A0A060X3Q3_ONCMY Loading...

PET100 cytochrome c oxidase chaperone

AlphaFold DB , UniProt , Accession A0A060X3Q3, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 80 aa.

						>A0A060X3Q3_ONCMY|A0A060X3Q3
MGVKIEVFRMMLYLSFPVTMFWISNQAEYFEEYIVKRKREIFPPDEKMHRKELEDFKERMRDRKERRLLKRMALEEAEKE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62	Low	86	Confident	212 Å²	212	120.7 Å²	120.7	100%	1.044	61%	0.611	S	S	*	*				0	-7.5	0	-65.6	-176.7	-173.9	0	0	114.2
2	G	78.1	Confident	86.6	Confident	52 Å²	52	118.3 Å²	118.3	54%	0.536	60%	0.6	S	S	.	*	H	α-helix	trans	-70.7	-34.4	-176.9	0	0	0	0	0	115.8	K4 I5 E6	G2-K4 VanDerWaalsContact C-N 3.31Å; G2-K4 PolarHBondContact O-N 2.85Å; G2-I5 PolarHBondContact O-N 3.3Å; G2-I5 VanDerWaalsContact O-N 3.13Å; G2-E6 PolarHBondContact O-N 2.97Å
3	V	83.9	Confident	86.9	Confident	111 Å²	111	122.5 Å²	122.5	67%	0.673	61%	0.606	S	S	*	*	H	α-helix	trans	-61.5	-37.9	-177.7	-178	0	0	0	0	112.3	I5 E6 V7	V3-I5 VanDerWaalsContact C-N 3.32Å; V3-I5 PolarHBondContact O-N 3.05Å; V3-E6 PolarHBondContact O-N 3.32Å; V3-V7 HydrophobicContact CG1-CG2 4.49Å; V3-V7 WeakPolarHBondContact O-CG2 3.3Å; V3-V7 PolarHBondContact O-N 3.43Å
4	K	85.8	Confident	87.1	Confident	178 Å²	178	122.5 Å²	122.5	77%	0.774	61%	0.609	S	S	*	*	H	α-helix	trans	-65.2	-36.7	178.3	-63.1	-173.7	-179.9	-173.3	0	112.1	G2 F8	G2-K4 VanDerWaalsContact C-N 3.31Å; G2-K4 PolarHBondContact O-N 2.85Å; K4-F8 WeakPolarHBondContact O-CB 3.36Å; K4-F8 PolarHBondContact O-N 3.35Å; K4-F8 VanDerWaalsContact O-N 3.12Å
5	I	91.9	Very high	87.4	Confident	116 Å²	116	117.9 Å²	117.9	60%	0.595	59%	0.593	S	S	*	*	H	α-helix	trans	-72.4	-37.5	177.8	-78.3	159.3	0	0	0	111	G2 V3 F8 R9	G2-I5 PolarHBondContact O-N 3.3Å; G2-I5 VanDerWaalsContact O-N 3.13Å; V3-I5 VanDerWaalsContact C-N 3.32Å; V3-I5 PolarHBondContact O-N 3.05Å; I5-F8 PolarHBondContact O-N 2.94Å; I5-R9 WeakPolarHBondContact O-CB 3.32Å; I5-R9 PolarHBondContact O-N 3.49Å
6	E	90.3	Very high	87.6	Confident	102 Å²	102	119 Å²	119	48%	0.477	59%	0.593	S	S	.	*	H	α-helix	trans	-66.7	-42.7	177.9	-171.4	150.9	88.3	0	0	112.3	G2 V3 R9 M10	G2-E6 PolarHBondContact O-N 2.97Å; V3-E6 PolarHBondContact O-N 3.32Å; E6-R9 PolarHBondContact O-N 3.3Å; E6-R9 IonicContact OE2-NH2 3.08Å; E6-R9 PolarHBondContact OE2-NH2 3.27Å; E6-M10 PolarHBondContact O-N 3.12Å
7	V	89.8	Confident	87.6	Confident	74 Å²	74	115.9 Å²	115.9	45%	0.448	58%	0.584	S	S	.	*	H	α-helix	trans	-64.1	-40.7	174.4	173.2	0	0	0	0	111.3	V3 R9 M10 M11	V3-V7 HydrophobicContact CG1-CG2 4.49Å; V3-V7 WeakPolarHBondContact O-CG2 3.3Å; V3-V7 PolarHBondContact O-N 3.43Å; V7-R9 PolarHBondContact O-N 2.95Å; V7-M10 PolarHBondContact O-N 3.39Å; V7-M11 HydrophobicContact CG1-CE 4.01Å; V7-M11 PolarHBondContact O-N 3.01Å
8	F	91.4	Very high	87.6	Confident	127 Å²	127	114.8 Å²	114.8	56%	0.557	58%	0.584	S	S	*	*	H	α-helix	trans	-61.8	-43.2	175	178.7	-107.4	0	0	0	112.2	K4 I5 M11 L12	K4-F8 WeakPolarHBondContact O-CB 3.36Å; K4-F8 PolarHBondContact O-N 3.35Å; K4-F8 VanDerWaalsContact O-N 3.12Å; I5-F8 PolarHBondContact O-N 2.94Å; F8-M11 PolarHBondContact O-N 3.13Å; F8-L12 HydrophobicContact CD1-CD1 3.94Å; F8-L12 HydrophobicContact CE1-CD1 3.37Å; F8-L12 HydrophobicContact CE1-CG 4.26Å; F8-L12 HydrophobicContact CE2-CD1 4.44Å; F8-L12 HydrophobicContact CZ-CD1 3.66Å; F8-L12 HydrophobicContact CZ-CG 4.17Å; F8-L12 PolarHBondContact O-N 3.4Å
9	R	90.4	Very high	87.6	Confident	118 Å²	118	112.6 Å²	112.6	45%	0.445	58%	0.576	S	S	.	*	H	α-helix	trans	-64.2	-41.2	176.8	-176.7	178.2	60.5	-175.5	-5.8	111.9	I5 E6 V7 L12 Y13	I5-R9 WeakPolarHBondContact O-CB 3.32Å; I5-R9 PolarHBondContact O-N 3.49Å; E6-R9 PolarHBondContact O-N 3.3Å; E6-R9 IonicContact OE2-NH2 3.08Å; E6-R9 PolarHBondContact OE2-NH2 3.27Å; V7-R9 PolarHBondContact O-N 2.95Å; R9-L12 PolarHBondContact O-N 3.34Å; R9-Y13 HydrophobicContact CG-CD2 3.67Å; R9-Y13 HydrophobicContact CG-CE2 3.31Å; R9-Y13 WeakPolarHBondContact O-CD2 3.44Å; R9-Y13 PolarHBondContact O-N 3.45Å
10	M	91.8	Very high	87.5	Confident	122 Å²	122	112.5 Å²	112.5	60%	0.601	58%	0.575	S	S	*	*	H	α-helix	trans	-62	-42.6	173.2	-83.4	-179.7	138.8	0	0	112.1	E6 V7 L12 Y13 L14	E6-M10 PolarHBondContact O-N 3.12Å; V7-M10 PolarHBondContact O-N 3.39Å; M10-L12 PolarHBondContact O-N 3.43Å; M10-Y13 PolarHBondContact O-N 2.93Å; M10-L14 WeakPolarHBondContact O-CB 2.92Å; M10-L14 VanDerWaalsContact O-CG 3.3Å; M10-L14 WeakPolarHBondContact O-CG 3.11Å; M10-L14 PolarHBondContact O-N 2.59Å
