A0A060XCB9_ONCMY Loading...

SUZ RNA-binding domain-containing

AlphaFold DB , UniProt , Accession A0A060XCB9, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110528404, Length 161 aa.

						>A0A060XCB9_ONCMY|A0A060XCB9|LOC110528404
MEDEEVCESWEEAADSGEIVKRLEAKLKISQKAKKASISSGSSPIRTAMVIQDESLPAAPPPQIRILKRPSSNGSLGSSGSSNRPTQQPKSLAQREAEYAEARRRILGSASSEETPQDKPRPERPVRVSAQPPQPELVSLNNHVIRQPTGPDGTLGFRRYR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.6	Very low	52.4	Low	221 Å²	221	159.6 Å²	159.6	100%	1.089	78%	0.777	S	S	*	*				0	105.3	0	-132.1	151.3	-172	0	0	102.9	D3	M1-D3 PolarHBondContact O-N 3.43Å
2	E	43.6	Very low	52.9	Low	196 Å²	196	156.8 Å²	156.8	92%	0.916	76%	0.761	S	S	*	*			trans	-74.4	104.5	170.2	-74.3	163.4	161.3	0	0	104	E4	E2-E4 VanDerWaalsContact C-N 3.35Å; E2-E4 PolarHBondContact O-N 2.91Å
3	D	44.5	Very low	53.8	Low	143 Å²	143	148.7 Å²	148.7	77%	0.765	74%	0.735	S	S	*	*			trans	-64	102.4	174.8	-55.6	-55.6	0	0	0	105.8	M1 E5	M1-D3 PolarHBondContact O-N 3.43Å; D3-E5 VanDerWaalsContact C-N 3.32Å; D3-E5 PolarHBondContact O-N 3.08Å
4	E	52	Low	54.7	Low	179 Å²	179	144 Å²	144	84%	0.836	73%	0.732	S	S	*	*			trans	-58.9	102	171.6	-164.3	159.9	-156.4	0	0	105.4	E2 V6	E2-E4 VanDerWaalsContact C-N 3.35Å; E2-E4 PolarHBondContact O-N 2.91Å; E4-V6 PolarHBondContact O-N 3.08Å
5	E	53.7	Low	55.4	Low	187 Å²	187	144.2 Å²	144.2	87%	0.874	74%	0.735	S	S	*	*			trans	-59.8	81.7	179.1	-115.6	175	-168	0	0	107.9	D3 C7	D3-E5 VanDerWaalsContact C-N 3.32Å; D3-E5 PolarHBondContact O-N 3.08Å; E5-C7 PolarHBondContact O-N 3.07Å
6	V	55.2	Low	56.6	Low	115 Å²	115	139.8 Å²	139.8	70%	0.697	72%	0.721	S	S	*	*			trans	-65.1	105.6	169.5	175.3	0	0	0	0	104.8	E4 E8	E4-V6 PolarHBondContact O-N 3.08Å; V6-E8 PolarHBondContact O-N 2.74Å
7	C	47.3	Very low	57.7	Low	64 Å²	64	133.8 Å²	133.8	43%	0.432	70%	0.702	S	S	.	*			trans	-53.6	109.6	175.9	-56.4	0	0	0	0	108.8	E5 S9 A13	E5-C7 PolarHBondContact O-N 3.07Å; C7-S9 PolarHBondContact O-N 2.88Å; C7-S9 VanDerWaalsContact O-N 3.13Å; C7-A13 HydrophobicContact CB-CB 3.92Å
8	E	49.8	Very low	59	Low	195 Å²	195	133.4 Å²	133.4	91%	0.911	70%	0.696	S	S	*	*	S	Bend	trans	-70.1	-8.4	-174.1	-62.5	-172.6	161.3	0	0	112.5	V6	V6-E8 PolarHBondContact O-N 2.74Å
