A0A060XBZ5_ONCMY Loading...

Transmembrane protein 100

AlphaFold DB , UniProt , Accession A0A060XBZ5, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene tmem100a, Length 143 aa.

						>A0A060XBZ5_ONCMY|A0A060XBZ5|tmem100a
MLDPAMPEEPSKDPMTVPAAPERAVMEKANINDHTPTVTIIAIPLVTEIQLNAATGGAELSCYRCTVPFGVVILIAGIVVTSVAYSFNSHGSTISYFGLVLLSAGLVLLALSAVCWKMRLERKKERRRESQTALVANQRSIFA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.8	Very low	40.5	Very low	233 Å²	233	140.9 Å²	140.9	100%	1.148	78%	0.784	S	S	*	*				0	112	0	-158.7	161.7	168.3	0	0	106
2	L	41.8	Very low	40.2	Very low	148 Å²	148	144.8 Å²	144.8	78%	0.775	79%	0.787	S	S	*	*			trans	68.8	95.7	178	-78.8	81.6	0	0	0	119.1
3	D	45.6	Very low	40.4	Very low	145 Å²	145	146 Å²	146	78%	0.775	79%	0.792	S	S	*	*				-57.9	149.2	123.8	-139.3	-82	0	0	0	109.5	A5	D3-A5 PolarHBondContact OD1-N 3.12Å
4	P	47.3	Very low	40.3	Very low	108 Å²	108	142.9 Å²	142.9	70%	0.701	78%	0.783	S	S	*	*				-141.7	116.7	118.2	31.4	-15.4	0	0	0	114.2
5	A	36.3	Very low	40	Very low	73 Å²	73	143.9 Å²	143.9	60%	0.603	78%	0.783	S	S	*	*				54.3	108.3	104.4	0	0	0	0	0	119.5	D3	D3-A5 PolarHBondContact OD1-N 3.12Å
6	M	37	Very low	39.5	Very low	169 Å²	169	143.1 Å²	143.1	83%	0.833	78%	0.784	S	S	*	*				63.8	157.2	125.7	-78.5	-86.4	-73.7	0	0	118.6
7	P	45.4	Very low	39.5	Very low	99 Å²	99	140.6 Å²	140.6	64%	0.643	77%	0.774	S	S	*	*			cis	-152	175.6	29.5	49.2	-29.1	0	0	0	118.3
8	E	40.9	Very low	39.2	Very low	168 Å²	168	139.8 Å²	139.8	79%	0.785	78%	0.777	S	S	*	*			trans	71.8	116.1	147.2	-41.8	-149.1	103.6	0	0	122.9
9	E	43.4	Very low	38.9	Very low	183 Å²	183	136.8 Å²	136.8	86%	0.855	77%	0.771	S	S	*	*			trans	-70.3	150.8	141.8	-52.5	-137.9	128.1	0	0	109.4
10	P	37.3	Very low	38.6	Very low	115 Å²	115	133.9 Å²	133.9	75%	0.747	77%	0.765	S	S	*	*				-154.7	143.9	101.5	34.6	-14.8	0	0	0	116.1
11	S	35	Very low	38.5	Very low	109 Å²	109	133.6 Å²	133.6	76%	0.762	77%	0.768	S	S	*	*				46.6	111.6	127.9	-167.1	0	0	0	0	120
12	K	36.6	Very low	38.3	Very low	187 Å²	187	131 Å²	131	81%	0.813	75%	0.754	S	S	*	*				-169.5	100	125.2	-122.4	172.8	176.5	175.8	0	112
13	D	43.1	Very low	38	Very low	161 Å²	161	135.2 Å²	135.2	86%	0.861	76%	0.759	S	S	*	*			trans	-75.3	132	139.5	-74.2	-62.9	0	0	0	106.9
14	P	38.3	Very low	37.4	Very low	102 Å²	102	133 Å²	133	66%	0.662	76%	0.761	S	S	*	*				-143.3	132.9	107.8	32.7	-16.1	0	0	0	113.2
15	M	36.1	Very low	36.9	Very low	159 Å²	159	133.8 Å²	133.8	78%	0.783	76%	0.764	S	S	*	*			trans	34.4	106.2	131.8	-162.4	76.2	170.6	0	0	116.7	V17	M15-V17 HydrophobicContact CE-CG2 4.37Å
16	T	31.8	Very low	36.9	Very low	130 Å²	130	139.3 Å²	139.3	80%	0.798	78%	0.779	S	S	*	*			trans	-154.7	109	139.6	-68.9	0	0	0	0	109.4	P18	T16-P18 WeakPolarHBondContact O-CD 3.36Å
17	V	39.4	Very low	36.7	Very low	102 Å²	102	139.4 Å²	139.4	62%	0.618	78%	0.777	S	S	*	*			trans	-60.5	125.9	162.1	179	0	0	0	0	108.1	M15 A19	M15-V17 HydrophobicContact CE-CG2 4.37Å; V17-A19 PolarHBondContact O-N 3.38Å
18	P	35.2	Very low	36.1	Very low	126 Å²	126	144.2 Å²	144.2	82%	0.818	79%	0.788	S	S	*	*			trans	-76.4	90.9	159.9	-11.2	28.5	0	0	0	107.1	T16	T16-P18 WeakPolarHBondContact O-CD 3.36Å
19	A	32.9	Very low	36.1	Very low	82 Å²	82	140.2 Å²	140.2	68%	0.678	78%	0.784	S	S	*	*			trans	-53.9	138	159.3	0	0	0	0	0	108.6	V17	V17-A19 PolarHBondContact O-N 3.38Å
20	A	33.7	Very low	35.6	Very low	78 Å²	78	138.1 Å²	138.1	65%	0.645	78%	0.779	S	S	*	*			trans	10.8	126.9	157.6	0	0	0	0	0	117.9	E22	A20-E22 PolarHBondContact O-N 2.76Å
21	P	34.7	Very low	35.9	Very low	128 Å²	128	139 Å²	139	83%	0.831	78%	0.776	S	S	*	*			trans	-68.9	94.2	148.2	29.1	-27.1	0	0	0	107.4	R23	P21-R23 PolarHBondContact O-N 2.82Å; P21-R23 VanDerWaalsContact O-N 3.16Å
22	E	32.4	Very low	36.1	Very low	180 Å²	180	140.3 Å²	140.3	84%	0.841	77%	0.774	S	S	*	*			trans	-40.1	113.7	158.5	-166.2	171.1	98.9	0	0	108.5	A20 A24	A20-E22 PolarHBondContact O-N 2.76Å; E22-A24 VanDerWaalsContact C-N 3.35Å; E22-A24 PolarHBondContact O-N 3.34Å
23	R	35.2	Very low	35.9	Very low	236 Å²	236	137.9 Å²	137.9	89%	0.891	77%	0.77	S	S	*	*			trans	-69.6	96.6	176.3	-69.7	-173.4	-176.5	168.2	1.5	107.4	P21 V25	P21-R23 PolarHBondContact O-N 2.82Å; P21-R23 VanDerWaalsContact O-N 3.16Å; R23-V25 PolarHBondContact O-N 3.29Å
24	A	33.2	Very low	35.6	Very low	98 Å²	98	138.3 Å²	138.3	81%	0.81	77%	0.767	S	S	*	*			trans	-62.7	107.5	164.8	0	0	0	0	0	108.6	E22	E22-A24 VanDerWaalsContact C-N 3.35Å; E22-A24 PolarHBondContact O-N 3.34Å
25	V	37.9	Very low	35.4	Very low	125 Å²	125	138.1 Å²	138.1	76%	0.758	76%	0.764	S	S	*	*			trans	-53.8	130.9	167.8	172.7	0	0	0	0	109.7	R23 E27	R23-V25 PolarHBondContact O-N 3.29Å; V25-E27 HydrophobicContact CG1-CB 4.12Å
26	M	35.6	Very low	35.7	Very low	189 Å²	189	136.5 Å²	136.5	93%	0.931	77%	0.765	S	S	*	*			trans	-134.7	76.8	144.1	-168.2	148.9	84.3	0	0	108.5
27	E	32.9	Very low	35.8	Very low	170 Å²	170	135.3 Å²	135.3	79%	0.794	76%	0.758	S	S	*	*			trans	-89.3	105.7	168.3	-173.3	160.9	95.1	0	0	108.1	V25 A29	V25-E27 HydrophobicContact CG1-CB 4.12Å; E27-A29 PolarHBondContact O-N 3.44Å
28	K	32.2	Very low	36	Very low	201 Å²	201	136.7 Å²	136.7	87%	0.874	77%	0.766	S	S	*	*			trans	-87.6	93.2	167.6	-172.4	170.1	-177.7	175.1	0	107.8
29	A	40.7	Very low	36.3	Very low	84 Å²	84	135.9 Å²	135.9	69%	0.694	76%	0.759	S	S	*	*			trans	-71.8	130.5	172.2	0	0	0	0	0	111	E27	E27-A29 PolarHBondContact O-N 3.44Å
30	N	33.1	Very low	36.9	Very low	139 Å²	139	139 Å²	139	74%	0.743	76%	0.762	S	S	*	*			trans	-155.8	101.8	151.3	-158.7	10.3	0	0	0	112.4
31	I	44.6	Very low	37.6	Very low	133 Å²	133	141.9 Å²	141.9	68%	0.682	77%	0.766	S	S	*	*			trans	61.7	107.3	134.4	-64	-178.8	0	0	0	119.8
32	N	38.8	Very low	38.3	Very low	136 Å²	136	139.4 Å²	139.4	73%	0.727	76%	0.756	S	S	*	*				124.6	119.2	127.1	-81	-1.1	0	0	0	119.8
33	D	31.3	Very low	39.1	Very low	137 Å²	137	137.8 Å²	137.8	73%	0.733	75%	0.752	S	S	*	*			trans	69.6	107.2	142.3	-84.6	-61.9	0	0	0	122.9
34	H	37.9	Very low	39.7	Very low	170 Å²	170	129.4 Å²	129.4	79%	0.787	73%	0.728	S	S	*	*				69.9	92.1	126.1	-139	74.3	0	0	0	119.8
35	T	34.8	Very low	40.7	Very low	98 Å²	98	131 Å²	131	60%	0.601	72%	0.722	S	S	*	*			trans	-34.5	147.9	151.5	49.8	0	0	0	0	114.9	T37	T35-T37 HydrophobicContact CG2-CG2 4.44Å
36	P	40.8	Very low	41.3	Very low	124 Å²	124	129 Å²	129	81%	0.805	71%	0.71	S	S	*	*				-124	121.2	58.6	28.2	-10.9	0	0	0	113.4	V38	P36-V38 PolarHBondContact O-N 3.34Å; P36-V38 VanDerWaalsContact O-N 3.12Å
37	T	34	Very low	42.4	Very low	106 Å²	106	123.1 Å²	123.1	65%	0.65	68%	0.684	S	S	*	*			trans	-49.5	107.4	165.5	46.1	0	0	0	0	110.7	T35 T39	T35-T37 HydrophobicContact CG2-CG2 4.44Å; T37-T39 PolarHBondContact O-N 3Å
38	V	43.3	Very low	43.5	Very low	131 Å²	131	120.9 Å²	120.9	79%	0.794	67%	0.674	S	S	*	*			trans	-62.8	95.8	148.8	176.2	0	0	0	0	104.7	P36 I40	P36-V38 PolarHBondContact O-N 3.34Å; P36-V38 VanDerWaalsContact O-N 3.12Å; V38-I40 HydrophobicContact CG1-CG1 4.27Å; V38-I40 PolarHBondContact O-N 3.41Å
39	T	41.8	Very low	44.6	Very low	109 Å²	109	116.5 Å²	116.5	67%	0.669	66%	0.659	S	S	*	*			trans	-63.4	83	168.2	36.4	0	0	0	0	106.7	T37 I41	T37-T39 PolarHBondContact O-N 3Å; T39-I41 PolarHBondContact O-N 3.5Å
40	I	45.9	Very low	45.2	Very low	146 Å²	146	118.6 Å²	118.6	75%	0.749	65%	0.654	S	S	*	*			trans	-55.7	102.1	153.3	-60	179.9	0	0	0	103.1	V38 A42	V38-I40 HydrophobicContact CG1-CG1 4.27Å; V38-I40 PolarHBondContact O-N 3.41Å; I40-A42 PolarHBondContact O-N 3.37Å
41	I	48.8	Very low	46.3	Very low	140 Å²	140	117.3 Å²	117.3	72%	0.718	65%	0.647	S	S	*	*			trans	-64	83.7	168.6	-58.5	174.5	0	0	0	104.1	T39 I43	T39-I41 PolarHBondContact O-N 3.5Å; I41-I43 HydrophobicContact CG2-CG1 3.91Å; I41-I43 PolarHBondContact O-N 3.01Å