11	M	91	Very high	87.3	Confident	116 Å²	116	114 Å²	114	57%	0.571	58%	0.577	S	S	*	*	H	α-helix	trans	-62.5	-41.9	175.9	-82.5	-164.2	-86.8	0	0	112.5	V7 F8 L14 S15	V7-M11 HydrophobicContact CG1-CE 4.01Å; V7-M11 PolarHBondContact O-N 3.01Å; F8-M11 PolarHBondContact O-N 3.13Å; M11-L14 PolarHBondContact O-N 2.84Å; M11-S15 WeakPolarHBondContact O-CB 3.36Å; M11-S15 PolarHBondContact O-N 3.35Å; M11-S15 PolarHBondContact O-OG 2.84Å
12	L	92.2	Very high	88.2	Confident	91 Å²	91	113.1 Å²	113.1	48%	0.476	56%	0.563	S	S	.	*	H	α-helix	trans	-62.4	-46.4	175.6	-81.2	172	0	0	0	111.7	F8 R9 M10 L14 S15 F16	F8-L12 HydrophobicContact CD1-CD1 3.94Å; F8-L12 HydrophobicContact CE1-CD1 3.37Å; F8-L12 HydrophobicContact CE1-CG 4.26Å; F8-L12 HydrophobicContact CE2-CD1 4.44Å; F8-L12 HydrophobicContact CZ-CD1 3.66Å; F8-L12 HydrophobicContact CZ-CG 4.17Å; F8-L12 PolarHBondContact O-N 3.4Å; R9-L12 PolarHBondContact O-N 3.34Å; M10-L12 PolarHBondContact O-N 3.43Å; L12-L14 VanDerWaalsContact C-N 3.32Å; L12-L14 PolarHBondContact O-N 2.97Å; L12-S15 PolarHBondContact O-OG 3.36Å; L12-F16 WeakPolarHBondContact O-CB 3.37Å; L12-F16 PolarHBondContact O-N 3.01Å
13	Y	91.1	Very high	88.1	Confident	173 Å²	173	115.8 Å²	115.8	68%	0.678	56%	0.564	S	S	*	*	H	α-helix	trans	-68.9	-29	-179.9	-74.9	-54.8	0	0	0	113.8	R9 M10 P17	R9-Y13 HydrophobicContact CG-CD2 3.67Å; R9-Y13 HydrophobicContact CG-CE2 3.31Å; R9-Y13 WeakPolarHBondContact O-CD2 3.44Å; R9-Y13 PolarHBondContact O-N 3.45Å; M10-Y13 PolarHBondContact O-N 2.93Å; Y13-P17 WeakPolarHBondContact O-CD 3.29Å; Y13-P17 WeakPolarHBondContact O-CG 3.44Å
14	L	90.3	Very high	87.5	Confident	123 Å²	123	114.3 Å²	114.3	64%	0.644	56%	0.558	S	S	*	*	H	α-helix	trans	-82.1	-41.9	176.1	-72.9	167.7	0	0	0	112.1	M10 M11 L12 P17 V18	M10-L14 WeakPolarHBondContact O-CB 2.92Å; M10-L14 VanDerWaalsContact O-CG 3.3Å; M10-L14 WeakPolarHBondContact O-CG 3.11Å; M10-L14 PolarHBondContact O-N 2.59Å; M11-L14 PolarHBondContact O-N 2.84Å; L12-L14 VanDerWaalsContact C-N 3.32Å; L12-L14 PolarHBondContact O-N 2.97Å; L14-P17 WeakPolarHBondContact O-CD 3.34Å; L14-V18 VanDerWaalsContact O-CG2 3.29Å; L14-V18 WeakPolarHBondContact O-CG2 3.23Å
15	S	91.6	Very high	86.5	Confident	54 Å²	54	111.4 Å²	111.4	38%	0.378	55%	0.551	S	S	.	*	H	α-helix	trans	-71	-36.9	-179.7	58.3	0	0	0	0	112.1	M11 L12 V18 T19	M11-S15 WeakPolarHBondContact O-CB 3.36Å; M11-S15 PolarHBondContact O-N 3.35Å; M11-S15 PolarHBondContact O-OG 2.84Å; L12-S15 PolarHBondContact O-OG 3.36Å; S15-V18 PolarHBondContact O-N 3.38Å; S15-T19 WeakPolarHBondContact O-CB 3.22Å; S15-T19 PolarHBondContact O-N 2.67Å; S15-T19 PolarHBondContact O-OG1 2.95Å
16	F	89.6	Confident	84.9	Confident	135 Å²	135	111.2 Å²	111.2	59%	0.592	55%	0.547	S	S	*	.	H	α-helix	trans	-53.3	-59.1	-178.7	178.9	-95.7	0	0	0	113.8	L12 V18 T19 M20	L12-F16 WeakPolarHBondContact O-CB 3.37Å; L12-F16 PolarHBondContact O-N 3.01Å; F16-V18 VanDerWaalsContact C-N 3.33Å; F16-V18 PolarHBondContact O-N 2.99Å; F16-T19 PolarHBondContact O-N 2.9Å; F16-M20 HydrophobicContact CE1-SD 4.26Å; F16-M20 HydrophobicContact CZ-SD 4.07Å; F16-M20 WeakPolarHBondContact O-CB 3.18Å; F16-M20 PolarHBondContact O-N 3.45Å
17	P	88.8	Confident	83.3	Confident	67 Å²	67	109 Å²	109	44%	0.435	55%	0.546	S	S	.	.	H	α-helix	trans	-65.9	-34.7	-178.5	26.5	-34.7	0	0	0	112.5	Y13 L14 F21	Y13-P17 WeakPolarHBondContact O-CD 3.29Å; Y13-P17 WeakPolarHBondContact O-CG 3.44Å; L14-P17 WeakPolarHBondContact O-CD 3.34Å; P17-F21 VanDerWaalsContact O-CB 3.23Å; P17-F21 WeakPolarHBondContact O-CB 3.43Å; P17-F21 PolarHBondContact O-N 3.49Å
18	V	86.6	Confident	81.6	Confident	96 Å²	96	113.1 Å²	113.1	58%	0.582	56%	0.561	S	S	*	*	H	α-helix	trans	-67	-42.2	178	176.2	0	0	0	0	111.1	L14 S15 F16 F21 W22	L14-V18 VanDerWaalsContact O-CG2 3.29Å; L14-V18 WeakPolarHBondContact O-CG2 3.23Å; S15-V18 PolarHBondContact O-N 3.38Å; F16-V18 VanDerWaalsContact C-N 3.33Å; F16-V18 PolarHBondContact O-N 2.99Å; V18-F21 PolarHBondContact O-N 3.42Å; V18-W22 WeakPolarHBondContact O-CB 3.28Å; V18-W22 PolarHBondContact O-N 3.26Å
19	T	88.6	Confident	79.7	Confident	72 Å²	72	114.6 Å²	114.6	44%	0.442	56%	0.564	S	S	.	*	H	α-helix	trans	-71.5	-40.3	178.7	-39.3	0	0	0	0	110.6	S15 F16 F21 W22 I23	S15-T19 WeakPolarHBondContact O-CB 3.22Å; S15-T19 PolarHBondContact O-N 2.67Å; S15-T19 PolarHBondContact O-OG1 2.95Å; F16-T19 PolarHBondContact O-N 2.9Å; T19-F21 VanDerWaalsContact C-N 3.32Å; T19-F21 PolarHBondContact O-N 2.82Å; T19-W22 PolarHBondContact O-N 2.91Å; T19-I23 HydrophobicContact CG2-CD1 4.03Å; T19-I23 WeakPolarHBondContact O-CB 3.2Å; T19-I23 WeakPolarHBondContact O-CD1 3.48Å; T19-I23 VanDerWaalsContact O-CG1 3.28Å; T19-I23 WeakPolarHBondContact O-CG1 3.38Å; T19-I23 PolarHBondContact O-N 2.91Å