9	S	54.2	Low	60	Low	50 Å²	50	133.7 Å²	133.7	35%	0.35	70%	0.697	S	S	.	*	S	Bend	trans	-136.1	134.4	176.9	-176.6	0	0	0	0	111.8	C7 E11 E12 A13	C7-S9 PolarHBondContact O-N 2.88Å; C7-S9 VanDerWaalsContact O-N 3.13Å; S9-E11 PolarHBondContact O-N 3.1Å; S9-E11 VanDerWaalsContact O-N 3.13Å; S9-E11 WeakPolarHBondContact OG-CB 3.39Å; S9-E11 PolarHBondContact OG-N 2.81Å; S9-E12 PolarHBondContact O-N 2.81Å; S9-E12 VanDerWaalsContact O-N 3.08Å; S9-A13 PolarHBondContact O-N 3.27Å
10	W	79.5	Confident	61.2	Low	247 Å²	247	132.1 Å²	132.1	94%	0.936	69%	0.693	S	S	*	*	H	α-helix	trans	-56.8	-23.2	170.3	-79.6	82.9	0	0	0	113
11	E	61.2	Low	62.3	Low	159 Å²	159	133.3 Å²	133.3	74%	0.743	69%	0.693	S	S	*	*	H	α-helix	trans	-71.7	-40.7	176.4	-170.9	170.9	-160	0	0	111.6	S9 A14 D15	S9-E11 PolarHBondContact O-N 3.1Å; S9-E11 VanDerWaalsContact O-N 3.13Å; S9-E11 WeakPolarHBondContact OG-CB 3.39Å; S9-E11 PolarHBondContact OG-N 2.81Å; E11-A14 PolarHBondContact O-N 3.43Å; E11-D15 PolarHBondContact O-N 3.32Å
12	E	58.5	Low	64.6	Low	126 Å²	126	131.4 Å²	131.4	59%	0.589	67%	0.673	S	S	*	*	H	α-helix	trans	-76.6	-34.4	-177.9	-170.3	163.8	-163.5	0	0	112.2	S9 A14 D15 S16	S9-E12 PolarHBondContact O-N 2.81Å; S9-E12 VanDerWaalsContact O-N 3.08Å; E12-A14 PolarHBondContact O-N 2.6Å; E12-D15 PolarHBondContact O-N 3.07Å; E12-S16 PolarHBondContact O-N 3.12Å; E12-S16 VanDerWaalsContact O-N 3.11Å
13	A	63.8	Low	66.6	Low	51 Å²	51	126.9 Å²	126.9	42%	0.421	66%	0.655	S	S	.	*	H	α-helix	trans	-62.1	-28.9	173.1	0	0	0	0	0	112.9	C7 S9	C7-A13 HydrophobicContact CB-CB 3.92Å; S9-A13 PolarHBondContact O-N 3.27Å
14	A	66.4	Low	68.5	Low	83 Å²	83	124.6 Å²	124.6	69%	0.686	64%	0.64	S	S	*	*	H	α-helix	trans	-81.5	-33.8	177.5	0	0	0	0	0	112.7	E11 E12	E11-A14 PolarHBondContact O-N 3.43Å; E12-A14 PolarHBondContact O-N 2.6Å
15	D	65.6	Low	69.9	Low	147 Å²	147	118.3 Å²	118.3	79%	0.786	62%	0.618	S	S	*	*	H	α-helix	trans	-85.3	-17.4	-176	-154.4	31.3	0	0	0	113.7	E11 E12 G17	E11-D15 PolarHBondContact O-N 3.32Å; E12-D15 PolarHBondContact O-N 3.07Å; D15-G17 PolarHBondContact O-N 2.92Å
16	S	74.1	Confident	71.1	Confident	73 Å²	73	116 Å²	116	51%	0.51	61%	0.605	S	S	.	*	T	Hydrogen-bonded Turn	trans	-58	-19.3	178.9	170.7	0	0	0	0	114.7	E12 E18	E12-S16 PolarHBondContact O-N 3.12Å; E12-S16 VanDerWaalsContact O-N 3.11Å; S16-E18 PolarHBondContact O-N 2.76Å