42	A	50.1	Low	47	Very low	75 Å²	75	113.4 Å²	113.4	62%	0.62	63%	0.628	S	S	*	*			trans	-62.2	89.8	158.5	0	0	0	0	0	104	I40 P44	I40-A42 PolarHBondContact O-N 3.37Å; A42-P44 VanDerWaalsContact C-N 3.33Å; A42-P44 WeakPolarHBondContact O-CD 3.41Å
43	I	48	Very low	47.8	Very low	147 Å²	147	110.7 Å²	110.7	75%	0.754	62%	0.624	S	S	*	*			trans	-54.2	102.3	172.6	-62	166.9	0	0	0	104.5	I41 L45	I41-I43 HydrophobicContact CG2-CG1 3.91Å; I41-I43 PolarHBondContact O-N 3.01Å; I43-L45 PolarHBondContact O-N 3.27Å; I43-L45 VanDerWaalsContact O-N 3.12Å
44	P	48.2	Very low	49.1	Very low	60 Å²	60	108.4 Å²	108.4	39%	0.39	62%	0.624	S	S	.	*			trans	-82.1	112.5	-159.1	22.2	-16.4	0	0	0	106.5	A42 V46 T47	A42-P44 VanDerWaalsContact C-N 3.33Å; A42-P44 WeakPolarHBondContact O-CD 3.41Å; P44-V46 HydrophobicContact CB-CB 4.04Å; P44-V46 HydrophobicContact CB-CG2 3.68Å; P44-V46 PolarHBondContact O-N 2.86Å; P44-T47 HydrophobicContact CG-CG2 4.22Å; P44-T47 PolarHBondContact O-N 3Å; P44-T47 PolarHBondContact O-OG1 2.9Å
45	L	53.3	Low	50.2	Low	130 Å²	130	104 Å²	104	68%	0.681	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-47.1	-13.8	160.9	-175.9	62.9	0	0	0	113	I43 T47 I49	I43-L45 PolarHBondContact O-N 3.27Å; I43-L45 VanDerWaalsContact O-N 3.12Å; L45-T47 VanDerWaalsContact C-N 3.31Å; L45-I49 HydrophobicContact CG-CD1 4.25Å
46	V	50.9	Low	51.1	Low	84 Å²	84	102.9 Å²	102.9	51%	0.509	62%	0.617	S	S	.	*	H	α-helix	trans	-69.6	-17.4	174.4	-144.9	0	0	0	0	113.8	P44 Q50	P44-V46 HydrophobicContact CB-CB 4.04Å; P44-V46 HydrophobicContact CB-CG2 3.68Å; P44-V46 PolarHBondContact O-N 2.86Å; V46-Q50 WeakPolarHBondContact O-CB 3.48Å; V46-Q50 WeakPolarHBondContact O-CG 3.32Å; V46-Q50 PolarHBondContact O-N 2.7Å; V46-Q50 PolarHBondContact O-NE2 2.87Å
47	T	59.3	Low	52	Low	65 Å²	65	98 Å²	98	40%	0.399	59%	0.589	S	S	.	*	H	α-helix	trans	-72.2	-48.5	172.9	45.9	0	0	0	0	111.3	P44 L45 I49 L51	P44-T47 HydrophobicContact CG-CG2 4.22Å; P44-T47 PolarHBondContact O-N 3Å; P44-T47 PolarHBondContact O-OG1 2.9Å; L45-T47 VanDerWaalsContact C-N 3.31Å; T47-I49 PolarHBondContact O-N 2.85Å; T47-L51 VanDerWaalsContact O-CB 3.27Å; T47-L51 WeakPolarHBondContact O-CB 3.28Å; T47-L51 WeakPolarHBondContact O-CD1 3.43Å; T47-L51 PolarHBondContact O-N 2.99Å
48	E	55	Low	52.9	Low	124 Å²	124	95.6 Å²	95.6	58%	0.579	58%	0.58	S	S	*	*	H	α-helix	trans	-62.2	-45.3	-176	-55.4	-70.7	128.7	0	0	112	N52	E48-N52 VanDerWaalsContact O-CB 3.29Å; E48-N52 WeakPolarHBondContact O-CB 3.29Å; E48-N52 PolarHBondContact O-N 3.24Å; E48-N52 PolarHBondContact O-OD1 2.98Å; E48-N52 VanDerWaalsContact O-OD1 3.1Å
49	I	56.8	Low	53.4	Low	108 Å²	108	92 Å²	92	55%	0.554	56%	0.555	S	S	*	*	H	α-helix	trans	-73.1	-38.9	-173.5	-61.2	163.4	0	0	0	111.1	L45 T47 A53	L45-I49 HydrophobicContact CG-CD1 4.25Å; T47-I49 PolarHBondContact O-N 2.85Å; I49-A53 WeakPolarHBondContact O-CB 2.99Å; I49-A53 PolarHBondContact O-N 3.39Å
50	Q	53.5	Low	54.2	Low	128 Å²	128	89.9 Å²	89.9	60%	0.598	54%	0.539	S	S	*	.	H	α-helix	trans	-74.8	-35.6	176.3	-72.8	-171	87.2	0	0	112.1	V46 A53 A54	V46-Q50 WeakPolarHBondContact O-CB 3.48Å; V46-Q50 WeakPolarHBondContact O-CG 3.32Å; V46-Q50 PolarHBondContact O-N 2.7Å; V46-Q50 PolarHBondContact O-NE2 2.87Å; Q50-A53 PolarHBondContact O-N 3.34Å; Q50-A54 WeakPolarHBondContact O-CB 3.44Å; Q50-A54 PolarHBondContact O-N 3.03Å
51	L	55.2	Low	54.6	Low	113 Å²	113	86.7 Å²	86.7	59%	0.592	53%	0.53	S	S	*	.	H	α-helix	trans	-65.2	-40.1	171.5	-91.2	85.1	0	0	0	111.6	T47 T55	T47-L51 VanDerWaalsContact O-CB 3.27Å; T47-L51 WeakPolarHBondContact O-CB 3.28Å; T47-L51 WeakPolarHBondContact O-CD1 3.43Å; T47-L51 PolarHBondContact O-N 2.99Å; L51-T55 WeakPolarHBondContact O-CB 3.21Å; L51-T55 WeakPolarHBondContact O-CG2 3.37Å; L51-T55 PolarHBondContact O-N 3.44Å; L51-T55 PolarHBondContact O-OG1 2.88Å
52	N	60.3	Low	54.9	Low	51 Å²	51	84 Å²	84	27%	0.273	52%	0.522	S	S	.	.	H	α-helix	trans	-61.2	-43.2	173.1	-94.1	56.6	0	0	0	112.9	E48 G56 G57 E59	E48-N52 VanDerWaalsContact O-CB 3.29Å; E48-N52 WeakPolarHBondContact O-CB 3.29Å; E48-N52 PolarHBondContact O-N 3.24Å; E48-N52 PolarHBondContact O-OD1 2.98Å; E48-N52 VanDerWaalsContact O-OD1 3.1Å; N52-G56 PolarHBondContact O-N 3.2Å; N52-G57 PolarHBondContact O-N 3.5Å; N52-E59 VanDerWaalsContact CG-CD 3.41Å; N52-E59 PolarHBondContact ND2-OE1 3.5Å; N52-E59 PolarHBondContact ND2-OE2 2.69Å; N52-E59 PolarHBondContact OD1-OE1 3.44Å; N52-E59 PolarHBondContact OD1-OE2 3Å
53	A	55.7	Low	55.4	Low	79 Å²	79	82.2 Å²	82.2	65%	0.653	50%	0.5	S	S	*	.	H	α-helix	trans	-71.7	-39.7	179.9	0	0	0	0	0	111.8	I49 Q50 T55 G56	I49-A53 WeakPolarHBondContact O-CB 2.99Å; I49-A53 PolarHBondContact O-N 3.39Å; Q50-A53 PolarHBondContact O-N 3.34Å; A53-T55 VanDerWaalsContact C-N 3.34Å; A53-G56 PolarHBondContact O-N 2.82Å
54	A	57.3	Low	56	Low	88 Å²	88	82.6 Å²	82.6	73%	0.727	49%	0.492	S	S	*	.	H	α-helix	trans	-70.7	-28.2	178.9	0	0	0	0	0	113.1	Q50	Q50-A54 WeakPolarHBondContact O-CB 3.44Å; Q50-A54 PolarHBondContact O-N 3.03Å
55	T	61.4	Low	56.4	Low	78 Å²	78	83.2 Å²	83.2	48%	0.479	50%	0.497	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.3	7	178.4	61.4	0	0	0	0	113.7	L51 A53 G57 A58	L51-T55 WeakPolarHBondContact O-CB 3.21Å; L51-T55 WeakPolarHBondContact O-CG2 3.37Å; L51-T55 PolarHBondContact O-N 3.44Å; L51-T55 PolarHBondContact O-OG1 2.88Å; A53-T55 VanDerWaalsContact C-N 3.34Å; T55-G57 PolarHBondContact O-N 3.04Å; T55-G57 VanDerWaalsContact O-N 3.16Å; T55-A58 WeakPolarHBondContact O-CB 3.04Å; T55-A58 PolarHBondContact O-N 3.12Å; T55-A58 VanDerWaalsContact O-N 3.14Å
56	G	53.5	Low	57.1	Low	74 Å²	74	80.8 Å²	80.8	76%	0.763	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.4	25.3	172.9	0	0	0	0	0	114.7	N52 A53 A58	N52-G56 PolarHBondContact O-N 3.2Å; A53-G56 PolarHBondContact O-N 2.82Å; G56-A58 VanDerWaalsContact C-N 3.34Å; G56-A58 PolarHBondContact O-N 2.93Å
57	G	59.8	Low	58.1	Low	22 Å²	22	78.7 Å²	78.7	23%	0.227	48%	0.475	C	S	.	.	T	Hydrogen-bonded Turn	trans	71.6	24.4	-177.6	0	0	0	0	0	114.6	N52 T55 E59 L60	N52-G57 PolarHBondContact O-N 3.5Å; T55-G57 PolarHBondContact O-N 3.04Å; T55-G57 VanDerWaalsContact O-N 3.16Å; G57-E59 PolarHBondContact O-N 2.96Å; G57-L60 PolarHBondContact O-N 3.05Å
58	A	53.5	Low	58.8	Low	55 Å²	55	78.8 Å²	78.8	46%	0.455	48%	0.476	S	S	.	.	H	α-helix	trans	-53.6	-24.9	175.5	0	0	0	0	0	113.7	T55 G56 L60 S61 C62	T55-A58 WeakPolarHBondContact O-CB 3.04Å; T55-A58 PolarHBondContact O-N 3.12Å; T55-A58 VanDerWaalsContact O-N 3.14Å; G56-A58 VanDerWaalsContact C-N 3.34Å; G56-A58 PolarHBondContact O-N 2.93Å; A58-L60 VanDerWaalsContact C-N 3.28Å; A58-L60 PolarHBondContact O-N 2.9Å; A58-S61 PolarHBondContact O-N 2.89Å; A58-C62 WeakPolarHBondContact O-CB 3.44Å; A58-C62 PolarHBondContact O-N 3.34Å
59	E	53.4	Low	59.8	Low	56 Å²	56	79.9 Å²	79.9	26%	0.262	48%	0.479	S	S	.	.	H	α-helix	trans	-59.8	-27	173.3	62.1	-145.2	107.2	0	0	115.2	N52 G57 R119	N52-E59 VanDerWaalsContact CG-CD 3.41Å; N52-E59 PolarHBondContact ND2-OE1 3.5Å; N52-E59 PolarHBondContact ND2-OE2 2.69Å; N52-E59 PolarHBondContact OD1-OE1 3.44Å; N52-E59 PolarHBondContact OD1-OE2 3Å; G57-E59 PolarHBondContact O-N 2.96Å; E59-R119 IonicContact OE2-CZ 2.91Å; E59-R119 IonicContact OE2-NH1 2.62Å; E59-R119 IonicContact OE2-NH2 3.65Å; E59-R119 PolarHBondContact OE2-NH2 3.29Å
60	L	57.4	Low	61	Low	64 Å²	64	75.7 Å²	75.7	34%	0.335	46%	0.463	S	S	.	.	H	α-helix	trans	-85.1	-31.6	179.4	-96.7	148.4	0	0	0	112.8	G57 A58 W116	G57-L60 PolarHBondContact O-N 3.05Å; A58-L60 VanDerWaalsContact C-N 3.28Å; A58-L60 PolarHBondContact O-N 2.9Å; L60-W116 HydrophobicContact CD2-CH2 4.32Å; L60-W116 HydrophobicContact CD2-CZ3 4.2Å