20	M	85.6	Confident	78	Confident	110 Å²	110	115.4 Å²	115.4	54%	0.542	57%	0.571	S	S	.	*	H	α-helix	trans	-61.5	-42	174.6	-121.3	-156.6	156.1	0	0	111.7	F16 S24	F16-M20 HydrophobicContact CE1-SD 4.26Å; F16-M20 HydrophobicContact CZ-SD 4.07Å; F16-M20 WeakPolarHBondContact O-CB 3.18Å; F16-M20 PolarHBondContact O-N 3.45Å; M20-S24 VanDerWaalsContact O-CB 3.27Å; M20-S24 WeakPolarHBondContact O-CB 3.3Å; M20-S24 PolarHBondContact O-N 3.34Å; M20-S24 PolarHBondContact O-OG 3.01Å
21	F	81.8	Confident	76.2	Confident	145 Å²	145	116.5 Å²	116.5	64%	0.636	58%	0.575	S	S	*	*	H	α-helix	trans	-65.3	-42.3	175.5	-175.1	-99	0	0	0	111.4	P17 V18 T19 S24 N25	P17-F21 VanDerWaalsContact O-CB 3.23Å; P17-F21 WeakPolarHBondContact O-CB 3.43Å; P17-F21 PolarHBondContact O-N 3.49Å; V18-F21 PolarHBondContact O-N 3.42Å; T19-F21 VanDerWaalsContact C-N 3.32Å; T19-F21 PolarHBondContact O-N 2.82Å; F21-S24 PolarHBondContact O-N 3.33Å; F21-N25 WeakPolarHBondContact O-CB 3.27Å; F21-N25 PolarHBondContact O-N 2.92Å
22	W	81.1	Confident	74.7	Confident	194 Å²	194	117.5 Å²	117.5	74%	0.735	58%	0.578	S	S	*	*	H	α-helix	trans	-62.3	-45.5	177.4	-166.1	-85.3	0	0	0	112.8	V18 T19 N25 Q26	V18-W22 WeakPolarHBondContact O-CB 3.28Å; V18-W22 PolarHBondContact O-N 3.26Å; T19-W22 PolarHBondContact O-N 2.91Å; W22-N25 PolarHBondContact O-N 3.47Å; W22-Q26 PolarHBondContact O-N 3.46Å
23	I	77.3	Confident	73	Confident	108 Å²	108	119.7 Å²	119.7	55%	0.554	58%	0.581	S	S	*	*	H	α-helix	trans	-64.1	-42.6	176.1	-68.3	160.9	0	0	0	110.7	T19 N25 Q26	T19-I23 HydrophobicContact CG2-CD1 4.03Å; T19-I23 WeakPolarHBondContact O-CB 3.2Å; T19-I23 WeakPolarHBondContact O-CD1 3.48Å; T19-I23 VanDerWaalsContact O-CG1 3.28Å; T19-I23 WeakPolarHBondContact O-CG1 3.38Å; T19-I23 PolarHBondContact O-N 2.91Å; I23-N25 VanDerWaalsContact C-N 3.34Å; I23-Q26 VanDerWaalsContact O-CB 3.3Å; I23-Q26 WeakPolarHBondContact O-CB 3.42Å; I23-Q26 PolarHBondContact O-N 3.16Å
24	S	69.6	Low	71.5	Confident	80 Å²	80	115 Å²	115	56%	0.559	57%	0.567	S	S	*	*	H	α-helix	trans	-73.4	-26.7	-179.2	-53.8	0	0	0	0	112.9	M20 F21 Q26 A27	M20-S24 VanDerWaalsContact O-CB 3.27Å; M20-S24 WeakPolarHBondContact O-CB 3.3Å; M20-S24 PolarHBondContact O-N 3.34Å; M20-S24 PolarHBondContact O-OG 3.01Å; F21-S24 PolarHBondContact O-N 3.33Å; S24-Q26 PolarHBondContact O-N 3.4Å; S24-A27 PolarHBondContact O-N 2.95Å
25	N	65.4	Low	70.1	Confident	117 Å²	117	113.5 Å²	113.5	63%	0.626	56%	0.563	S	S	*	*	H	α-helix	trans	-72.9	-14.8	175.1	-163.3	38.4	0	0	0	112.2	F21 W22 I23 A27	F21-N25 WeakPolarHBondContact O-CB 3.27Å; F21-N25 PolarHBondContact O-N 2.92Å; W22-N25 PolarHBondContact O-N 3.47Å; I23-N25 VanDerWaalsContact C-N 3.34Å; N25-A27 PolarHBondContact O-N 3.46Å
26	Q	59	Low	68.5	Low	111 Å²	111	118 Å²	118	52%	0.519	58%	0.575	S	S	.	*			trans	-75	33.3	168.1	-148.3	178.3	-15.3	0	0	112.1	W22 I23 S24 E28 Y29	W22-Q26 PolarHBondContact O-N 3.46Å; I23-Q26 VanDerWaalsContact O-CB 3.3Å; I23-Q26 WeakPolarHBondContact O-CB 3.42Å; I23-Q26 PolarHBondContact O-N 3.16Å; S24-Q26 PolarHBondContact O-N 3.4Å; Q26-E28 PolarHBondContact O-N 3.43Å; Q26-Y29 PolarHBondContact O-N 3.29Å; Q26-Y29 VanDerWaalsContact O-N 3.16Å
27	A	55.3	Low	67.1	Low	55 Å²	55	117.3 Å²	117.3	46%	0.455	57%	0.569	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64.3	3.2	171.4	0	0	0	0	0	113.2	S24 N25 Y29 F30	S24-A27 PolarHBondContact O-N 2.95Å; N25-A27 PolarHBondContact O-N 3.46Å; A27-Y29 PolarHBondContact O-N 2.72Å; A27-F30 WeakPolarHBondContact O-CB 3.2Å; A27-F30 PolarHBondContact O-N 3.35Å
28	E	55.1	Low	65.7	Low	162 Å²	162	121 Å²	121	76%	0.757	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58	-26.6	162.3	-158.7	167.9	97.4	0	0	111.7	Q26 F30 E31	Q26-E28 PolarHBondContact O-N 3.43Å; E28-F30 PolarHBondContact O-N 3.32Å; E28-E31 PolarHBondContact O-N 3.49Å
29	Y	52.4	Low	64.4	Low	158 Å²	158	124.6 Å²	124.6	62%	0.62	58%	0.581	S	S	*	*	H	α-helix	trans	-71.6	-13.7	170.2	-96.8	-77.4	0	0	0	114.5	Q26 A27 Y33	Q26-Y29 PolarHBondContact O-N 3.29Å; Q26-Y29 VanDerWaalsContact O-N 3.16Å; A27-Y29 PolarHBondContact O-N 2.72Å; Y29-Y33 PolarHBondContact O-N 2.95Å
30	F	53.1	Low	63	Low	134 Å²	134	128.8 Å²	128.8	59%	0.588	60%	0.596	S	S	*	*	H	α-helix	trans	-79.2	-22.5	177.6	-123.9	-90.5	0	0	0	112.1	A27 E28 I34	A27-F30 WeakPolarHBondContact O-CB 3.2Å; A27-F30 PolarHBondContact O-N 3.35Å; E28-F30 PolarHBondContact O-N 3.32Å; F30-I34 HydrophobicContact CD1-CD1 3.63Å; F30-I34 HydrophobicContact CD1-CG1 3.88Å; F30-I34 HydrophobicContact CE1-CD1 3.83Å; F30-I34 HydrophobicContact CE1-CG1 4.16Å; F30-I34 WeakPolarHBondContact O-CB 3.48Å; F30-I34 PolarHBondContact O-N 2.91Å; F30-I34 VanDerWaalsContact O-N 3.12Å