17	G	75.4	Confident	72.2	Confident	38 Å²	38	115.5 Å²	115.5	39%	0.392	60%	0.598	S	S	.	*			trans	66.2	4	177.5	0	0	0	0	0	114.6	D15 I19 V20 K21	D15-G17 PolarHBondContact O-N 2.92Å; G17-I19 VanDerWaalsContact C-N 3.31Å; G17-I19 PolarHBondContact O-N 3.2Å; G17-V20 WeakPolarHBondContact O-CB 3.09Å; G17-V20 PolarHBondContact O-N 3.23Å; G17-V20 VanDerWaalsContact O-N 3.08Å; G17-K21 PolarHBondContact O-N 2.85Å; G17-K21 VanDerWaalsContact O-N 3.15Å
18	E	80.9	Confident	73.4	Confident	127 Å²	127	118.6 Å²	118.6	59%	0.593	60%	0.604	S	S	*	*	H	α-helix	trans	-61.8	-37	-176	-171.1	178.3	174.6	0	0	112.7	S16 V20 K21 R22	S16-E18 PolarHBondContact O-N 2.76Å; E18-V20 VanDerWaalsContact C-N 3.3Å; E18-V20 PolarHBondContact O-N 2.86Å; E18-K21 PolarHBondContact O-N 3.31Å; E18-R22 WeakPolarHBondContact O-CB 3.42Å; E18-R22 PolarHBondContact O-N 2.98Å
19	I	79.1	Confident	74	Confident	140 Å²	140	115 Å²	115	72%	0.718	59%	0.59	S	S	*	*	H	α-helix	trans	-59.2	-41.2	174.8	-90.6	155.6	0	0	0	111.7	G17 L23	G17-I19 VanDerWaalsContact C-N 3.31Å; G17-I19 PolarHBondContact O-N 3.2Å; I19-L23 VanDerWaalsContact O-CB 3.32Å; I19-L23 WeakPolarHBondContact O-CB 3.5Å; I19-L23 PolarHBondContact O-N 3.03Å
20	V	83.7	Confident	74.5	Confident	101 Å²	101	115.1 Å²	115.1	61%	0.612	59%	0.591	S	S	*	*	H	α-helix	trans	-68.1	-44.8	179	-179.7	0	0	0	0	109.8	G17 E18 R22 L23 E24	G17-V20 WeakPolarHBondContact O-CB 3.09Å; G17-V20 PolarHBondContact O-N 3.23Å; G17-V20 VanDerWaalsContact O-N 3.08Å; E18-V20 VanDerWaalsContact C-N 3.3Å; E18-V20 PolarHBondContact O-N 2.86Å; V20-R22 PolarHBondContact O-N 3.48Å; V20-L23 PolarHBondContact O-N 2.94Å; V20-E24 WeakPolarHBondContact O-CB 3.49Å; V20-E24 PolarHBondContact O-N 2.88Å
21	K	84.1	Confident	73.6	Confident	158 Å²	158	110.4 Å²	110.4	69%	0.687	58%	0.579	S	S	*	*	H	α-helix	trans	-61.9	-43.8	178.1	-168.2	177.5	-177.7	179.7	0	112.3	G17 E18 E24 A25	G17-K21 PolarHBondContact O-N 2.85Å; G17-K21 VanDerWaalsContact O-N 3.15Å; E18-K21 PolarHBondContact O-N 3.31Å; K21-E24 PolarHBondContact O-N 2.95Å; K21-A25 WeakPolarHBondContact O-CB 3.4Å; K21-A25 PolarHBondContact O-N 3.4Å
22	R	84.1	Confident	73.5	Confident	180 Å²	180	111.2 Å²	111.2	68%	0.679	58%	0.58	S	S	*	*	H	α-helix	trans	-65.4	-38.7	176.4	-172.8	172.9	-176.5	155.8	-0	111.9	E18 V20 K26	E18-R22 WeakPolarHBondContact O-CB 3.42Å; E18-R22 PolarHBondContact O-N 2.98Å; V20-R22 PolarHBondContact O-N 3.48Å; R22-K26 WeakPolarHBondContact O-CG 3.29Å; R22-K26 PolarHBondContact O-N 3.25Å; R22-K26 VanDerWaalsContact O-N 3.14Å