61	S	55.5	Low	62.4	Low	80 Å²	80	72.4 Å²	72.4	56%	0.559	45%	0.451	S	S	*	.	H	α-helix	trans	-88	-35.4	-176.9	-62.1	0	0	0	0	112	A58 Y63 R64 C65	A58-S61 PolarHBondContact O-N 2.89Å; S61-Y63 VanDerWaalsContact C-N 3.3Å; S61-Y63 PolarHBondContact O-N 3.26Å; S61-R64 PolarHBondContact O-N 3.24Å; S61-C65 PolarHBondContact O-N 2.83Å; S61-C65 PolarHBondContact O-SG 2.89Å
62	C	54.5	Low	63.9	Low	83 Å²	83	71.7 Å²	71.7	56%	0.561	45%	0.452	S	S	*	.	H	α-helix	trans	-60.7	-41.7	176.7	-170.8	0	0	0	0	111.2	A58 T66	A58-C62 WeakPolarHBondContact O-CB 3.44Å; A58-C62 PolarHBondContact O-N 3.34Å; C62-T66 VanDerWaalsContact O-CB 3.25Å; C62-T66 WeakPolarHBondContact O-CB 2.99Å; C62-T66 PolarHBondContact O-N 3.21Å; C62-T66 PolarHBondContact O-OG1 3.37Å
63	Y	60.8	Low	65.1	Low	38 Å²	38	75 Å²	75	15%	0.149	47%	0.468	C	S	.	.	H	α-helix	trans	-73.1	-35.1	-178.1	-168.1	-84.7	0	0	0	113.7	S61 C65 V67 S112 A113 W116	S61-Y63 VanDerWaalsContact C-N 3.3Å; S61-Y63 PolarHBondContact O-N 3.26Å; Y63-C65 PolarHBondContact O-N 2.94Å; Y63-V67 HydrophobicContact CD1-CG2 3.67Å; Y63-V67 HydrophobicContact CD2-CG2 4.26Å; Y63-V67 HydrophobicContact CE1-CB 4.25Å; Y63-V67 HydrophobicContact CE1-CG2 3.09Å; Y63-V67 HydrophobicContact CE2-CG2 3.76Å; Y63-V67 HydrophobicContact CG-CG2 4.19Å; Y63-V67 WeakPolarHBondContact O-CG2 3.49Å; Y63-V67 PolarHBondContact O-N 2.9Å; Y63-V67 VanDerWaalsContact O-N 3.14Å; Y63-V67 WeakPolarHBondContact OH-CG2 3.29Å; Y63-S112 VanDerWaalsContact CE2-C 3.44Å; Y63-S112 VanDerWaalsContact CE2-CA 3.5Å; Y63-S112 WeakPolarHBondContact CE2-O 3.33Å; Y63-S112 VanDerWaalsContact CE2-OG 3.23Å; Y63-S112 WeakPolarHBondContact CE2-OG 3.22Å; Y63-S112 WeakPolarHBondContact OH-CA 3.25Å; Y63-S112 VanDerWaalsContact OH-CB 3.27Å; Y63-S112 WeakPolarHBondContact OH-CB 3.32Å; Y63-S112 PolarHBondContact OH-O 2.9Å; Y63-A113 WeakPolarHBondContact OH-CA 3.13Å; Y63-A113 PolarHBondContact OH-N 3.28Å; Y63-W116 HydrophobicContact CD1-CB 4.04Å; Y63-W116 AromaticContact CD1-CD2 3.7Å; Y63-W116 HydrophobicContact CD1-CD2 3.7Å; Y63-W116 AromaticContact CD1-CE3 3.1Å; Y63-W116 HydrophobicContact CD1-CE3 3.1Å; Y63-W116 HydrophobicContact CD1-CG 4.1Å; Y63-W116 AromaticContact CD1-CZ3 3.84Å; Y63-W116 HydrophobicContact CD1-CZ3 3.84Å; Y63-W116 HydrophobicContact CE1-CB 3.31Å; Y63-W116 AromaticContact CE1-CD2 3.65Å; Y63-W116 HydrophobicContact CE1-CD2 3.65Å; Y63-W116 AromaticContact CE1-CE3 3.57Å; Y63-W116 HydrophobicContact CE1-CE3 3.57Å; Y63-W116 AromaticContact CE1-CG 3.56Å; Y63-W116 HydrophobicContact CE1-CG 3.56Å; Y63-W116 HydrophobicContact CE2-CB 4.42Å; Y63-W116 AromaticContact CG-CE3 3.93Å; Y63-W116 HydrophobicContact CG-CE3 3.93Å
64	R	60.2	Low	66.5	Low	155 Å²	155	72.4 Å²	72.4	59%	0.585	44%	0.443	S	S	*	.	H	α-helix	trans	-63.7	-28.8	-179.9	-137.7	79.6	170.7	114.8	-0.9	112.1	S61 P68 W116	S61-R64 PolarHBondContact O-N 3.24Å; R64-P68 WeakPolarHBondContact O-CD 3.42Å; R64-P68 VanDerWaalsContact O-CG 3.26Å; R64-P68 WeakPolarHBondContact O-CG 3.37Å; R64-W116 VanDerWaalsContact CZ-CH2 3.41Å; R64-W116 VanDerWaalsContact NE-CH2 3.34Å; R64-W116 VanDerWaalsContact NH1-CH2 3.31Å
65	C	56.8	Low	67.9	Low	73 Å²	73	72.8 Å²	72.8	49%	0.493	43%	0.432	S	S	.	.	H	α-helix	trans	-94.6	-45.1	176.9	-52.7	0	0	0	0	111.3	S61 Y63 V67 P68 F69	S61-C65 PolarHBondContact O-N 2.83Å; S61-C65 PolarHBondContact O-SG 2.89Å; Y63-C65 PolarHBondContact O-N 2.94Å; C65-V67 VanDerWaalsContact C-N 3.28Å; C65-V67 PolarHBondContact O-N 3.42Å; C65-P68 WeakPolarHBondContact O-CD 3.49Å; C65-P68 VanDerWaalsContact O-CG 3.3Å; C65-P68 WeakPolarHBondContact O-CG 3.49Å; C65-F69 WeakPolarHBondContact O-CB 3.34Å; C65-F69 WeakPolarHBondContact O-CD2 3.29Å; C65-F69 PolarHBondContact O-N 3.16Å
66	T	67.8	Low	69.2	Low	79 Å²	79	71.7 Å²	71.7	49%	0.485	43%	0.43	S	S	.	.	H	α-helix	trans	-65.5	-28.8	-176.1	-59.2	0	0	0	0	113.4	C62 G70	C62-T66 VanDerWaalsContact O-CB 3.25Å; C62-T66 WeakPolarHBondContact O-CB 2.99Å; C62-T66 PolarHBondContact O-N 3.21Å; C62-T66 PolarHBondContact O-OG1 3.37Å; T66-G70 VanDerWaalsContact O-CA 3.25Å; T66-G70 WeakPolarHBondContact O-CA 3.43Å; T66-G70 PolarHBondContact O-N 2.9Å
67	V	71.9	Confident	70.8	Confident	40 Å²	40	69.5 Å²	69.5	24%	0.242	41%	0.408	C	S	.	.	H	α-helix	trans	-66.8	-59.1	175.6	173.5	0	0	0	0	113.6	Y63 C65 F69 G70 V71	Y63-V67 HydrophobicContact CD1-CG2 3.67Å; Y63-V67 HydrophobicContact CD2-CG2 4.26Å; Y63-V67 HydrophobicContact CE1-CB 4.25Å; Y63-V67 HydrophobicContact CE1-CG2 3.09Å; Y63-V67 HydrophobicContact CE2-CG2 3.76Å; Y63-V67 HydrophobicContact CG-CG2 4.19Å; Y63-V67 WeakPolarHBondContact O-CG2 3.49Å; Y63-V67 PolarHBondContact O-N 2.9Å; Y63-V67 VanDerWaalsContact O-N 3.14Å; Y63-V67 WeakPolarHBondContact OH-CG2 3.29Å; C65-V67 VanDerWaalsContact C-N 3.28Å; C65-V67 PolarHBondContact O-N 3.42Å; V67-F69 VanDerWaalsContact C-N 3.33Å; V67-F69 PolarHBondContact O-N 3.5Å; V67-G70 PolarHBondContact O-N 3.49Å; V67-V71 HydrophobicContact CG1-CG2 4.31Å; V67-V71 WeakPolarHBondContact O-CB 3.27Å; V67-V71 WeakPolarHBondContact O-CG2 3.49Å; V67-V71 PolarHBondContact O-N 3.06Å
68	P	74.4	Confident	72	Confident	66 Å²	66	71.6 Å²	71.6	43%	0.429	41%	0.413	S	S	.	.	H	α-helix	trans	-62.1	-42.8	-178	23.1	-33.7	0	0	0	111.4	R64 C65 V71 V72	R64-P68 WeakPolarHBondContact O-CD 3.42Å; R64-P68 VanDerWaalsContact O-CG 3.26Å; R64-P68 WeakPolarHBondContact O-CG 3.37Å; C65-P68 WeakPolarHBondContact O-CD 3.49Å; C65-P68 VanDerWaalsContact O-CG 3.3Å; C65-P68 WeakPolarHBondContact O-CG 3.49Å; P68-V71 PolarHBondContact O-N 2.85Å; P68-V72 VanDerWaalsContact O-CG2 3.31Å; P68-V72 WeakPolarHBondContact O-CG2 3.49Å; P68-V72 PolarHBondContact O-N 3.29Å; P68-V72 VanDerWaalsContact O-N 3.13Å
69	F	75.6	Confident	73.6	Confident	148 Å²	148	72.9 Å²	72.9	65%	0.649	42%	0.415	S	S	*	.	H	α-helix	trans	-66	-40.7	177.2	-78	-83.6	0	0	0	112	C65 V67 V72 I73	C65-F69 WeakPolarHBondContact O-CB 3.34Å; C65-F69 WeakPolarHBondContact O-CD2 3.29Å; C65-F69 PolarHBondContact O-N 3.16Å; V67-F69 VanDerWaalsContact C-N 3.33Å; V67-F69 PolarHBondContact O-N 3.5Å; F69-V72 PolarHBondContact O-N 2.86Å; F69-I73 VanDerWaalsContact O-CG1 3.28Å; F69-I73 WeakPolarHBondContact O-CG1 3.46Å; F69-I73 PolarHBondContact O-N 3.44Å
70	G	82.1	Confident	75.1	Confident	20 Å²	20	75 Å²	75	21%	0.206	43%	0.432	C	S	.	.	H	α-helix	trans	-65.9	-39.6	177.3	0	0	0	0	0	113.2	T66 V67 I73 L74	T66-G70 VanDerWaalsContact O-CA 3.25Å; T66-G70 WeakPolarHBondContact O-CA 3.43Å; T66-G70 PolarHBondContact O-N 2.9Å; V67-G70 PolarHBondContact O-N 3.49Å; G70-I73 PolarHBondContact O-N 2.89Å; G70-L74 WeakPolarHBondContact O-CB 3.4Å; G70-L74 PolarHBondContact O-N 3.4Å
71	V	83.1	Confident	76.4	Confident	59 Å²	59	73.8 Å²	73.8	36%	0.358	43%	0.427	S	S	.	.	H	α-helix	trans	-63	-45.3	174.8	171	0	0	0	0	110.6	V67 P68 L74 I75 L109	V67-V71 HydrophobicContact CG1-CG2 4.31Å; V67-V71 WeakPolarHBondContact O-CB 3.27Å; V67-V71 WeakPolarHBondContact O-CG2 3.49Å; V67-V71 PolarHBondContact O-N 3.06Å; P68-V71 PolarHBondContact O-N 2.85Å; V71-L74 PolarHBondContact O-N 3.45Å; V71-I75 HydrophobicContact CG1-CD1 3.8Å; V71-I75 HydrophobicContact CG1-CG1 4.45Å; V71-I75 VanDerWaalsContact O-CG1 3.26Å; V71-I75 WeakPolarHBondContact O-CG1 3.39Å; V71-I75 PolarHBondContact O-N 3.03Å; V71-L109 HydrophobicContact CG2-CD1 3.94Å