31	E	55.6	Low	62	Low	145 Å²	145	129 Å²	129	68%	0.678	60%	0.598	S	S	*	*	H	α-helix	trans	-67.9	-48.7	173	-74.1	-162.6	162.1	0	0	110.9	E28 Y33 V35	E28-E31 PolarHBondContact O-N 3.49Å; E31-Y33 VanDerWaalsContact C-N 3.33Å; E31-Y33 PolarHBondContact O-N 2.9Å; E31-V35 WeakPolarHBondContact O-CB 3.14Å; E31-V35 WeakPolarHBondContact O-CG2 3.32Å; E31-V35 PolarHBondContact O-N 3.03Å
32	E	58.6	Low	60.8	Low	138 Å²	138	129.5 Å²	129.5	65%	0.645	60%	0.6	S	S	*	*	H	α-helix	trans	-63.1	-39.2	179.9	-75	-164	167.4	0	0	112.5	K36	E32-K36 WeakPolarHBondContact O-CB 3.27Å; E32-K36 PolarHBondContact O-N 2.81Å
33	Y	57.2	Low	59.8	Low	136 Å²	136	124.3 Å²	124.3	53%	0.533	59%	0.591	S	S	.	*	H	α-helix	trans	-75.8	-38.1	-176.3	-170.2	-117	0	0	0	113.3	Y29 E31 R37	Y29-Y33 PolarHBondContact O-N 2.95Å; E31-Y33 VanDerWaalsContact C-N 3.33Å; E31-Y33 PolarHBondContact O-N 2.9Å; Y33-R37 VanDerWaalsContact O-CB 3.27Å; Y33-R37 WeakPolarHBondContact O-CB 3.06Å; Y33-R37 PolarHBondContact O-N 3.12Å; Y33-R37 PolarHBondContact OH-NH2 2.99Å
34	I	59.3	Low	59	Low	76 Å²	76	123.8 Å²	123.8	39%	0.39	60%	0.595	S	S	.	*	H	α-helix	trans	-73.2	-37.8	173	-67.5	-169.5	0	0	0	111	F30 R37 K38	F30-I34 HydrophobicContact CD1-CD1 3.63Å; F30-I34 HydrophobicContact CD1-CG1 3.88Å; F30-I34 HydrophobicContact CE1-CD1 3.83Å; F30-I34 HydrophobicContact CE1-CG1 4.16Å; F30-I34 WeakPolarHBondContact O-CB 3.48Å; F30-I34 PolarHBondContact O-N 2.91Å; F30-I34 VanDerWaalsContact O-N 3.12Å; I34-R37 PolarHBondContact O-N 3.36Å; I34-K38 VanDerWaalsContact O-CB 3.3Å; I34-K38 WeakPolarHBondContact O-CB 3.36Å; I34-K38 PolarHBondContact O-N 3.45Å
35	V	59.4	Low	58.6	Low	91 Å²	91	123.8 Å²	123.8	55%	0.552	59%	0.588	S	S	*	*	H	α-helix	trans	-66.8	-41.1	177.7	173.4	0	0	0	0	110.9	E31 R39	E31-V35 WeakPolarHBondContact O-CB 3.14Å; E31-V35 WeakPolarHBondContact O-CG2 3.32Å; E31-V35 PolarHBondContact O-N 3.03Å; V35-R39 WeakPolarHBondContact O-CB 3.16Å; V35-R39 PolarHBondContact O-N 3.03Å
36	K	58.5	Low	58.2	Low	149 Å²	149	125.5 Å²	125.5	65%	0.648	59%	0.593	S	S	*	*	H	α-helix	trans	-62.5	-47.5	171.6	-107.1	178.5	171.9	174.7	0	112.2	E32 R39 E40	E32-K36 WeakPolarHBondContact O-CB 3.27Å; E32-K36 PolarHBondContact O-N 2.81Å; K36-R39 CarbonylContact O-C 3.57Å; K36-R39 WeakPolarHBondContact O-CB 3.47Å; K36-R39 PolarHBondContact O-N 3.4Å; K36-R39 VanDerWaalsContact O-N 3.12Å; K36-E40 PolarHBondContact O-N 2.78Å
37	R	59.8	Low	58.1	Low	120 Å²	120	129.4 Å²	129.4	45%	0.453	61%	0.608	S	S	.	*	H	α-helix	trans	-66.4	-40.1	-179.1	-165.2	-168.3	-69.4	175.5	-15	112.2	Y33 I34 R39 E40 I41	Y33-R37 VanDerWaalsContact O-CB 3.27Å; Y33-R37 WeakPolarHBondContact O-CB 3.06Å; Y33-R37 PolarHBondContact O-N 3.12Å; Y33-R37 PolarHBondContact OH-NH2 2.99Å; I34-R37 PolarHBondContact O-N 3.36Å; R37-R39 VanDerWaalsContact C-N 3.28Å; R37-R39 PolarHBondContact O-N 2.9Å; R37-E40 PolarHBondContact O-N 3.4Å; R37-I41 HydrophobicContact CG-CD1 3.96Å; R37-I41 WeakPolarHBondContact O-CB 3.33Å; R37-I41 VanDerWaalsContact O-CG1 3.28Å; R37-I41 WeakPolarHBondContact O-CG1 3.28Å; R37-I41 PolarHBondContact O-N 2.93Å
38	K	59.3	Low	58.4	Low	144 Å²	144	132.9 Å²	132.9	63%	0.626	62%	0.617	S	S	*	*	H	α-helix	trans	-61.3	-37.9	171.3	-100.8	-168.6	172.5	-174.7	0	111.3	I34 F42	I34-K38 VanDerWaalsContact O-CB 3.3Å; I34-K38 WeakPolarHBondContact O-CB 3.36Å; I34-K38 PolarHBondContact O-N 3.45Å; K38-F42 WeakPolarHBondContact O-CA 3.48Å; K38-F42 WeakPolarHBondContact O-CB 3.3Å; K38-F42 PolarHBondContact O-N 3.12Å
39	R	60	Low	58.8	Low	171 Å²	171	130 Å²	130	65%	0.645	60%	0.603	S	S	*	*	H	α-helix	trans	-74.6	-26.4	179.9	-169.1	176.8	-172.2	172.3	2.7	113.9	V35 K36 R37 F42	V35-R39 WeakPolarHBondContact O-CB 3.16Å; V35-R39 PolarHBondContact O-N 3.03Å; K36-R39 CarbonylContact O-C 3.57Å; K36-R39 WeakPolarHBondContact O-CB 3.47Å; K36-R39 PolarHBondContact O-N 3.4Å; K36-R39 VanDerWaalsContact O-N 3.12Å; R37-R39 VanDerWaalsContact C-N 3.28Å; R37-R39 PolarHBondContact O-N 2.9Å; R39-F42 CarbonylContact C-O 3.59Å; R39-F42 CarbonylContact O-C 3.44Å; R39-F42 VanDerWaalsContact O-O 3.05Å
40	E	60.2	Low	59.6	Low	160 Å²	160	130.4 Å²	130.4	75%	0.748	60%	0.603	S	S	*	*	H	α-helix	trans	-77.2	-39.1	170	-83.7	-179.9	93.8	0	0	112.3	K36 R37	K36-E40 PolarHBondContact O-N 2.78Å; R37-E40 PolarHBondContact O-N 3.4Å
41	I	63.4	Low	60.7	Low	116 Å²	116	130.4 Å²	130.4	60%	0.595	60%	0.603	S	S	*	*	H	α-helix	trans	-76.2	-36	179.3	-64.8	169.2	0	0	0	111.5	R37 P43	R37-I41 HydrophobicContact CG-CD1 3.96Å; R37-I41 WeakPolarHBondContact O-CB 3.33Å; R37-I41 VanDerWaalsContact O-CG1 3.28Å; R37-I41 WeakPolarHBondContact O-CG1 3.28Å; R37-I41 PolarHBondContact O-N 2.93Å; I41-P43 WeakPolarHBondContact O-CD 3.36Å