23	L	85.5	Confident	73.4	Confident	101 Å²	101	108 Å²	108	53%	0.529	58%	0.575	S	S	.	*	H	α-helix	trans	-65.6	-46.9	175.8	-178.9	61.7	0	0	0	111.3	I19 V20 A25 K26 L27	I19-L23 VanDerWaalsContact O-CB 3.32Å; I19-L23 WeakPolarHBondContact O-CB 3.5Å; I19-L23 PolarHBondContact O-N 3.03Å; V20-L23 PolarHBondContact O-N 2.94Å; L23-A25 PolarHBondContact O-N 2.94Å; L23-K26 PolarHBondContact O-N 3.45Å; L23-L27 HydrophobicContact CD1-CD1 4.41Å; L23-L27 HydrophobicContact CD1-CG 4.43Å; L23-L27 HydrophobicContact CG-CD1 4.2Å; L23-L27 WeakPolarHBondContact O-CG 3.45Å; L23-L27 PolarHBondContact O-N 3.3Å
24	E	84.5	Confident	73.1	Confident	96 Å²	96	112 Å²	112	45%	0.449	58%	0.583	S	S	.	*	H	α-helix	trans	-61	-44.1	178.9	-164.8	-164.1	162.9	0	0	111.6	V20 K21 K26 L27 K28	V20-E24 WeakPolarHBondContact O-CB 3.49Å; V20-E24 PolarHBondContact O-N 2.88Å; K21-E24 PolarHBondContact O-N 2.95Å; E24-K26 PolarHBondContact O-N 2.86Å; E24-L27 PolarHBondContact O-N 3.22Å; E24-K28 HydrophobicContact CG-CD 4.39Å; E24-K28 PolarHBondContact O-N 3.37Å; E24-K28 WeakPolarHBondContact OE1-CE 3.47Å; E24-K28 IonicContact OE1-NZ 2.6Å; E24-K28 PolarHBondContact OE1-NZ 3.31Å
25	A	80.9	Confident	72.5	Confident	47 Å²	47	116.2 Å²	116.2	39%	0.388	59%	0.586	S	S	.	*	H	α-helix	trans	-59.2	-46.2	176.2	0	0	0	0	0	111.8	K21 L23 L27 K28 I29	K21-A25 WeakPolarHBondContact O-CB 3.4Å; K21-A25 PolarHBondContact O-N 3.4Å; L23-A25 PolarHBondContact O-N 2.94Å; A25-L27 VanDerWaalsContact C-N 3.34Å; A25-L27 PolarHBondContact O-N 3.34Å; A25-K28 PolarHBondContact O-N 3.12Å; A25-I29 WeakPolarHBondContact O-CD1 3.26Å; A25-I29 VanDerWaalsContact O-CG1 3.26Å; A25-I29 WeakPolarHBondContact O-CG1 3.42Å; A25-I29 PolarHBondContact O-N 2.97Å
26	K	78.3	Confident	71.9	Confident	139 Å²	139	111.8 Å²	111.8	60%	0.604	57%	0.57	S	S	*	*	H	α-helix	trans	-62.4	-39.2	176.7	-74.9	176.7	67.2	-179.1	0	112.3	R22 L23 E24 S30	R22-K26 WeakPolarHBondContact O-CG 3.29Å; R22-K26 PolarHBondContact O-N 3.25Å; R22-K26 VanDerWaalsContact O-N 3.14Å; L23-K26 PolarHBondContact O-N 3.45Å; E24-K26 PolarHBondContact O-N 2.86Å; K26-S30 WeakPolarHBondContact O-CB 3.19Å; K26-S30 PolarHBondContact O-N 3.23Å