72	V	86.4	Confident	77.6	Confident	98 Å²	98	72.6 Å²	72.6	59%	0.594	42%	0.418	S	S	*	.	H	α-helix	trans	-62.8	-46.3	178.8	173.9	0	0	0	0	111.3	P68 F69 L74 I75 A76	P68-V72 VanDerWaalsContact O-CG2 3.31Å; P68-V72 WeakPolarHBondContact O-CG2 3.49Å; P68-V72 PolarHBondContact O-N 3.29Å; P68-V72 VanDerWaalsContact O-N 3.13Å; F69-V72 PolarHBondContact O-N 2.86Å; V72-L74 VanDerWaalsContact C-N 3.3Å; V72-L74 PolarHBondContact O-N 3.25Å; V72-I75 PolarHBondContact O-N 2.89Å; V72-A76 PolarHBondContact O-N 2.71Å
73	I	85.9	Confident	78.9	Confident	121 Å²	121	71.9 Å²	71.9	62%	0.621	41%	0.411	S	S	*	.	H	α-helix	trans	-62.9	-38.7	176.9	-67.3	169.7	0	0	0	110.8	F69 G70 A76 G77	F69-I73 VanDerWaalsContact O-CG1 3.28Å; F69-I73 WeakPolarHBondContact O-CG1 3.46Å; F69-I73 PolarHBondContact O-N 3.44Å; G70-I73 PolarHBondContact O-N 2.89Å; I73-A76 PolarHBondContact O-N 3.06Å; I73-G77 PolarHBondContact O-N 3.01Å
74	L	85.1	Confident	79.8	Confident	24 Å²	24	72.4 Å²	72.4	13%	0.126	42%	0.424	C	S	.	.	H	α-helix	trans	-67.2	-42.1	178.9	-167.8	142.2	0	0	0	111.7	G70 V71 V72 A76 G77 I78 L106 L109	G70-L74 WeakPolarHBondContact O-CB 3.4Å; G70-L74 PolarHBondContact O-N 3.4Å; V71-L74 PolarHBondContact O-N 3.45Å; V72-L74 VanDerWaalsContact C-N 3.3Å; V72-L74 PolarHBondContact O-N 3.25Å; L74-A76 VanDerWaalsContact C-N 3.35Å; L74-A76 PolarHBondContact O-N 3.32Å; L74-G77 PolarHBondContact O-N 2.91Å; L74-I78 HydrophobicContact CD2-CD1 3.53Å; L74-I78 HydrophobicContact CD2-CG1 4.08Å; L74-I78 WeakPolarHBondContact O-CG1 3.39Å; L74-I78 PolarHBondContact O-N 2.93Å; L74-L106 HydrophobicContact CD1-CD2 4.18Å; L74-L106 HydrophobicContact CD1-CG 4.31Å; L74-L106 HydrophobicContact CD2-CD2 3.51Å; L74-L106 HydrophobicContact CD2-CG 4.09Å; L74-L109 HydrophobicContact CB-CD1 4.06Å; L74-L109 HydrophobicContact CD1-CD1 3.6Å; L74-L109 HydrophobicContact CD1-CG 4.12Å; L74-L109 HydrophobicContact CG-CD1 4.28Å
75	I	87.8	Confident	80.6	Confident	96 Å²	96	68.6 Å²	68.6	49%	0.492	41%	0.41	S	S	.	.	H	α-helix	trans	-61	-45.9	174.6	-67	165.3	0	0	0	110.3	V71 V72 G77 I78 V79	V71-I75 HydrophobicContact CG1-CD1 3.8Å; V71-I75 HydrophobicContact CG1-CG1 4.45Å; V71-I75 VanDerWaalsContact O-CG1 3.26Å; V71-I75 WeakPolarHBondContact O-CG1 3.39Å; V71-I75 PolarHBondContact O-N 3.03Å; V72-I75 PolarHBondContact O-N 2.89Å; I75-G77 VanDerWaalsContact C-N 3.3Å; I75-G77 PolarHBondContact O-N 2.83Å; I75-I78 PolarHBondContact O-N 3.21Å; I75-V79 WeakPolarHBondContact O-CG2 3.13Å; I75-V79 PolarHBondContact O-N 3.1Å
76	A	88.7	Confident	81.4	Confident	54 Å²	54	69.9 Å²	69.9	45%	0.446	42%	0.419	S	S	.	.	H	α-helix	trans	-58.3	-43.9	175.4	0	0	0	0	0	111.5	V72 I73 L74 I78 V79 V80	V72-A76 PolarHBondContact O-N 2.71Å; I73-A76 PolarHBondContact O-N 3.06Å; L74-A76 VanDerWaalsContact C-N 3.35Å; L74-A76 PolarHBondContact O-N 3.32Å; A76-I78 PolarHBondContact O-N 2.89Å; A76-V79 PolarHBondContact O-N 2.82Å; A76-V80 WeakPolarHBondContact O-CG2 3.29Å; A76-V80 PolarHBondContact O-N 3.01Å
77	G	85.6	Confident	81.6	Confident	28 Å²	28	74.2 Å²	74.2	29%	0.289	43%	0.432	S	S	.	.	H	α-helix	trans	-61.2	-39.6	175.1	0	0	0	0	0	113.7	I73 L74 I75 V80 T81	I73-G77 PolarHBondContact O-N 3.01Å; L74-G77 PolarHBondContact O-N 2.91Å; I75-G77 VanDerWaalsContact C-N 3.3Å; I75-G77 PolarHBondContact O-N 2.83Å; G77-V80 PolarHBondContact O-N 3.4Å; G77-T81 VanDerWaalsContact O-CB 3.26Å; G77-T81 WeakPolarHBondContact O-CB 3.35Å; G77-T81 PolarHBondContact O-N 3.21Å; G77-T81 PolarHBondContact O-OG1 3.39Å
78	I	85.4	Confident	81.4	Confident	66 Å²	66	76.4 Å²	76.4	34%	0.338	44%	0.442	S	S	.	.	H	α-helix	trans	-61.5	-47.9	174.6	-68.3	169.8	0	0	0	110.3	L74 I75 A76 T81 S82 L102	L74-I78 HydrophobicContact CD2-CD1 3.53Å; L74-I78 HydrophobicContact CD2-CG1 4.08Å; L74-I78 WeakPolarHBondContact O-CG1 3.39Å; L74-I78 PolarHBondContact O-N 2.93Å; I75-I78 PolarHBondContact O-N 3.21Å; A76-I78 PolarHBondContact O-N 2.89Å; I78-T81 PolarHBondContact O-N 2.62Å; I78-S82 WeakPolarHBondContact O-CB 3.33Å; I78-S82 PolarHBondContact O-N 3.47Å; I78-S82 PolarHBondContact O-OG 3.17Å; I78-L102 HydrophobicContact CB-CD1 4.43Å; I78-L102 HydrophobicContact CB-CD2 4.3Å; I78-L102 HydrophobicContact CD1-CD2 4.47Å; I78-L102 HydrophobicContact CG1-CD1 3.96Å; I78-L102 HydrophobicContact CG1-CD2 3.36Å; I78-L102 HydrophobicContact CG1-CG 4.29Å
79	V	87.4	Confident	80.7	Confident	82 Å²	82	78.6 Å²	78.6	50%	0.497	46%	0.459	S	S	.	.	H	α-helix	trans	-62.9	-44.1	-179.4	176.2	0	0	0	0	110.8	I75 A76 T81 S82 V83	I75-V79 WeakPolarHBondContact O-CG2 3.13Å; I75-V79 PolarHBondContact O-N 3.1Å; A76-V79 PolarHBondContact O-N 2.82Å; V79-T81 VanDerWaalsContact C-N 3.35Å; V79-T81 PolarHBondContact O-N 2.78Å; V79-S82 WeakPolarHBondContact CA-OG 3.19Å; V79-S82 PolarHBondContact O-N 2.87Å; V79-S82 PolarHBondContact O-OG 2.86Å; V79-V83 HydrophobicContact CG1-CG2 4.49Å; V79-V83 WeakPolarHBondContact O-CB 3.38Å; V79-V83 WeakPolarHBondContact O-CG2 3.41Å; V79-V83 PolarHBondContact O-N 2.89Å
80	V	84.9	Confident	80.2	Confident	102 Å²	102	79.2 Å²	79.2	62%	0.618	46%	0.464	S	S	*	.	H	α-helix	trans	-63.3	-43	176.2	173.4	0	0	0	0	111.1	A76 G77 V83 A84	A76-V80 WeakPolarHBondContact O-CG2 3.29Å; A76-V80 PolarHBondContact O-N 3.01Å; G77-V80 PolarHBondContact O-N 3.4Å; V80-V83 PolarHBondContact O-N 3.24Å; V80-A84 VanDerWaalsContact O-CB 3.29Å; V80-A84 WeakPolarHBondContact O-CB 3.48Å; V80-A84 PolarHBondContact O-N 3.38Å
81	T	84.5	Confident	79.4	Confident	38 Å²	38	80.5 Å²	80.5	23%	0.233	48%	0.477	C	S	.	.	H	α-helix	trans	-65.6	-39.1	178.5	-58	0	0	0	0	111.5	G77 I78 V79 A84 Y85 L102	G77-T81 VanDerWaalsContact O-CB 3.26Å; G77-T81 WeakPolarHBondContact O-CB 3.35Å; G77-T81 PolarHBondContact O-N 3.21Å; G77-T81 PolarHBondContact O-OG1 3.39Å; I78-T81 PolarHBondContact O-N 2.62Å; V79-T81 VanDerWaalsContact C-N 3.35Å; V79-T81 PolarHBondContact O-N 2.78Å; T81-A84 PolarHBondContact O-N 3.48Å; T81-Y85 WeakPolarHBondContact O-CB 3.42Å; T81-Y85 PolarHBondContact O-N 2.83Å; T81-L102 HydrophobicContact CG2-CD1 3.82Å
82	S	80	Confident	79	Confident	54 Å²	54	80.3 Å²	80.3	38%	0.378	48%	0.478	S	S	.	.	H	α-helix	trans	-72.3	-35.3	179.8	66.2	0	0	0	0	112.5	I78 V79 Y85 S86	I78-S82 WeakPolarHBondContact O-CB 3.33Å; I78-S82 PolarHBondContact O-N 3.47Å; I78-S82 PolarHBondContact O-OG 3.17Å; V79-S82 WeakPolarHBondContact CA-OG 3.19Å; V79-S82 PolarHBondContact O-N 2.87Å; V79-S82 PolarHBondContact O-OG 2.86Å; S82-Y85 PolarHBondContact O-N 3.4Å; S82-S86 VanDerWaalsContact O-CB 3.32Å; S82-S86 WeakPolarHBondContact O-CB 3.37Å; S82-S86 PolarHBondContact O-N 3.05Å; S82-S86 PolarHBondContact O-OG 3.45Å
83	V	81.6	Confident	78.4	Confident	68 Å²	68	80.2 Å²	80.2	41%	0.412	48%	0.478	S	S	.	.	H	α-helix	trans	-65.9	-48.5	171.6	172.4	0	0	0	0	109.9	V79 V80 Y85 S86 F87	V79-V83 HydrophobicContact CG1-CG2 4.49Å; V79-V83 WeakPolarHBondContact O-CB 3.38Å; V79-V83 WeakPolarHBondContact O-CG2 3.41Å; V79-V83 PolarHBondContact O-N 2.89Å; V80-V83 PolarHBondContact O-N 3.24Å; V83-Y85 VanDerWaalsContact C-N 3.26Å; V83-Y85 PolarHBondContact O-N 2.89Å; V83-S86 PolarHBondContact O-N 3.16Å; V83-F87 HydrophobicContact CG1-CD2 3.68Å; V83-F87 HydrophobicContact CG1-CE2 3.35Å; V83-F87 HydrophobicContact CG1-CZ 4.5Å; V83-F87 WeakPolarHBondContact O-CD2 3.32Å; V83-F87 PolarHBondContact O-N 3.14Å
84	A	80.1	Confident	77.9	Confident	49 Å²	49	80.2 Å²	80.2	41%	0.405	48%	0.478	S	S	.	.	H	α-helix	trans	-60.7	-36.8	175.7	0	0	0	0	0	112.4	V80 T81 N88	V80-A84 VanDerWaalsContact O-CB 3.29Å; V80-A84 WeakPolarHBondContact O-CB 3.48Å; V80-A84 PolarHBondContact O-N 3.38Å; T81-A84 PolarHBondContact O-N 3.48Å; A84-N88 PolarHBondContact O-N 2.95Å; A84-N88 PolarHBondContact O-ND2 3.37Å