42	F	56.7	Low	61.8	Low	155 Å²	155	128.3 Å²	128.3	68%	0.68	59%	0.593	S	S	*	*	S	Bend	trans	-112.1	87.2	171.1	-70.8	-89.2	0	0	0	108.3	K38 R39	K38-F42 WeakPolarHBondContact O-CA 3.48Å; K38-F42 WeakPolarHBondContact O-CB 3.3Å; K38-F42 PolarHBondContact O-N 3.12Å; R39-F42 CarbonylContact C-O 3.59Å; R39-F42 CarbonylContact O-C 3.44Å; R39-F42 VanDerWaalsContact O-O 3.05Å
43	P	59.7	Low	62.9	Low	84 Å²	84	127.7 Å²	127.7	55%	0.545	59%	0.594	S	S	.	*			trans	-54.2	137.5	171.7	21.9	-30.9	0	0	0	108.5	I41 D45	I41-P43 WeakPolarHBondContact O-CD 3.36Å; P43-D45 PolarHBondContact O-N 3.08Å
44	P	62.3	Low	64.2	Low	97 Å²	97	126.1 Å²	126.1	63%	0.63	59%	0.591	S	S	*	*			trans	-71.7	65.2	175.2	29.8	-33.4	0	0	0	109.6	E46	P44-E46 VanDerWaalsContact C-N 3.29Å; P44-E46 PolarHBondContact O-N 3.22Å
45	D	59.3	Low	65.6	Low	80 Å²	80	125.7 Å²	125.7	43%	0.428	59%	0.59	S	S	.	*			trans	-88.4	71	173.3	-143.7	-56	0	0	0	108.6	P43 H49	P43-D45 PolarHBondContact O-N 3.08Å; D45-H49 PolarHBondContact O-CD2 2.99Å
46	E	57.9	Low	67	Low	154 Å²	154	126.9 Å²	126.9	72%	0.72	59%	0.588	S	S	*	*			trans	-129.2	24.8	177.1	-77.7	-169.8	166.8	0	0	112.6	P44 R50	P44-E46 VanDerWaalsContact C-N 3.29Å; P44-E46 PolarHBondContact O-N 3.22Å; E46-R50 WeakPolarHBondContact O-CB 3.2Å
47	K	57.8	Low	68.5	Low	192 Å²	192	127.6 Å²	127.6	84%	0.835	59%	0.591	S	S	*	*	S	Bend	trans	-98.9	-42.4	162.3	-69.3	-170.9	179.9	-177.4	0	111.9	K51	K47-K51 PolarHBondContact O-N 3.39Å
48	M	60.4	Low	70.1	Confident	129 Å²	129	126.9 Å²	126.9	64%	0.635	59%	0.593	S	S	*	*	H	α-helix	trans	-72.5	-51.7	174.5	-92.1	-165.6	76.5	0	0	111.7	R50 K51 E52	M48-R50 PolarHBondContact O-N 3.2Å; M48-K51 PolarHBondContact O-N 3.34Å; M48-K51 VanDerWaalsContact O-N 3.07Å; M48-E52 WeakPolarHBondContact O-CG 3.49Å; M48-E52 PolarHBondContact O-N 2.92Å
49	H	64.1	Low	71.6	Confident	100 Å²	100	126.9 Å²	126.9	46%	0.463	59%	0.589	S	S	.	*	H	α-helix	trans	-61.5	-32.3	179.9	-71.7	-38.8	0	0	0	113.7	D45 E52 L53	D45-H49 PolarHBondContact O-CD2 2.99Å; H49-E52 IonicContact CE1-OE2 3.84Å; H49-E52 IonicContact ND1-OE2 3.87Å; H49-E52 PolarHBondContact ND1-OE2 2.89Å; H49-E52 PolarHBondContact O-N 2.72Å; H49-L53 WeakPolarHBondContact O-CB 3.47Å; H49-L53 PolarHBondContact O-N 2.89Å
50	R	68.9	Low	73.1	Confident	167 Å²	167	123 Å²	123	63%	0.63	58%	0.579	S	S	*	*	H	α-helix	trans	-65.3	-43.3	174.8	-176	171.4	174.7	172.2	1.3	112	E46 M48 L53 E54	E46-R50 WeakPolarHBondContact O-CB 3.2Å; M48-R50 PolarHBondContact O-N 3.2Å; R50-L53 PolarHBondContact O-N 3.35Å; R50-E54 IonicContact CZ-OE1 3.04Å; R50-E54 IonicContact NE-OE1 3.93Å; R50-E54 PolarHBondContact NE-OE1 3.23Å; R50-E54 VanDerWaalsContact NE-OE1 3.08Å; R50-E54 IonicContact NH2-OE1 2.85Å; R50-E54 WeakPolarHBondContact O-CB 3.48Å; R50-E54 WeakPolarHBondContact O-CG 3.33Å; R50-E54 PolarHBondContact O-N 3.44Å
51	K	76.1	Confident	74.6	Confident	135 Å²	135	122.2 Å²	122.2	59%	0.587	57%	0.569	S	S	*	*	H	α-helix	trans	-64.6	-42.3	176.1	-170.1	177.8	178.9	-176.9	0	111.3	K47 M48 L53 E54 D55	K47-K51 PolarHBondContact O-N 3.39Å; M48-K51 PolarHBondContact O-N 3.34Å; M48-K51 VanDerWaalsContact O-N 3.07Å; K51-L53 VanDerWaalsContact C-N 3.34Å; K51-L53 PolarHBondContact O-N 3.37Å; K51-E54 PolarHBondContact O-N 2.99Å; K51-D55 WeakPolarHBondContact O-CB 3.47Å; K51-D55 VanDerWaalsContact O-CG 3.24Å; K51-D55 PolarHBondContact O-N 3.04Å
52	E	79.4	Confident	75.9	Confident	101 Å²	101	119.9 Å²	119.9	47%	0.472	56%	0.558	S	S	.	*	H	α-helix	trans	-63.5	-38.9	176.7	-67.2	179.9	136.3	0	0	112.7	M48 H49 F56	M48-E52 WeakPolarHBondContact O-CG 3.49Å; M48-E52 PolarHBondContact O-N 2.92Å; H49-E52 IonicContact CE1-OE2 3.84Å; H49-E52 IonicContact ND1-OE2 3.87Å; H49-E52 PolarHBondContact ND1-OE2 2.89Å; H49-E52 PolarHBondContact O-N 2.72Å; E52-F56 VanDerWaalsContact O-CB 3.29Å; E52-F56 WeakPolarHBondContact O-CB 3.41Å; E52-F56 PolarHBondContact O-N 2.88Å
53	L	80.6	Confident	77.6	Confident	125 Å²	125	119.4 Å²	119.4	65%	0.654	55%	0.552	S	S	*	*	H	α-helix	trans	-67.9	-43.3	175.1	-115.9	106.7	0	0	0	112.2	H49 R50 K51 F56 K57	H49-L53 WeakPolarHBondContact O-CB 3.47Å; H49-L53 PolarHBondContact O-N 2.89Å; R50-L53 PolarHBondContact O-N 3.35Å; K51-L53 VanDerWaalsContact C-N 3.34Å; K51-L53 PolarHBondContact O-N 3.37Å; L53-F56 PolarHBondContact O-N 2.93Å; L53-K57 WeakPolarHBondContact O-CB 3.38Å; L53-K57 PolarHBondContact O-N 3.45Å