27	L	78.5	Confident	70.8	Confident	104 Å²	104	112 Å²	112	55%	0.545	57%	0.571	S	S	.	*	H	α-helix	trans	-68.2	-41.8	177.8	-71	175.4	0	0	0	112.2	L23 E24 A25 I29 S30 Q31	L23-L27 HydrophobicContact CD1-CD1 4.41Å; L23-L27 HydrophobicContact CD1-CG 4.43Å; L23-L27 HydrophobicContact CG-CD1 4.2Å; L23-L27 WeakPolarHBondContact O-CG 3.45Å; L23-L27 PolarHBondContact O-N 3.3Å; E24-L27 PolarHBondContact O-N 3.22Å; A25-L27 VanDerWaalsContact C-N 3.34Å; A25-L27 PolarHBondContact O-N 3.34Å; L27-I29 PolarHBondContact O-N 3.33Å; L27-S30 PolarHBondContact O-N 3.13Å; L27-Q31 PolarHBondContact O-N 3.35Å
28	K	73.1	Confident	69.8	Low	129 Å²	129	117.4 Å²	117.4	56%	0.561	59%	0.59	S	S	*	*	H	α-helix	trans	-60.8	-41.9	174.6	-83	170.7	162.8	163.6	0	112.1	E24 A25 K32	E24-K28 HydrophobicContact CG-CD 4.39Å; E24-K28 PolarHBondContact O-N 3.37Å; E24-K28 WeakPolarHBondContact OE1-CE 3.47Å; E24-K28 IonicContact OE1-NZ 2.6Å; E24-K28 PolarHBondContact OE1-NZ 3.31Å; A25-K28 PolarHBondContact O-N 3.12Å; K28-K32 PolarHBondContact O-N 2.94Å; K28-K32 VanDerWaalsContact O-N 3.17Å
29	I	63.4	Low	68.3	Low	118 Å²	118	116.3 Å²	116.3	61%	0.605	60%	0.596	S	S	*	*	H	α-helix	trans	-65.9	-42.8	176.4	-66	160.2	0	0	0	110.9	A25 L27 K32 A33	A25-I29 WeakPolarHBondContact O-CD1 3.26Å; A25-I29 VanDerWaalsContact O-CG1 3.26Å; A25-I29 WeakPolarHBondContact O-CG1 3.42Å; A25-I29 PolarHBondContact O-N 2.97Å; L27-I29 PolarHBondContact O-N 3.33Å; I29-K32 PolarHBondContact O-N 3.45Å; I29-A33 WeakPolarHBondContact O-CB 3.38Å; I29-A33 PolarHBondContact O-N 3.09Å
30	S	63.2	Low	66.7	Low	53 Å²	53	113.3 Å²	113.3	37%	0.371	59%	0.587	S	S	.	*	H	α-helix	trans	-65.6	-39.5	178.9	-166.7	0	0	0	0	112.7	K26 L27 A33 K34	K26-S30 WeakPolarHBondContact O-CB 3.19Å; K26-S30 PolarHBondContact O-N 3.23Å; L27-S30 PolarHBondContact O-N 3.13Å; S30-A33 PolarHBondContact O-N 2.93Å; S30-K34 WeakPolarHBondContact O-CB 3.35Å; S30-K34 VanDerWaalsContact O-CG 3.29Å; S30-K34 WeakPolarHBondContact O-CG 3.45Å; S30-K34 PolarHBondContact O-N 3.42Å
31	Q	61	Low	65.4	Low	149 Å²	149	112 Å²	112	70%	0.696	59%	0.594	S	S	*	*	H	α-helix	trans	-63.2	-42.6	173.9	-82.1	-169.1	13.6	0	0	112.2	L27 K34 K35	L27-Q31 PolarHBondContact O-N 3.35Å; Q31-K34 PolarHBondContact O-N 3.42Å; Q31-K35 PolarHBondContact O-N 3.3Å; Q31-K35 VanDerWaalsContact O-N 3.09Å