85	Y	76.6	Confident	77.7	Confident	76 Å²	76	79.9 Å²	79.9	30%	0.298	48%	0.478	S	S	.	.	H	α-helix	trans	-69	-42.4	174.6	-175.8	-117.9	0	0	0	112.3	T81 S82 V83 F87 N88 H90 S95	T81-Y85 WeakPolarHBondContact O-CB 3.42Å; T81-Y85 PolarHBondContact O-N 2.83Å; S82-Y85 PolarHBondContact O-N 3.4Å; V83-Y85 VanDerWaalsContact C-N 3.26Å; V83-Y85 PolarHBondContact O-N 2.89Å; Y85-F87 VanDerWaalsContact C-N 3.29Å; Y85-F87 PolarHBondContact O-N 3.13Å; Y85-N88 CarbonylContact O-C 3.42Å; Y85-N88 PolarHBondContact O-N 2.99Å; Y85-N88 VanDerWaalsContact O-N 3.16Å; Y85-H90 AromaticContact CZ-ND1 3.99Å; Y85-H90 PolarHBondContact OH-ND1 3.45Å; Y85-H90 VanDerWaalsContact OH-ND1 3.17Å; Y85-S95 WeakPolarHBondContact CD2-OG 3.41Å; Y85-S95 VanDerWaalsContact CE2-CB 3.45Å; Y85-S95 WeakPolarHBondContact CE2-OG 3.34Å
86	S	74.2	Confident	77.3	Confident	99 Å²	99	82.6 Å²	82.6	69%	0.692	48%	0.483	S	S	*	.	H	α-helix	trans	-64.7	-33.7	178.9	-67.1	0	0	0	0	112.6	S82 V83	S82-S86 VanDerWaalsContact O-CB 3.32Å; S82-S86 WeakPolarHBondContact O-CB 3.37Å; S82-S86 PolarHBondContact O-N 3.05Å; S82-S86 PolarHBondContact O-OG 3.45Å; V83-S86 PolarHBondContact O-N 3.16Å
87	F	71.8	Confident	77	Confident	171 Å²	171	86.6 Å²	86.6	75%	0.75	49%	0.491	S	S	*	.	H	α-helix	trans	-78	-18	176	-72.2	-59.4	0	0	0	114	V83 Y85	V83-F87 HydrophobicContact CG1-CD2 3.68Å; V83-F87 HydrophobicContact CG1-CE2 3.35Å; V83-F87 HydrophobicContact CG1-CZ 4.5Å; V83-F87 WeakPolarHBondContact O-CD2 3.32Å; V83-F87 PolarHBondContact O-N 3.14Å; Y85-F87 VanDerWaalsContact C-N 3.29Å; Y85-F87 PolarHBondContact O-N 3.13Å
88	N	68.6	Low	76.9	Confident	86 Å²	86	86 Å²	86	46%	0.46	48%	0.484	S	S	.	.	S	Bend	trans	-115.4	99.6	-179.1	-74.8	-82.8	0	0	0	109.6	A84 Y85 H90	A84-N88 PolarHBondContact O-N 2.95Å; A84-N88 PolarHBondContact O-ND2 3.37Å; Y85-N88 CarbonylContact O-C 3.42Å; Y85-N88 PolarHBondContact O-N 2.99Å; Y85-N88 VanDerWaalsContact O-N 3.16Å; N88-H90 PolarHBondContact O-N 3.21Å
89	S	59	Low	76.8	Confident	112 Å²	112	88.3 Å²	88.3	78%	0.783	50%	0.496	S	S	*	.			trans	-33	127.7	-179.7	-88.3	0	0	0	0	114	G91	S89-G91 PolarHBondContact O-N 3.45Å
90	H	64.6	Low	76.7	Confident	160 Å²	160	88.5 Å²	88.5	74%	0.741	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	-26.9	114.8	179.5	-80	-114.7	0	0	0	114.3	Y85 N88	Y85-H90 AromaticContact CZ-ND1 3.99Å; Y85-H90 PolarHBondContact OH-ND1 3.45Å; Y85-H90 VanDerWaalsContact OH-ND1 3.17Å; N88-H90 PolarHBondContact O-N 3.21Å
91	G	65.4	Low	76.8	Confident	48 Å²	48	89.7 Å²	89.7	50%	0.495	50%	0.5	S	S	.	.	T	Hydrogen-bonded Turn	trans	118.4	0.3	163.5	0	0	0	0	0	117.4	S89	S89-G91 PolarHBondContact O-N 3.45Å
92	S	74.9	Confident	76.9	Confident	54 Å²	54	89.5 Å²	89.5	38%	0.378	50%	0.497	S	S	.	.			trans	-66.7	145.9	174.9	-174.3	0	0	0	0	112.2	I94 S95 Y96	S92-I94 PolarHBondContact O-N 3.31Å; S92-I94 VanDerWaalsContact O-N 3.12Å; S92-S95 VanDerWaalsContact O-CB 3.28Å; S92-S95 WeakPolarHBondContact O-CB 3.42Å; S92-S95 PolarHBondContact O-N 3.05Å; S92-Y96 PolarHBondContact O-N 3.35Å
93	T	73.9	Confident	77.2	Confident	97 Å²	97	89.8 Å²	89.8	60%	0.595	50%	0.499	S	S	*	.	H	α-helix	trans	-54.9	-32.4	179.7	51	0	0	0	0	112.7	S95 Y96 F97	T93-S95 VanDerWaalsContact C-N 3.28Å; T93-S95 PolarHBondContact O-N 2.84Å; T93-Y96 WeakPolarHBondContact O-CB 3.37Å; T93-Y96 PolarHBondContact O-N 2.96Å; T93-Y96 VanDerWaalsContact O-N 3.08Å; T93-F97 WeakPolarHBondContact O-CD2 3.47Å; T93-F97 PolarHBondContact O-N 3.01Å
94	I	77.1	Confident	77.4	Confident	120 Å²	120	88.8 Å²	88.8	62%	0.615	50%	0.498	S	S	*	.	H	α-helix	trans	-61.7	-35.1	176.3	-112.6	149.1	0	0	0	112.5	S92 G98	S92-I94 PolarHBondContact O-N 3.31Å; S92-I94 VanDerWaalsContact O-N 3.12Å; I94-G98 PolarHBondContact O-N 2.86Å; I94-G98 VanDerWaalsContact O-N 3.08Å
95	S	79.6	Confident	77.7	Confident	17 Å²	17	87.4 Å²	87.4	12%	0.119	49%	0.489	C	S	.	.	H	α-helix	trans	-68.4	-40.6	172.7	176.6	0	0	0	0	111.9	Y85 S92 T93 F97 G98 L99	Y85-S95 WeakPolarHBondContact CD2-OG 3.41Å; Y85-S95 VanDerWaalsContact CE2-CB 3.45Å; Y85-S95 WeakPolarHBondContact CE2-OG 3.34Å; S92-S95 VanDerWaalsContact O-CB 3.28Å; S92-S95 WeakPolarHBondContact O-CB 3.42Å; S92-S95 PolarHBondContact O-N 3.05Å; T93-S95 VanDerWaalsContact C-N 3.28Å; T93-S95 PolarHBondContact O-N 2.84Å; S95-F97 VanDerWaalsContact C-N 3.31Å; S95-G98 PolarHBondContact O-N 3.5Å; S95-L99 PolarHBondContact O-N 2.84Å
96	Y	78.9	Confident	78.2	Confident	153 Å²	153	88.1 Å²	88.1	60%	0.6	50%	0.497	S	S	*	.	H	α-helix	trans	-62.5	-42.9	178.3	-87.1	-81.9	0	0	0	110.4	S92 T93 G98 L99 V100	S92-Y96 PolarHBondContact O-N 3.35Å; T93-Y96 WeakPolarHBondContact O-CB 3.37Å; T93-Y96 PolarHBondContact O-N 2.96Å; T93-Y96 VanDerWaalsContact O-N 3.08Å; Y96-G98 PolarHBondContact O-N 3.39Å; Y96-L99 PolarHBondContact O-N 3.46Å; Y96-V100 WeakPolarHBondContact O-CB 3.08Å; Y96-V100 VanDerWaalsContact O-CG2 3.25Å; Y96-V100 WeakPolarHBondContact O-CG2 3.2Å; Y96-V100 PolarHBondContact O-N 2.91Å
97	F	82.4	Confident	78.8	Confident	139 Å²	139	87.3 Å²	87.3	61%	0.61	49%	0.488	S	S	*	.	H	α-helix	trans	-59.9	-43.2	173.4	-74.7	-66.2	0	0	0	112.4	T93 S95 V100 L101	T93-F97 WeakPolarHBondContact O-CD2 3.47Å; T93-F97 PolarHBondContact O-N 3.01Å; S95-F97 VanDerWaalsContact C-N 3.31Å; F97-V100 PolarHBondContact O-N 2.94Å; F97-L101 WeakPolarHBondContact O-CB 3.29Å; F97-L101 WeakPolarHBondContact O-CD1 3.48Å; F97-L101 VanDerWaalsContact O-CG 3.3Å; F97-L101 WeakPolarHBondContact O-CG 3.27Å; F97-L101 PolarHBondContact O-N 2.84Å
98	G	85.1	Confident	79.5	Confident	14 Å²	14	84.7 Å²	84.7	14%	0.144	48%	0.481	C	S	.	.	H	α-helix	trans	-60.9	-43.4	174.9	0	0	0	0	0	113.1	I94 S95 Y96 L102	I94-G98 PolarHBondContact O-N 2.86Å; I94-G98 VanDerWaalsContact O-N 3.08Å; S95-G98 PolarHBondContact O-N 3.5Å; Y96-G98 PolarHBondContact O-N 3.39Å; G98-L102 WeakPolarHBondContact O-CB 3.23Å; G98-L102 WeakPolarHBondContact O-CG 3.28Å; G98-L102 PolarHBondContact O-N 2.84Å
99	L	82.3	Confident	80.1	Confident	115 Å²	115	82.4 Å²	82.4	60%	0.602	47%	0.469	S	S	*	.	H	α-helix	trans	-65.6	-43.5	177.9	-143.8	88.4	0	0	0	111.9	S95 Y96 L102 S103	S95-L99 PolarHBondContact O-N 2.84Å; Y96-L99 PolarHBondContact O-N 3.46Å; L99-L102 PolarHBondContact O-N 2.7Å; L99-S103 WeakPolarHBondContact O-CB 3.33Å; L99-S103 PolarHBondContact O-N 3.44Å; L99-S103 PolarHBondContact O-OG 3.23Å
100	V	85.8	Confident	81.3	Confident	87 Å²	87	79.6 Å²	79.6	53%	0.527	45%	0.453	S	S	.	.	H	α-helix	trans	-63	-48.2	176.9	170.7	0	0	0	0	110.4	Y96 F97 L102 S103 A104	Y96-V100 WeakPolarHBondContact O-CB 3.08Å; Y96-V100 VanDerWaalsContact O-CG2 3.25Å; Y96-V100 WeakPolarHBondContact O-CG2 3.2Å; Y96-V100 PolarHBondContact O-N 2.91Å; F97-V100 PolarHBondContact O-N 2.94Å; V100-L102 PolarHBondContact O-N 3.37Å; V100-S103 PolarHBondContact O-N 3.46Å; V100-S103 PolarHBondContact O-OG 2.97Å; V100-A104 PolarHBondContact O-N 3.2Å
101	L	85.9	Confident	82.1	Confident	127 Å²	127	77.3 Å²	77.3	67%	0.665	45%	0.445	S	S	*	.	H	α-helix	trans	-60.7	-42.7	177.2	-77.3	164.7	0	0	0	112.2	F97 A104 G105	F97-L101 WeakPolarHBondContact O-CB 3.29Å; F97-L101 WeakPolarHBondContact O-CD1 3.48Å; F97-L101 VanDerWaalsContact O-CG 3.3Å; F97-L101 WeakPolarHBondContact O-CG 3.27Å; F97-L101 PolarHBondContact O-N 2.84Å; L101-A104 PolarHBondContact O-N 3.38Å; L101-G105 PolarHBondContact O-N 2.89Å