54	E	84.6	Confident	79	Confident	103 Å²	103	123 Å²	123	48%	0.481	56%	0.559	S	S	.	*	H	α-helix	trans	-62.1	-47.5	177.2	-76.3	174.8	-171.7	0	0	110.4	R50 K51 F56 K57 E58	R50-E54 IonicContact CZ-OE1 3.04Å; R50-E54 IonicContact NE-OE1 3.93Å; R50-E54 PolarHBondContact NE-OE1 3.23Å; R50-E54 VanDerWaalsContact NE-OE1 3.08Å; R50-E54 IonicContact NH2-OE1 2.85Å; R50-E54 WeakPolarHBondContact O-CB 3.48Å; R50-E54 WeakPolarHBondContact O-CG 3.33Å; R50-E54 PolarHBondContact O-N 3.44Å; K51-E54 PolarHBondContact O-N 2.99Å; E54-F56 VanDerWaalsContact C-N 3.33Å; E54-F56 PolarHBondContact O-N 3.07Å; E54-K57 WeakPolarHBondContact O-CB 3.46Å; E54-K57 PolarHBondContact O-N 3.4Å; E54-E58 PolarHBondContact O-N 3.32Å
55	D	89.1	Confident	80.4	Confident	67 Å²	67	123.2 Å²	123.2	36%	0.358	55%	0.551	S	S	.	*	H	α-helix	trans	-62.2	-39.1	175.9	-71.2	-10.4	0	0	0	111.7	K51 R59	K51-D55 WeakPolarHBondContact O-CB 3.47Å; K51-D55 VanDerWaalsContact O-CG 3.24Å; K51-D55 PolarHBondContact O-N 3.04Å; D55-R59 WeakPolarHBondContact O-CG 3.42Å; D55-R59 PolarHBondContact O-N 3.46Å; D55-R59 VanDerWaalsContact O-N 3.11Å; D55-R59 PolarHBondContact O-NH1 3.21Å
56	F	89.4	Confident	81.9	Confident	115 Å²	115	127.7 Å²	127.7	50%	0.504	56%	0.562	S	S	.	*	H	α-helix	trans	-66.2	-41.4	175.9	-178.9	-101	0	0	0	112.2	E52 L53 E54 E58 R59 M60	E52-F56 VanDerWaalsContact O-CB 3.29Å; E52-F56 WeakPolarHBondContact O-CB 3.41Å; E52-F56 PolarHBondContact O-N 2.88Å; L53-F56 PolarHBondContact O-N 2.93Å; E54-F56 VanDerWaalsContact C-N 3.33Å; E54-F56 PolarHBondContact O-N 3.07Å; F56-E58 VanDerWaalsContact C-N 3.35Å; F56-R59 PolarHBondContact O-N 3.13Å; F56-M60 HydrophobicContact CD1-CG 4.24Å; F56-M60 HydrophobicContact CE1-CG 3.79Å; F56-M60 HydrophobicContact CE2-CG 4.18Å; F56-M60 HydrophobicContact CZ-CG 3.76Å; F56-M60 HydrophobicContact CZ-SD 4.16Å; F56-M60 WeakPolarHBondContact O-CG 3.4Å; F56-M60 PolarHBondContact O-N 3.23Å
57	K	90.6	Very high	83.4	Confident	164 Å²	164	128.1 Å²	128.1	71%	0.713	56%	0.557	S	S	*	*	H	α-helix	trans	-63.2	-42	178.3	-173.2	179.2	179.8	-178.3	0	111.3	L53 E54 M60 R61	L53-K57 WeakPolarHBondContact O-CB 3.38Å; L53-K57 PolarHBondContact O-N 3.45Å; E54-K57 WeakPolarHBondContact O-CB 3.46Å; E54-K57 PolarHBondContact O-N 3.4Å; K57-M60 PolarHBondContact O-N 2.95Å; K57-R61 PolarHBondContact O-N 2.99Å
58	E	92	Very high	85	Confident	106 Å²	106	123.8 Å²	123.8	50%	0.495	54%	0.543	S	S	.	.	H	α-helix	trans	-63.9	-48.5	176.5	-171	168.2	-149.9	0	0	111.5	E54 F56 M60 R61 D62	E54-E58 PolarHBondContact O-N 3.32Å; F56-E58 VanDerWaalsContact C-N 3.35Å; E58-M60 VanDerWaalsContact C-N 3.25Å; E58-M60 PolarHBondContact O-N 3.46Å; E58-R61 WeakPolarHBondContact O-CB 3.4Å; E58-R61 PolarHBondContact O-N 3.07Å; E58-D62 PolarHBondContact O-N 3.29Å
59	R	91.9	Very high	86.4	Confident	143 Å²	143	122.9 Å²	122.9	54%	0.54	54%	0.54	S	S	.	.	H	α-helix	trans	-56.5	-38.4	175.7	-72.9	-169.9	-59.1	-92	5.7	113.1	D55 F56 R63	D55-R59 WeakPolarHBondContact O-CG 3.42Å; D55-R59 PolarHBondContact O-N 3.46Å; D55-R59 VanDerWaalsContact O-N 3.11Å; D55-R59 PolarHBondContact O-NH1 3.21Å; F56-R59 PolarHBondContact O-N 3.13Å; R59-R63 WeakPolarHBondContact O-CB 3.43Å; R59-R63 PolarHBondContact O-N 2.93Å
60	M	90.8	Very high	87.6	Confident	89 Å²	89	125.2 Å²	125.2	44%	0.438	55%	0.549	S	S	.	.	H	α-helix	trans	-72.1	-35.6	178.6	-74	-63.3	-72.5	0	0	112.3	F56 K57 E58 K64	F56-M60 HydrophobicContact CD1-CG 4.24Å; F56-M60 HydrophobicContact CE1-CG 3.79Å; F56-M60 HydrophobicContact CE2-CG 4.18Å; F56-M60 HydrophobicContact CZ-CG 3.76Å; F56-M60 HydrophobicContact CZ-SD 4.16Å; F56-M60 WeakPolarHBondContact O-CG 3.4Å; F56-M60 PolarHBondContact O-N 3.23Å; K57-M60 PolarHBondContact O-N 2.95Å; E58-M60 VanDerWaalsContact C-N 3.25Å; E58-M60 PolarHBondContact O-N 3.46Å; M60-K64 PolarHBondContact O-N 3.06Å
61	R	91.3	Very high	88.6	Confident	144 Å²	144	125.5 Å²	125.5	54%	0.543	55%	0.55	S	S	.	.	H	α-helix	trans	-63.1	-50.7	174.6	-173.6	174.6	69.8	-177.7	-0.2	110.9	K57 E58 R63 K64 E65	K57-R61 PolarHBondContact O-N 2.99Å; E58-R61 WeakPolarHBondContact O-CB 3.4Å; E58-R61 PolarHBondContact O-N 3.07Å; R61-R63 VanDerWaalsContact C-N 3.28Å; R61-R63 PolarHBondContact O-N 3.02Å; R61-K64 WeakPolarHBondContact O-CA 3.49Å; R61-K64 WeakPolarHBondContact O-CB 3.45Å; R61-K64 PolarHBondContact O-N 3.02Å; R61-E65 WeakPolarHBondContact CG-OE1 3.36Å; R61-E65 PolarHBondContact O-N 3.17Å
62	D	91.6	Very high	89	Confident	68 Å²	68	123 Å²	123	36%	0.364	54%	0.541	S	S	.	.	H	α-helix	trans	-58	-41.4	178.4	-82	20.5	0	0	0	112.2	E58 K64 E65 R66	E58-D62 PolarHBondContact O-N 3.29Å; D62-K64 VanDerWaalsContact C-N 3.31Å; D62-K64 PolarHBondContact O-N 3.22Å; D62-E65 PolarHBondContact O-N 3.42Å; D62-R66 WeakPolarHBondContact O-CB 3.33Å; D62-R66 VanDerWaalsContact O-CG 3.28Å; D62-R66 WeakPolarHBondContact O-CG 3.25Å; D62-R66 PolarHBondContact O-N 2.87Å