32	K	59.1	Low	64.3	Low	175 Å²	175	110 Å²	110	76%	0.761	60%	0.6	S	S	*	*	H	α-helix	trans	-64	-40.9	177.3	-121.7	178.5	173.7	-170.1	0	111.8	K28 I29 K35 A36	K28-K32 PolarHBondContact O-N 2.94Å; K28-K32 VanDerWaalsContact O-N 3.17Å; I29-K32 PolarHBondContact O-N 3.45Å; K32-K35 PolarHBondContact O-N 2.96Å; K32-A36 PolarHBondContact O-N 3.46Å
33	A	57	Low	62.7	Low	58 Å²	58	107 Å²	107	48%	0.479	61%	0.607	S	S	.	*	H	α-helix	trans	-67.7	-40.1	176.6	0	0	0	0	0	112.9	I29 S30 K35 A36 S37	I29-A33 WeakPolarHBondContact O-CB 3.38Å; I29-A33 PolarHBondContact O-N 3.09Å; S30-A33 PolarHBondContact O-N 2.93Å; A33-K35 VanDerWaalsContact C-N 3.32Å; A33-K35 PolarHBondContact O-N 3.26Å; A33-A36 PolarHBondContact O-N 3.46Å; A33-S37 PolarHBondContact O-N 2.98Å
34	K	56.3	Low	61.1	Low	135 Å²	135	107.5 Å²	107.5	59%	0.587	62%	0.616	S	S	*	*	H	α-helix	trans	-65.9	-32.1	176.1	-74.9	-178.6	-178.6	-173	0	113.2	S30 Q31 S37 I38	S30-K34 WeakPolarHBondContact O-CB 3.35Å; S30-K34 VanDerWaalsContact O-CG 3.29Å; S30-K34 WeakPolarHBondContact O-CG 3.45Å; S30-K34 PolarHBondContact O-N 3.42Å; Q31-K34 PolarHBondContact O-N 3.42Å; K34-S37 PolarHBondContact O-OG 3.42Å; K34-I38 PolarHBondContact O-N 2.93Å
35	K	54.7	Low	59.4	Low	173 Å²	173	110.2 Å²	110.2	75%	0.752	63%	0.632	S	S	*	*	H	α-helix	trans	-74.2	-30.1	176.6	-145.5	-175	-177	-165.5	0	112.2	Q31 K32 A33	Q31-K35 PolarHBondContact O-N 3.3Å; Q31-K35 VanDerWaalsContact O-N 3.09Å; K32-K35 PolarHBondContact O-N 2.96Å; A33-K35 VanDerWaalsContact C-N 3.32Å; A33-K35 PolarHBondContact O-N 3.26Å
36	A	53.9	Low	58.3	Low	54 Å²	54	119.5 Å²	119.5	45%	0.446	66%	0.657	S	S	.	*	H	α-helix	trans	-78.6	-35.7	173.8	0	0	0	0	0	112.8	K32 A33 I38 S39 S40	K32-A36 PolarHBondContact O-N 3.46Å; A33-A36 PolarHBondContact O-N 3.46Å; A36-I38 VanDerWaalsContact C-N 3.27Å; A36-I38 PolarHBondContact O-N 2.88Å; A36-S39 PolarHBondContact O-N 3.24Å; A36-S39 PolarHBondContact O-OG 3.41Å; A36-S39 VanDerWaalsContact O-OG 3.12Å; A36-S40 PolarHBondContact O-N 2.89Å; A36-S40 PolarHBondContact O-OG 3.13Å
37	S	50	Low	57.3	Low	78 Å²	78	118.3 Å²	118.3	55%	0.545	66%	0.661	S	S	.	*	H	α-helix	trans	-75.8	-11	179.8	77.2	0	0	0	0	114.4	A33 K34	A33-S37 PolarHBondContact O-N 2.98Å; K34-S37 PolarHBondContact O-OG 3.42Å
38	I	53.7	Low	56.3	Low	151 Å²	151	117.6 Å²	117.6	77%	0.774	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.6	-21.8	173.6	-83.1	168.6	0	0	0	111.8	K34 A36	K34-I38 PolarHBondContact O-N 2.93Å; A36-I38 VanDerWaalsContact C-N 3.27Å; A36-I38 PolarHBondContact O-N 2.88Å