102	L	86.8	Confident	82.9	Confident	33 Å²	33	76.8 Å²	76.8	17%	0.173	43%	0.434	C	S	.	.	H	α-helix	trans	-61.5	-45.2	174.8	-86.3	178.6	0	0	0	112.2	I78 T81 G98 L99 V100 A104 G105 L106	I78-L102 HydrophobicContact CB-CD1 4.43Å; I78-L102 HydrophobicContact CB-CD2 4.3Å; I78-L102 HydrophobicContact CD1-CD2 4.47Å; I78-L102 HydrophobicContact CG1-CD1 3.96Å; I78-L102 HydrophobicContact CG1-CD2 3.36Å; I78-L102 HydrophobicContact CG1-CG 4.29Å; T81-L102 HydrophobicContact CG2-CD1 3.82Å; G98-L102 WeakPolarHBondContact O-CB 3.23Å; G98-L102 WeakPolarHBondContact O-CG 3.28Å; G98-L102 PolarHBondContact O-N 2.84Å; L99-L102 PolarHBondContact O-N 2.7Å; V100-L102 PolarHBondContact O-N 3.37Å; L102-A104 VanDerWaalsContact C-N 3.33Å; L102-A104 PolarHBondContact O-N 2.86Å; L102-G105 PolarHBondContact O-N 3Å; L102-L106 WeakPolarHBondContact O-CG 3.42Å; L102-L106 PolarHBondContact O-N 3.27Å
103	S	86.1	Confident	83.2	Confident	60 Å²	60	76.5 Å²	76.5	42%	0.42	44%	0.435	S	S	.	.	H	α-helix	trans	-62.1	-41.3	178.2	74.3	0	0	0	0	111.6	L99 V100 G105 L106 V107	L99-S103 WeakPolarHBondContact O-CB 3.33Å; L99-S103 PolarHBondContact O-N 3.44Å; L99-S103 PolarHBondContact O-OG 3.23Å; V100-S103 PolarHBondContact O-N 3.46Å; V100-S103 PolarHBondContact O-OG 2.97Å; S103-G105 VanDerWaalsContact C-N 3.35Å; S103-G105 PolarHBondContact O-N 2.91Å; S103-L106 PolarHBondContact O-N 3.47Å; S103-V107 VanDerWaalsContact O-CG2 3.29Å; S103-V107 WeakPolarHBondContact O-CG2 3.08Å; S103-V107 PolarHBondContact O-N 3.45Å
104	A	87.2	Confident	83.5	Confident	47 Å²	47	75.8 Å²	75.8	39%	0.388	43%	0.43	S	S	.	.	H	α-helix	trans	-61.9	-42.3	174.6	0	0	0	0	0	111.6	V100 L101 L102 V107 L108	V100-A104 PolarHBondContact O-N 3.2Å; L101-A104 PolarHBondContact O-N 3.38Å; L102-A104 VanDerWaalsContact C-N 3.33Å; L102-A104 PolarHBondContact O-N 2.86Å; A104-V107 PolarHBondContact O-N 3.38Å; A104-L108 WeakPolarHBondContact O-CB 3.43Å; A104-L108 VanDerWaalsContact O-CG 3.32Å; A104-L108 WeakPolarHBondContact O-CG 3.45Å; A104-L108 PolarHBondContact O-N 3.28Å
105	G	86.2	Confident	83.6	Confident	21 Å²	21	73.9 Å²	73.9	22%	0.216	43%	0.427	C	S	.	.	H	α-helix	trans	-60.2	-45.1	174	0	0	0	0	0	112.9	L101 L102 S103 L108 L109	L101-G105 PolarHBondContact O-N 2.89Å; L102-G105 PolarHBondContact O-N 3Å; S103-G105 VanDerWaalsContact C-N 3.35Å; S103-G105 PolarHBondContact O-N 2.91Å; G105-L108 PolarHBondContact O-N 3.46Å; G105-L109 PolarHBondContact O-N 3.37Å
106	L	86.7	Confident	83.4	Confident	90 Å²	90	75.6 Å²	75.6	47%	0.471	43%	0.431	S	S	.	.	H	α-helix	trans	-64.3	-41.8	177.3	-74.3	172.4	0	0	0	112	L74 L102 S103 L109 A110	L74-L106 HydrophobicContact CD1-CD2 4.18Å; L74-L106 HydrophobicContact CD1-CG 4.31Å; L74-L106 HydrophobicContact CD2-CD2 3.51Å; L74-L106 HydrophobicContact CD2-CG 4.09Å; L102-L106 WeakPolarHBondContact O-CG 3.42Å; L102-L106 PolarHBondContact O-N 3.27Å; S103-L106 PolarHBondContact O-N 3.47Å; L106-L109 PolarHBondContact O-N 2.92Å; L106-A110 WeakPolarHBondContact O-CB 3.32Å; L106-A110 PolarHBondContact O-N 3.45Å
107	V	87.8	Confident	83.4	Confident	83 Å²	83	74.2 Å²	74.2	50%	0.503	43%	0.428	S	S	.	.	H	α-helix	trans	-62.6	-44.8	176.2	170.2	0	0	0	0	110.6	S103 A104 L109 A110 L111	S103-V107 VanDerWaalsContact O-CG2 3.29Å; S103-V107 WeakPolarHBondContact O-CG2 3.08Å; S103-V107 PolarHBondContact O-N 3.45Å; A104-V107 PolarHBondContact O-N 3.38Å; V107-L109 VanDerWaalsContact C-N 3.35Å; V107-L109 PolarHBondContact O-N 3Å; V107-A110 PolarHBondContact O-N 3.23Å; V107-L111 HydrophobicContact CG1-CD1 4.05Å; V107-L111 HydrophobicContact CG1-CG 4.33Å; V107-L111 WeakPolarHBondContact O-CB 3.19Å; V107-L111 WeakPolarHBondContact O-CG 3.49Å; V107-L111 PolarHBondContact O-N 3.14Å
108	L	84.8	Confident	83.1	Confident	115 Å²	115	73.1 Å²	73.1	60%	0.602	43%	0.426	S	S	*	.	H	α-helix	trans	-61.3	-42.4	176.8	-74	169	0	0	0	112	A104 G105 S112	A104-L108 WeakPolarHBondContact O-CB 3.43Å; A104-L108 VanDerWaalsContact O-CG 3.32Å; A104-L108 WeakPolarHBondContact O-CG 3.45Å; A104-L108 PolarHBondContact O-N 3.28Å; G105-L108 PolarHBondContact O-N 3.46Å; L108-S112 VanDerWaalsContact O-CB 3.28Å; L108-S112 WeakPolarHBondContact O-CB 3.25Å; L108-S112 PolarHBondContact O-N 3.38Å
109	L	82.4	Confident	82.3	Confident	39 Å²	39	77.9 Å²	77.9	20%	0.204	44%	0.44	C	S	.	.	H	α-helix	trans	-65.6	-39.5	174.3	-72.7	-170.2	0	0	0	112.4	V71 L74 G105 L106 V107 S112 A113	V71-L109 HydrophobicContact CG2-CD1 3.94Å; L74-L109 HydrophobicContact CB-CD1 4.06Å; L74-L109 HydrophobicContact CD1-CD1 3.6Å; L74-L109 HydrophobicContact CD1-CG 4.12Å; L74-L109 HydrophobicContact CG-CD1 4.28Å; G105-L109 PolarHBondContact O-N 3.37Å; L106-L109 PolarHBondContact O-N 2.92Å; V107-L109 VanDerWaalsContact C-N 3.35Å; V107-L109 PolarHBondContact O-N 3Å; L109-S112 WeakPolarHBondContact O-CB 3.49Å; L109-S112 PolarHBondContact O-N 3.43Å; L109-A113 WeakPolarHBondContact O-CB 3.42Å; L109-A113 PolarHBondContact O-N 2.92Å
110	A	83.9	Confident	81.8	Confident	53 Å²	53	75.7 Å²	75.7	44%	0.438	43%	0.428	S	S	.	.	H	α-helix	trans	-65.7	-45.1	177.5	0	0	0	0	0	111.6	L106 V107 S112 A113 V114	L106-A110 WeakPolarHBondContact O-CB 3.32Å; L106-A110 PolarHBondContact O-N 3.45Å; V107-A110 PolarHBondContact O-N 3.23Å; A110-S112 VanDerWaalsContact C-N 3.3Å; A110-S112 PolarHBondContact O-N 3.43Å; A110-A113 PolarHBondContact O-N 3.42Å; A110-V114 VanDerWaalsContact O-CG2 3.32Å; A110-V114 WeakPolarHBondContact O-CG2 3.26Å; A110-V114 PolarHBondContact O-N 3.46Å
111	L	82.1	Confident	81.2	Confident	111 Å²	111	75.1 Å²	75.1	58%	0.581	42%	0.419	S	S	*	.	H	α-helix	trans	-59.9	-43.9	174.3	-73.1	174.8	0	0	0	111.1	V107 A113 V114 C115	V107-L111 HydrophobicContact CG1-CD1 4.05Å; V107-L111 HydrophobicContact CG1-CG 4.33Å; V107-L111 WeakPolarHBondContact O-CB 3.19Å; V107-L111 WeakPolarHBondContact O-CG 3.49Å; V107-L111 PolarHBondContact O-N 3.14Å; L111-A113 VanDerWaalsContact C-N 3.35Å; L111-A113 PolarHBondContact O-N 2.91Å; L111-V114 PolarHBondContact O-N 3.08Å; L111-C115 WeakPolarHBondContact O-CB 3.49Å; L111-C115 PolarHBondContact O-N 3.25Å
112	S	80.6	Confident	80.4	Confident	38 Å²	38	77.9 Å²	77.9	27%	0.266	42%	0.421	S	S	.	.	H	α-helix	trans	-50.8	-55.8	168.9	-102.9	0	0	0	0	110.4	Y63 L108 L109 A110 V114 C115 W116	Y63-S112 VanDerWaalsContact CE2-C 3.44Å; Y63-S112 VanDerWaalsContact CE2-CA 3.5Å; Y63-S112 WeakPolarHBondContact CE2-O 3.33Å; Y63-S112 VanDerWaalsContact CE2-OG 3.23Å; Y63-S112 WeakPolarHBondContact CE2-OG 3.22Å; Y63-S112 WeakPolarHBondContact OH-CA 3.25Å; Y63-S112 VanDerWaalsContact OH-CB 3.27Å; Y63-S112 WeakPolarHBondContact OH-CB 3.32Å; Y63-S112 PolarHBondContact OH-O 2.9Å; L108-S112 VanDerWaalsContact O-CB 3.28Å; L108-S112 WeakPolarHBondContact O-CB 3.25Å; L108-S112 PolarHBondContact O-N 3.38Å; L109-S112 WeakPolarHBondContact O-CB 3.49Å; L109-S112 PolarHBondContact O-N 3.43Å; A110-S112 VanDerWaalsContact C-N 3.3Å; A110-S112 PolarHBondContact O-N 3.43Å; S112-V114 VanDerWaalsContact C-N 3.35Å; S112-V114 PolarHBondContact O-N 2.9Å; S112-C115 WeakPolarHBondContact O-CB 3.3Å; S112-C115 PolarHBondContact O-N 3.17Å; S112-C115 VanDerWaalsContact O-N 3.13Å; S112-W116 PolarHBondContact O-N 3.22Å
113	A	81.3	Confident	79.3	Confident	47 Å²	47	81.6 Å²	81.6	39%	0.388	44%	0.436	S	S	.	.	H	α-helix	trans	-64.4	-39	-173.3	0	0	0	0	0	112.4	Y63 L109 A110 L111 W116 K117	Y63-A113 WeakPolarHBondContact OH-CA 3.13Å; Y63-A113 PolarHBondContact OH-N 3.28Å; L109-A113 WeakPolarHBondContact O-CB 3.42Å; L109-A113 PolarHBondContact O-N 2.92Å; A110-A113 PolarHBondContact O-N 3.42Å; L111-A113 VanDerWaalsContact C-N 3.35Å; L111-A113 PolarHBondContact O-N 2.91Å; A113-W116 WeakPolarHBondContact O-CB 3.33Å; A113-W116 PolarHBondContact O-N 3.5Å; A113-K117 WeakPolarHBondContact O-CB 3.45Å; A113-K117 PolarHBondContact O-N 3.43Å