63	R	90.9	Very high	89.4	Confident	145 Å²	145	120.7 Å²	120.7	55%	0.547	54%	0.539	S	S	.	.	H	α-helix	trans	-64.6	-37.6	176.9	-173	178.3	-70.4	-178.4	-3.3	111.7	R59 R61 R67	R59-R63 WeakPolarHBondContact O-CB 3.43Å; R59-R63 PolarHBondContact O-N 2.93Å; R61-R63 VanDerWaalsContact C-N 3.28Å; R61-R63 PolarHBondContact O-N 3.02Å; R63-R67 WeakPolarHBondContact O-CB 3.41Å; R63-R67 VanDerWaalsContact O-CG 3.28Å; R63-R67 WeakPolarHBondContact O-CG 3.47Å; R63-R67 PolarHBondContact O-N 3.47Å; R63-R67 VanDerWaalsContact O-N 3.13Å
64	K	90.8	Very high	89.6	Confident	160 Å²	160	120.1 Å²	120.1	70%	0.696	54%	0.536	S	S	*	.	H	α-helix	trans	-68.6	-45.4	178	-169.4	-178.2	179.4	-174.8	0	111	M60 R61 D62 R67 L68	M60-K64 PolarHBondContact O-N 3.06Å; R61-K64 WeakPolarHBondContact O-CA 3.49Å; R61-K64 WeakPolarHBondContact O-CB 3.45Å; R61-K64 PolarHBondContact O-N 3.02Å; D62-K64 VanDerWaalsContact C-N 3.31Å; D62-K64 PolarHBondContact O-N 3.22Å; K64-R67 PolarHBondContact O-N 3.39Å; K64-L68 PolarHBondContact O-N 3.03Å
65	E	91	Very high	89.5	Confident	101 Å²	101	120.1 Å²	120.1	47%	0.472	54%	0.536	S	S	.	.	H	α-helix	trans	-62.3	-46.2	178	-71.1	176.7	-173.8	0	0	111.6	R61 D62 R67 L68 L69	R61-E65 WeakPolarHBondContact CG-OE1 3.36Å; R61-E65 PolarHBondContact O-N 3.17Å; D62-E65 PolarHBondContact O-N 3.42Å; E65-R67 VanDerWaalsContact C-N 3.29Å; E65-R67 PolarHBondContact O-N 3.11Å; E65-L68 PolarHBondContact O-N 3.4Å; E65-L68 VanDerWaalsContact O-N 3.13Å; E65-L69 WeakPolarHBondContact O-CG 3.48Å; E65-L69 PolarHBondContact O-N 2.94Å
66	R	90.3	Very high	89.2	Confident	174 Å²	174	123.6 Å²	123.6	66%	0.657	55%	0.55	S	S	*	*	H	α-helix	trans	-60.1	-37.6	174.7	-72.3	175.3	-176.8	-109	3.2	112.9	D62 K70	D62-R66 WeakPolarHBondContact O-CB 3.33Å; D62-R66 VanDerWaalsContact O-CG 3.28Å; D62-R66 WeakPolarHBondContact O-CG 3.25Å; D62-R66 PolarHBondContact O-N 2.87Å; R66-K70 WeakPolarHBondContact O-CB 3.29Å; R66-K70 VanDerWaalsContact O-CG 3.32Å; R66-K70 WeakPolarHBondContact O-CG 3.43Å; R66-K70 PolarHBondContact O-N 3.44Å; R66-K70 VanDerWaalsContact O-N 3.08Å
67	R	90.2	Very high	88.6	Confident	163 Å²	163	121.2 Å²	121.2	62%	0.615	55%	0.552	S	S	*	*	H	α-helix	trans	-68	-39.2	175.8	-78.7	176.3	177	-172.9	-1.3	111.8	R63 K64 E65 R71	R63-R67 WeakPolarHBondContact O-CB 3.41Å; R63-R67 VanDerWaalsContact O-CG 3.28Å; R63-R67 WeakPolarHBondContact O-CG 3.47Å; R63-R67 PolarHBondContact O-N 3.47Å; R63-R67 VanDerWaalsContact O-N 3.13Å; K64-R67 PolarHBondContact O-N 3.39Å; E65-R67 VanDerWaalsContact C-N 3.29Å; E65-R67 PolarHBondContact O-N 3.11Å; R67-R71 WeakPolarHBondContact O-CG 3.48Å; R67-R71 PolarHBondContact O-N 3.38Å; R67-R71 VanDerWaalsContact O-N 3.1Å
68	L	90.9	Very high	87.6	Confident	101 Å²	101	121.2 Å²	121.2	53%	0.529	55%	0.554	S	S	.	*	H	α-helix	trans	-66.3	-47.7	177.3	-172.3	68.6	0	0	0	110.9	K64 E65 K70 R71 M72	K64-L68 PolarHBondContact O-N 3.03Å; E65-L68 PolarHBondContact O-N 3.4Å; E65-L68 VanDerWaalsContact O-N 3.13Å; L68-K70 VanDerWaalsContact C-N 3.32Å; L68-K70 PolarHBondContact O-N 2.92Å; L68-R71 WeakPolarHBondContact O-CB 3.32Å; L68-R71 PolarHBondContact O-N 2.9Å; L68-M72 HydrophobicContact CD2-CE 4.3Å; L68-M72 HydrophobicContact CG-CE 3.96Å; L68-M72 HydrophobicContact CG-SD 4.27Å; L68-M72 WeakPolarHBondContact O-CG 3.28Å; L68-M72 PolarHBondContact O-N 3.1Å
69	L	89.3	Confident	86.4	Confident	109 Å²	109	124.2 Å²	124.2	57%	0.571	57%	0.566	S	S	*	*	H	α-helix	trans	-57.5	-43.3	176.2	-72.6	166	0	0	0	112.1	E65 R71 M72 A73	E65-L69 WeakPolarHBondContact O-CG 3.48Å; E65-L69 PolarHBondContact O-N 2.94Å; L69-R71 VanDerWaalsContact C-N 3.33Å; L69-R71 PolarHBondContact O-N 3.23Å; L69-M72 HydrophobicContact CD2-CE 3.82Å; L69-M72 HydrophobicContact CG-CE 4.35Å; L69-M72 PolarHBondContact O-N 3.45Å; L69-A73 WeakPolarHBondContact O-CB 3.4Å; L69-A73 PolarHBondContact O-N 3.08Å
70	K	89.9	Confident	84.5	Confident	150 Å²	150	128.6 Å²	128.6	65%	0.652	59%	0.592	S	S	*	*	H	α-helix	trans	-62.2	-38.4	174.9	-76.9	-177.5	178.8	-166.3	0	112.9	R66 L68 L74	R66-K70 WeakPolarHBondContact O-CB 3.29Å; R66-K70 VanDerWaalsContact O-CG 3.32Å; R66-K70 WeakPolarHBondContact O-CG 3.43Å; R66-K70 PolarHBondContact O-N 3.44Å; R66-K70 VanDerWaalsContact O-N 3.08Å; L68-K70 VanDerWaalsContact C-N 3.32Å; L68-K70 PolarHBondContact O-N 2.92Å; K70-L74 WeakPolarHBondContact O-CB 3.48Å; K70-L74 WeakPolarHBondContact O-CD1 3.39Å; K70-L74 VanDerWaalsContact O-CG 3.24Å; K70-L74 WeakPolarHBondContact O-CG 3.28Å; K70-L74 PolarHBondContact O-N 2.97Å; K70-L74 VanDerWaalsContact O-N 3.11Å
71	R	89	Confident	84.1	Confident	173 Å²	173	130.6 Å²	130.6	65%	0.653	60%	0.6	S	S	*	*	H	α-helix	trans	-67.8	-45	176.3	-75.1	179.1	178.4	-168.4	-3.2	111.5	R67 L68 L69 A73 L74 E75	R67-R71 WeakPolarHBondContact O-CG 3.48Å; R67-R71 PolarHBondContact O-N 3.38Å; R67-R71 VanDerWaalsContact O-N 3.1Å; L68-R71 WeakPolarHBondContact O-CB 3.32Å; L68-R71 PolarHBondContact O-N 2.9Å; L69-R71 VanDerWaalsContact C-N 3.33Å; L69-R71 PolarHBondContact O-N 3.23Å; R71-A73 PolarHBondContact O-N 3.13Å; R71-L74 PolarHBondContact O-N 3.07Å; R71-E75 WeakPolarHBondContact O-CG 3.41Å; R71-E75 PolarHBondContact O-N 3.4Å
72	M	86	Confident	83.8	Confident	81 Å²	81	129.8 Å²	129.8	40%	0.399	60%	0.603	S	S	.	*	H	α-helix	trans	-62.6	-42.1	177.8	-67	-175.5	-59.7	0	0	111.6	L68 L69 L74 E75 E76	L68-M72 HydrophobicContact CD2-CE 4.3Å; L68-M72 HydrophobicContact CG-CE 3.96Å; L68-M72 HydrophobicContact CG-SD 4.27Å; L68-M72 WeakPolarHBondContact O-CG 3.28Å; L68-M72 PolarHBondContact O-N 3.1Å; L69-M72 HydrophobicContact CD2-CE 3.82Å; L69-M72 HydrophobicContact CG-CE 4.35Å; L69-M72 PolarHBondContact O-N 3.45Å; M72-L74 VanDerWaalsContact C-N 3.34Å; M72-L74 PolarHBondContact O-N 3.37Å; M72-E75 PolarHBondContact O-N 2.98Å; M72-E76 WeakPolarHBondContact O-CG 3.46Å; M72-E76 PolarHBondContact O-N 3.26Å
73	A	86.3	Confident	83.3	Confident	53 Å²	53	133.3 Å²	133.3	44%	0.438	62%	0.616	S	S	.	*	H	α-helix	trans	-65	-35.1	175.9	0	0	0	0	0	113.2	L69 R71 A77	L69-A73 WeakPolarHBondContact O-CB 3.4Å; L69-A73 PolarHBondContact O-N 3.08Å; R71-A73 PolarHBondContact O-N 3.13Å; A73-A77 WeakPolarHBondContact O-CB 3.38Å; A73-A77 PolarHBondContact O-N 2.91Å
74	L	86.1	Confident	82.9	Confident	113 Å²	113	132.6 Å²	132.6	59%	0.592	62%	0.62	S	S	*	*	H	α-helix	trans	-68.5	-42.5	173.2	-74.3	164.9	0	0	0	111.3	K70 R71 M72 E76 A77 E78	K70-L74 WeakPolarHBondContact O-CB 3.48Å; K70-L74 WeakPolarHBondContact O-CD1 3.39Å; K70-L74 VanDerWaalsContact O-CG 3.24Å; K70-L74 WeakPolarHBondContact O-CG 3.28Å; K70-L74 PolarHBondContact O-N 2.97Å; K70-L74 VanDerWaalsContact O-N 3.11Å; R71-L74 PolarHBondContact O-N 3.07Å; M72-L74 VanDerWaalsContact C-N 3.34Å; M72-L74 PolarHBondContact O-N 3.37Å; L74-E76 VanDerWaalsContact C-N 3.33Å; L74-E76 PolarHBondContact O-N 3.42Å; L74-A77 PolarHBondContact O-N 3.12Å; L74-E78 WeakPolarHBondContact O-CG 3.24Å; L74-E78 PolarHBondContact O-N 3.34Å
75	E	82.8	Confident	82.4	Confident	103 Å²	103	130.9 Å²	130.9	48%	0.481	62%	0.616	S	S	.	*	H	α-helix	trans	-67.3	-30	176.6	-73.6	177.8	-165.1	0	0	113.2	R71 M72 K79	R71-E75 WeakPolarHBondContact O-CG 3.41Å; R71-E75 PolarHBondContact O-N 3.4Å; M72-E75 PolarHBondContact O-N 2.98Å; E75-K79 WeakPolarHBondContact O-CD 3.41Å; E75-K79 VanDerWaalsContact O-CG 3.25Å; E75-K79 WeakPolarHBondContact O-CG 3.49Å
76	E	81.1	Confident	81.8	Confident	140 Å²	140	132.9 Å²	132.9	65%	0.654	63%	0.625	S	S	*	*	H	α-helix	trans	-72.6	-42.7	172.2	-77.9	-179.9	163.6	0	0	111.4	M72 L74 E78 K79 E80	M72-E76 WeakPolarHBondContact O-CG 3.46Å; M72-E76 PolarHBondContact O-N 3.26Å; L74-E76 VanDerWaalsContact C-N 3.33Å; L74-E76 PolarHBondContact O-N 3.42Å; E76-E78 VanDerWaalsContact C-N 3.29Å; E76-E78 PolarHBondContact O-N 3.48Å; E76-K79 PolarHBondContact O-N 3.06Å; E76-K79 VanDerWaalsContact O-N 3.12Å; E76-E80 PolarHBondContact O-N 3.11Å
77	A	76.9	Confident	81.2	Confident	65 Å²	65	129.9 Å²	129.9	54%	0.537	62%	0.623	S	S	.	*	H	α-helix	trans	-68.7	-24	176.9	0	0	0	0	0	113.8	A73 L74 K79	A73-A77 WeakPolarHBondContact O-CB 3.38Å; A73-A77 PolarHBondContact O-N 2.91Å; L74-A77 PolarHBondContact O-N 3.12Å; A77-K79 VanDerWaalsContact C-N 3.35Å
78	E	70.6	Confident	80.5	Confident	164 Å²	164	127.4 Å²	127.4	77%	0.766	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82	-10.9	172.3	-76.8	-175	157.6	0	0	113.4	L74 E76	L74-E78 WeakPolarHBondContact O-CG 3.24Å; L74-E78 PolarHBondContact O-N 3.34Å; E76-E78 VanDerWaalsContact C-N 3.29Å; E76-E78 PolarHBondContact O-N 3.48Å
79	K	66	Low	79.7	Confident	170 Å²	170	129.6 Å²	129.6	74%	0.739	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.9	-14.5	179.4	-76.1	175.1	-168.1	171.2	0	114.1	E75 E76 A77	E75-K79 WeakPolarHBondContact O-CD 3.41Å; E75-K79 VanDerWaalsContact O-CG 3.25Å; E75-K79 WeakPolarHBondContact O-CG 3.49Å; E76-K79 PolarHBondContact O-N 3.06Å; E76-K79 VanDerWaalsContact O-N 3.12Å; A77-K79 VanDerWaalsContact C-N 3.35Å
80	E	52.1	Low	78.8	Confident	234 Å²	234	131.5 Å²	131.5	100%	1.093	64%	0.637	S	S	*	*			trans	-84.1	0	165.6	-81.6	-166.9	133.3	0	0	111.6	E76	E76-E80 PolarHBondContact O-N 3.11Å

Retrieved 80 of 80 residues in 63.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).