114	V	81.8	Confident	78.4	Confident	83 Å²	83	85.3 Å²	85.3	50%	0.503	45%	0.445	S	S	.	.	H	α-helix	trans	-66.6	-42.7	174.4	173.1	0	0	0	0	110.6	A110 L111 S112 W116 K117 M118	A110-V114 VanDerWaalsContact O-CG2 3.32Å; A110-V114 WeakPolarHBondContact O-CG2 3.26Å; A110-V114 PolarHBondContact O-N 3.46Å; L111-V114 PolarHBondContact O-N 3.08Å; S112-V114 VanDerWaalsContact C-N 3.35Å; S112-V114 PolarHBondContact O-N 2.9Å; V114-W116 VanDerWaalsContact C-N 3.27Å; V114-W116 PolarHBondContact O-N 2.88Å; V114-K117 PolarHBondContact O-N 3.27Å; V114-M118 HydrophobicContact CG1-CG 4.31Å; V114-M118 WeakPolarHBondContact O-CB 3.25Å; V114-M118 WeakPolarHBondContact O-CG 3.28Å; V114-M118 PolarHBondContact O-N 3.47Å
115	C	78.3	Confident	77.3	Confident	80 Å²	80	88.8 Å²	88.8	54%	0.541	45%	0.453	S	S	.	.	H	α-helix	trans	-60.5	-40.2	176	-159.1	0	0	0	0	111.1	L111 S112 R119	L111-C115 WeakPolarHBondContact O-CB 3.49Å; L111-C115 PolarHBondContact O-N 3.25Å; S112-C115 WeakPolarHBondContact O-CB 3.3Å; S112-C115 PolarHBondContact O-N 3.17Å; S112-C115 VanDerWaalsContact O-N 3.13Å; C115-R119 WeakPolarHBondContact O-CB 3.44Å; C115-R119 WeakPolarHBondContact O-CG 3.36Å; C115-R119 PolarHBondContact O-N 3.49Å
116	W	75.4	Confident	76.1	Confident	53 Å²	53	96.1 Å²	96.1	20%	0.201	47%	0.474	C	S	.	.	H	α-helix	trans	-63.8	-47.3	172	177.6	-94.7	0	0	0	113	L60 Y63 R64 S112 A113 V114 R119 L120	L60-W116 HydrophobicContact CD2-CH2 4.32Å; L60-W116 HydrophobicContact CD2-CZ3 4.2Å; Y63-W116 HydrophobicContact CD1-CB 4.04Å; Y63-W116 AromaticContact CD1-CD2 3.7Å; Y63-W116 HydrophobicContact CD1-CD2 3.7Å; Y63-W116 AromaticContact CD1-CE3 3.1Å; Y63-W116 HydrophobicContact CD1-CE3 3.1Å; Y63-W116 HydrophobicContact CD1-CG 4.1Å; Y63-W116 AromaticContact CD1-CZ3 3.84Å; Y63-W116 HydrophobicContact CD1-CZ3 3.84Å; Y63-W116 HydrophobicContact CE1-CB 3.31Å; Y63-W116 AromaticContact CE1-CD2 3.65Å; Y63-W116 HydrophobicContact CE1-CD2 3.65Å; Y63-W116 AromaticContact CE1-CE3 3.57Å; Y63-W116 HydrophobicContact CE1-CE3 3.57Å; Y63-W116 AromaticContact CE1-CG 3.56Å; Y63-W116 HydrophobicContact CE1-CG 3.56Å; Y63-W116 HydrophobicContact CE2-CB 4.42Å; Y63-W116 AromaticContact CG-CE3 3.93Å; Y63-W116 HydrophobicContact CG-CE3 3.93Å; R64-W116 VanDerWaalsContact CZ-CH2 3.41Å; R64-W116 VanDerWaalsContact NE-CH2 3.34Å; R64-W116 VanDerWaalsContact NH1-CH2 3.31Å; S112-W116 PolarHBondContact O-N 3.22Å; A113-W116 WeakPolarHBondContact O-CB 3.33Å; A113-W116 PolarHBondContact O-N 3.5Å; V114-W116 VanDerWaalsContact C-N 3.27Å; V114-W116 PolarHBondContact O-N 2.88Å; W116-R119 PolarHBondContact O-N 3Å; W116-L120 HydrophobicContact CD2-CD1 4.3Å; W116-L120 HydrophobicContact CZ2-CD1 3.46Å; W116-L120 VanDerWaalsContact CZ2-CD1 3.46Å; W116-L120 WeakPolarHBondContact O-CB 3.37Å; W116-L120 PolarHBondContact O-N 3.23Å
117	K	78.3	Confident	74.9	Confident	123 Å²	123	101.3 Å²	101.3	54%	0.535	49%	0.487	S	S	.	.	H	α-helix	trans	-59.2	-49.9	179.3	-113	-75	-178.7	166	0	110.9	A113 V114 R119 L120 E121	A113-K117 WeakPolarHBondContact O-CB 3.45Å; A113-K117 PolarHBondContact O-N 3.43Å; V114-K117 PolarHBondContact O-N 3.27Å; K117-R119 VanDerWaalsContact C-N 3.34Å; K117-R119 PolarHBondContact O-N 3.39Å; K117-L120 WeakPolarHBondContact O-CB 3.21Å; K117-L120 PolarHBondContact O-N 3.36Å; K117-E121 IonicContact NZ-OE1 3.88Å; K117-E121 PolarHBondContact NZ-OE1 3.08Å; K117-E121 WeakPolarHBondContact O-CG 3.21Å; K117-E121 PolarHBondContact O-N 2.87Å
118	M	76.4	Confident	73.4	Confident	117 Å²	117	106.7 Å²	106.7	58%	0.576	50%	0.499	S	S	*	.	H	α-helix	trans	-60.7	-40.7	177.8	-70.3	-64.6	178.5	0	0	112.2	V114 L120 E121 R122	V114-M118 HydrophobicContact CG1-CG 4.31Å; V114-M118 WeakPolarHBondContact O-CB 3.25Å; V114-M118 WeakPolarHBondContact O-CG 3.28Å; V114-M118 PolarHBondContact O-N 3.47Å; M118-L120 VanDerWaalsContact C-N 3.34Å; M118-L120 PolarHBondContact O-N 2.92Å; M118-E121 PolarHBondContact O-N 2.85Å; M118-R122 WeakPolarHBondContact O-CB 3.26Å; M118-R122 VanDerWaalsContact O-CG 3.29Å; M118-R122 WeakPolarHBondContact O-CG 3.31Å; M118-R122 PolarHBondContact O-N 2.93Å
119	R	69	Low	72	Confident	114 Å²	114	106.4 Å²	106.4	43%	0.43	49%	0.494	S	S	.	.	H	α-helix	trans	-63.6	-37.8	172.9	-82	-79.3	-148.7	163	10.1	112.6	E59 C115 W116 K117 R122 K123	E59-R119 IonicContact OE2-CZ 2.91Å; E59-R119 IonicContact OE2-NH1 2.62Å; E59-R119 IonicContact OE2-NH2 3.65Å; E59-R119 PolarHBondContact OE2-NH2 3.29Å; C115-R119 WeakPolarHBondContact O-CB 3.44Å; C115-R119 WeakPolarHBondContact O-CG 3.36Å; C115-R119 PolarHBondContact O-N 3.49Å; W116-R119 PolarHBondContact O-N 3Å; K117-R119 VanDerWaalsContact C-N 3.34Å; K117-R119 PolarHBondContact O-N 3.39Å; R119-R122 PolarHBondContact O-N 3.12Å; R119-K123 WeakPolarHBondContact O-CB 3.48Å; R119-K123 WeakPolarHBondContact O-CG 3.3Å; R119-K123 PolarHBondContact O-N 2.78Å
120	L	71.4	Confident	70.8	Confident	69 Å²	69	107.6 Å²	107.6	36%	0.361	51%	0.506	S	S	.	.	H	α-helix	trans	-67.5	-42.1	178.2	-129.4	127.6	0	0	0	111.5	W116 K117 M118 K123 K124	W116-L120 HydrophobicContact CD2-CD1 4.3Å; W116-L120 HydrophobicContact CZ2-CD1 3.46Å; W116-L120 VanDerWaalsContact CZ2-CD1 3.46Å; W116-L120 WeakPolarHBondContact O-CB 3.37Å; W116-L120 PolarHBondContact O-N 3.23Å; K117-L120 WeakPolarHBondContact O-CB 3.21Å; K117-L120 PolarHBondContact O-N 3.36Å; M118-L120 VanDerWaalsContact C-N 3.34Å; M118-L120 PolarHBondContact O-N 2.92Å; L120-K123 PolarHBondContact O-N 3.35Å; L120-K124 PolarHBondContact O-N 3.13Å
121	E	73.6	Confident	69.4	Low	74 Å²	74	111.8 Å²	111.8	35%	0.346	52%	0.516	S	S	.	.	H	α-helix	trans	-64.9	-43.1	173.8	-58.2	-51.6	157.3	0	0	110.6	K117 M118 K123 K124 E125	K117-E121 IonicContact NZ-OE1 3.88Å; K117-E121 PolarHBondContact NZ-OE1 3.08Å; K117-E121 WeakPolarHBondContact O-CG 3.21Å; K117-E121 PolarHBondContact O-N 2.87Å; M118-E121 PolarHBondContact O-N 2.85Å; E121-K123 VanDerWaalsContact C-N 3.3Å; E121-K123 PolarHBondContact O-N 3.16Å; E121-K124 WeakPolarHBondContact O-CA 3.16Å; E121-K124 WeakPolarHBondContact O-CB 3.42Å; E121-K124 PolarHBondContact O-N 3.38Å; E121-E125 PolarHBondContact O-N 2.97Å
122	R	68.4	Low	68.3	Low	186 Å²	186	111 Å²	111	70%	0.702	52%	0.516	S	S	*	.	H	α-helix	trans	-61.3	-33.9	172.4	-72.7	-177.7	-173.8	-161.9	3.8	113.2	M118 R119 E125 R126	M118-R122 WeakPolarHBondContact O-CB 3.26Å; M118-R122 VanDerWaalsContact O-CG 3.29Å; M118-R122 WeakPolarHBondContact O-CG 3.31Å; M118-R122 PolarHBondContact O-N 2.93Å; R119-R122 PolarHBondContact O-N 3.12Å; R122-E125 WeakPolarHBondContact O-CB 2.82Å; R122-E125 PolarHBondContact O-N 3.31Å; R122-R126 PolarHBondContact O-N 3.38Å
123	K	64.9	Low	67.2	Low	110 Å²	110	112.2 Å²	112.2	48%	0.478	53%	0.528	S	S	.	.	H	α-helix	trans	-68	-35.2	173	-84.7	-171.7	175.3	-172.6	0	112.1	R119 L120 E121 R127	R119-K123 WeakPolarHBondContact O-CB 3.48Å; R119-K123 WeakPolarHBondContact O-CG 3.3Å; R119-K123 PolarHBondContact O-N 2.78Å; L120-K123 PolarHBondContact O-N 3.35Å; E121-K123 VanDerWaalsContact C-N 3.3Å; E121-K123 PolarHBondContact O-N 3.16Å; K123-R127 WeakPolarHBondContact O-CG 3.07Å; K123-R127 PolarHBondContact O-N 2.79Å
124	K	66.4	Low	66.1	Low	139 Å²	139	116.3 Å²	116.3	60%	0.604	54%	0.543	S	S	*	.	H	α-helix	trans	-67.1	-42.8	171.9	-87.8	-178	173	179.1	0	111.6	L120 E121 R126 R127 R128	L120-K124 PolarHBondContact O-N 3.13Å; E121-K124 WeakPolarHBondContact O-CA 3.16Å; E121-K124 WeakPolarHBondContact O-CB 3.42Å; E121-K124 PolarHBondContact O-N 3.38Å; K124-R126 PolarHBondContact O-N 3.46Å; K124-R127 WeakPolarHBondContact O-CB 3.28Å; K124-R127 PolarHBondContact O-N 2.73Å; K124-R128 PolarHBondContact O-N 3.48Å
125	E	64.3	Low	65.1	Low	120 Å²	120	116.2 Å²	116.2	56%	0.561	54%	0.543	S	S	*	.	H	α-helix	trans	-56.2	-50.7	174	-159	89.2	-136.6	0	0	110.5	E121 R122 R127 R128 E129	E121-E125 PolarHBondContact O-N 2.97Å; R122-E125 WeakPolarHBondContact O-CB 2.82Å; R122-E125 PolarHBondContact O-N 3.31Å; E125-R127 VanDerWaalsContact C-N 3.27Å; E125-R127 PolarHBondContact O-N 2.88Å; E125-R128 WeakPolarHBondContact O-CA 2.83Å; E125-R128 WeakPolarHBondContact O-CB 3.18Å; E125-R128 PolarHBondContact O-N 3.27Å; E125-E129 PolarHBondContact O-N 3.47Å
126	R	60.9	Low	64.2	Low	174 Å²	174	115.4 Å²	115.4	66%	0.657	54%	0.541	S	S	*	.	H	α-helix	trans	-60.9	-31.4	179.6	-120	-172.8	-169.2	-99.1	3.2	114	R122 K124 R128 E129 S130	R122-R126 PolarHBondContact O-N 3.38Å; K124-R126 PolarHBondContact O-N 3.46Å; R126-R128 VanDerWaalsContact C-N 3.28Å; R126-E129 PolarHBondContact O-N 3.19Å; R126-S130 VanDerWaalsContact O-CB 3.29Å; R126-S130 WeakPolarHBondContact O-CB 3.32Å; R126-S130 PolarHBondContact O-N 3.38Å; R126-S130 PolarHBondContact O-OG 2.92Å
127	R	60.6	Low	63.4	Low	199 Å²	199	117.5 Å²	117.5	75%	0.751	56%	0.557	S	S	*	*	H	α-helix	trans	-66.6	-33.1	173.7	-74.1	-102	-168.5	-113.8	4.1	111.4	K123 K124 E125 Q131	K123-R127 WeakPolarHBondContact O-CG 3.07Å; K123-R127 PolarHBondContact O-N 2.79Å; K124-R127 WeakPolarHBondContact O-CB 3.28Å; K124-R127 PolarHBondContact O-N 2.73Å; E125-R127 VanDerWaalsContact C-N 3.27Å; E125-R127 PolarHBondContact O-N 2.88Å; R127-Q131 PolarHBondContact O-N 3.22Å
128	R	57.3	Low	62.5	Low	197 Å²	197	117.9 Å²	117.9	74%	0.743	56%	0.56	S	S	*	*	H	α-helix	trans	-74.6	-38.5	176.5	-135.7	175.4	-174.5	-91.7	-1.2	111.6	K124 E125 R126 T132	K124-R128 PolarHBondContact O-N 3.48Å; E125-R128 WeakPolarHBondContact O-CA 2.83Å; E125-R128 WeakPolarHBondContact O-CB 3.18Å; E125-R128 PolarHBondContact O-N 3.27Å; R126-R128 VanDerWaalsContact C-N 3.28Å; R128-T132 PolarHBondContact O-N 2.86Å; R128-T132 PolarHBondContact O-OG1 2.81Å
129	E	55.7	Low	61.6	Low	108 Å²	108	122 Å²	122	51%	0.505	57%	0.569	S	S	.	*	H	α-helix	trans	-68.6	-37	172	-62.8	180	144.2	0	0	112.4	E125 R126 T132 A133	E125-E129 PolarHBondContact O-N 3.47Å; R126-E129 PolarHBondContact O-N 3.19Å; E129-T132 VanDerWaalsContact CA-OG1 3.28Å; E129-T132 WeakPolarHBondContact CA-OG1 3.26Å; E129-T132 PolarHBondContact O-N 3.48Å; E129-T132 PolarHBondContact O-OG1 2.89Å; E129-A133 VanDerWaalsContact O-CB 3.32Å; E129-A133 WeakPolarHBondContact O-CB 3.48Å; E129-A133 PolarHBondContact O-N 3.4Å
130	S	56.2	Low	60.9	Low	65 Å²	65	120.2 Å²	120.2	46%	0.455	57%	0.574	S	S	.	*	H	α-helix	trans	-70.6	-33.8	179	-57.8	0	0	0	0	112.2	R126 L134	R126-S130 VanDerWaalsContact O-CB 3.29Å; R126-S130 WeakPolarHBondContact O-CB 3.32Å; R126-S130 PolarHBondContact O-N 3.38Å; R126-S130 PolarHBondContact O-OG 2.92Å; S130-L134 VanDerWaalsContact O-CB 3.29Å; S130-L134 WeakPolarHBondContact O-CB 3.21Å; S130-L134 PolarHBondContact O-N 2.8Å
131	Q	55	Low	60.2	Low	141 Å²	141	122.6 Å²	122.6	66%	0.659	59%	0.586	S	S	*	*	H	α-helix	trans	-67.4	-43	171.7	-82.8	-167.7	54.3	0	0	111.4	R127 L134 V135	R127-Q131 PolarHBondContact O-N 3.22Å; Q131-L134 PolarHBondContact O-N 2.96Å; Q131-V135 WeakPolarHBondContact O-CB 3.44Å; Q131-V135 WeakPolarHBondContact O-CG2 3.38Å; Q131-V135 PolarHBondContact O-N 2.99Å
132	T	58	Low	59.4	Low	94 Å²	94	127.6 Å²	127.6	58%	0.577	61%	0.607	S	S	*	*	H	α-helix	trans	-68.6	-36.6	179.1	38.1	0	0	0	0	112.7	R128 E129 A136	R128-T132 PolarHBondContact O-N 2.86Å; R128-T132 PolarHBondContact O-OG1 2.81Å; E129-T132 VanDerWaalsContact CA-OG1 3.28Å; E129-T132 WeakPolarHBondContact CA-OG1 3.26Å; E129-T132 PolarHBondContact O-N 3.48Å; E129-T132 PolarHBondContact O-OG1 2.89Å; T132-A136 WeakPolarHBondContact O-CB 3.29Å; T132-A136 PolarHBondContact O-N 3.28Å
133	A	58.4	Low	58.5	Low	63 Å²	63	125.5 Å²	125.5	52%	0.521	63%	0.629	S	S	.	*	H	α-helix	trans	-66.8	-40.6	172.9	0	0	0	0	0	112.8	E129 A136 N137	E129-A133 VanDerWaalsContact O-CB 3.32Å; E129-A133 WeakPolarHBondContact O-CB 3.48Å; E129-A133 PolarHBondContact O-N 3.4Å; A133-A136 PolarHBondContact O-N 3.37Å; A133-N137 WeakPolarHBondContact O-CB 3.42Å; A133-N137 PolarHBondContact O-N 3.02Å
134	L	57.7	Low	58.2	Low	133 Å²	133	126.3 Å²	126.3	70%	0.696	64%	0.637	S	S	*	*	H	α-helix	trans	-66.1	-40.7	177.1	-160.3	82.6	0	0	0	111.5	S130 Q131 N137 Q138	S130-L134 VanDerWaalsContact O-CB 3.29Å; S130-L134 WeakPolarHBondContact O-CB 3.21Å; S130-L134 PolarHBondContact O-N 2.8Å; Q131-L134 PolarHBondContact O-N 2.96Å; L134-N137 PolarHBondContact O-N 2.93Å; L134-Q138 PolarHBondContact O-N 3.46Å
135	V	60.2	Low	57.7	Low	82 Å²	82	125.6 Å²	125.6	50%	0.497	64%	0.639	S	S	.	*	H	α-helix	trans	-69.3	-35.3	178.4	-176.7	0	0	0	0	111.3	Q131 R139	Q131-V135 WeakPolarHBondContact O-CB 3.44Å; Q131-V135 WeakPolarHBondContact O-CG2 3.38Å; Q131-V135 PolarHBondContact O-N 2.99Å; V135-R139 PolarHBondContact O-N 2.91Å
136	A	60.1	Low	57.4	Low	62 Å²	62	125.9 Å²	125.9	51%	0.512	64%	0.643	S	S	.	*	H	α-helix	trans	-67.4	-42.3	173.9	0	0	0	0	0	112.3	T132 A133 R139 S140	T132-A136 WeakPolarHBondContact O-CB 3.29Å; T132-A136 PolarHBondContact O-N 3.28Å; A133-A136 PolarHBondContact O-N 3.37Å; A136-R139 PolarHBondContact O-N 3.04Å; A136-S140 PolarHBondContact O-N 3.48Å
137	N	59	Low	57.2	Low	98 Å²	98	123.1 Å²	123.1	52%	0.524	64%	0.642	S	S	.	*	H	α-helix	trans	-67.1	-37.2	177.8	-161.4	-76.8	0	0	0	112.1	A133 L134 R139 S140 I141	A133-N137 WeakPolarHBondContact O-CB 3.42Å; A133-N137 PolarHBondContact O-N 3.02Å; L134-N137 PolarHBondContact O-N 2.93Å; N137-R139 VanDerWaalsContact C-N 3.34Å; N137-R139 PolarHBondContact O-N 3.33Å; N137-S140 PolarHBondContact O-N 3.05Å; N137-S140 PolarHBondContact O-OG 3.2Å; N137-I141 WeakPolarHBondContact O-CG1 3.35Å; N137-I141 PolarHBondContact O-N 3.35Å; N137-I141 WeakPolarHBondContact OD1-CD1 3.09Å
138	Q	59.5	Low	56.9	Low	130 Å²	130	118.3 Å²	118.3	61%	0.607	64%	0.635	S	S	*	*	H	α-helix	trans	-66.6	-34.3	176.8	-151.8	-150.7	-22.1	0	0	112.6	L134 I141	L134-Q138 PolarHBondContact O-N 3.46Å; Q138-I141 PolarHBondContact O-N 2.92Å
139	R	56.4	Low	56.9	Low	204 Å²	204	113.1 Å²	113.1	77%	0.77	63%	0.628	S	S	*	*	H	α-helix	trans	-69.5	-33.5	175.5	-89.9	-169.8	176.2	171	-0.3	113.4	V135 A136 N137 I141	V135-R139 PolarHBondContact O-N 2.91Å; A136-R139 PolarHBondContact O-N 3.04Å; N137-R139 VanDerWaalsContact C-N 3.34Å; N137-R139 PolarHBondContact O-N 3.33Å; R139-I141 VanDerWaalsContact C-N 3.33Å
140	S	55.4	Low	57	Low	76 Å²	76	113.4 Å²	113.4	53%	0.531	64%	0.637	S	S	.	*	H	α-helix	trans	-74.4	-21	177	52.7	0	0	0	0	114	A136 N137 F142	A136-S140 PolarHBondContact O-N 3.48Å; N137-S140 PolarHBondContact O-N 3.05Å; N137-S140 PolarHBondContact O-OG 3.2Å; S140-F142 VanDerWaalsContact C-N 3.3Å
141	I	56.5	Low	57.1	Low	120 Å²	120	117.2 Å²	117.2	62%	0.615	65%	0.651	S	S	*	*	H	α-helix	trans	-78.8	-17.9	177.6	-69.2	169	0	0	0	111.7	N137 Q138 R139	N137-I141 WeakPolarHBondContact O-CG1 3.35Å; N137-I141 PolarHBondContact O-N 3.35Å; N137-I141 WeakPolarHBondContact OD1-CD1 3.09Å; Q138-I141 PolarHBondContact O-N 2.92Å; R139-I141 VanDerWaalsContact C-N 3.33Å
142	F	56.8	Low	57.3	Low	178 Å²	178	115.2 Å²	115.2	78%	0.781	65%	0.65	S	S	*	*			trans	-105.9	6.4	-176.5	-101.9	-86.1	0	0	0	114.5	S140	S140-F142 VanDerWaalsContact C-N 3.3Å
143	A	49	Very low	57.2	Low	142 Å²	142	117.1 Å²	117.1	100%	1.174	66%	0.657	S	S	*	*			trans	-113.6	0	175.4	0	0	0	0	0	109.8

Retrieved 143 of 143 residues in 730.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).