39	S	50.6	Low	55.4	Low	104 Å²	104	120.3 Å²	120.3	73%	0.727	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.8	-14.9	178.8	56.9	0	0	0	0	114.8	A36	A36-S39 PolarHBondContact O-N 3.24Å; A36-S39 PolarHBondContact O-OG 3.41Å; A36-S39 VanDerWaalsContact O-OG 3.12Å
40	S	46	Very low	55.3	Low	77 Å²	77	120.3 Å²	120.3	54%	0.538	69%	0.693	S	S	.	*	S	Bend	trans	-116.1	98.9	171.2	58.1	0	0	0	0	108.8	A36	A36-S40 PolarHBondContact O-N 2.89Å; A36-S40 PolarHBondContact O-OG 3.13Å
41	G	55.2	Low	55.3	Low	73 Å²	73	125.7 Å²	125.7	75%	0.753	72%	0.715	S	S	*	*			trans	-53	139.5	169.6	0	0	0	0	0	111.2
42	S	60.9	Low	55.1	Low	116 Å²	116	125.6 Å²	125.6	81%	0.811	72%	0.715	S	S	*	*			trans	79.8	109.1	169.9	-161.3	0	0	0	0	117.1
43	S	50.6	Low	55.2	Low	117 Å²	117	123.3 Å²	123.3	82%	0.818	71%	0.711	S	S	*	*			trans	-165.1	151.2	151.8	-83.7	0	0	0	0	110.2
44	P	52.8	Low	55.4	Low	111 Å²	111	128.8 Å²	128.8	72%	0.721	73%	0.727	S	S	*	*				-114.9	115.1	-115.2	34.2	-23.6	0	0	0	112.4
45	I	47.9	Very low	55.8	Low	153 Å²	153	126.2 Å²	126.2	79%	0.785	73%	0.726	S	S	*	*			trans	-106.4	101.7	150	-62	178.7	0	0	0	104.4	T47	I45-T47 PolarHBondContact O-N 3Å; I45-T47 PolarHBondContact O-OG1 3.29Å
46	R	57.8	Low	56.3	Low	242 Å²	242	124.5 Å²	124.5	91%	0.913	72%	0.724	S	S	*	*			trans	-71.2	77.3	168.1	-77	-169.4	-92.2	-150.4	-4.2	107.6	A48	R46-A48 PolarHBondContact O-N 3.38Å
47	T	58.2	Low	57.1	Low	114 Å²	114	127.9 Å²	127.9	70%	0.699	74%	0.742	S	S	*	*			trans	-57.9	119.2	155.5	6.5	0	0	0	0	105.7	I45 M49	I45-T47 PolarHBondContact O-N 3Å; I45-T47 PolarHBondContact O-OG1 3.29Å; T47-M49 PolarHBondContact O-N 3.21Å
48	A	56.2	Low	58.2	Low	89 Å²	89	128.8 Å²	128.8	74%	0.736	75%	0.754	S	S	*	*			trans	-46.4	119.3	172	0	0	0	0	0	107.5	R46 V50	R46-A48 PolarHBondContact O-N 3.38Å; A48-V50 VanDerWaalsContact C-N 3.32Å; A48-V50 PolarHBondContact O-N 3.23Å
49	M	54.2	Low	59.3	Low	187 Å²	187	125.8 Å²	125.8	92%	0.921	75%	0.752	S	S	*	*			trans	-64.4	101	178.2	-65.4	-176.1	78	0	0	106.7	T47 I51	T47-M49 PolarHBondContact O-N 3.21Å; M49-I51 PolarHBondContact O-N 3.44Å
50	V	62.3	Low	60.9	Low	118 Å²	118	126.3 Å²	126.3	72%	0.715	75%	0.753	S	S	*	*			trans	-69.4	115.3	166.1	177.4	0	0	0	0	104.6	A48 Q52	A48-V50 VanDerWaalsContact C-N 3.32Å; A48-V50 PolarHBondContact O-N 3.23Å; V50-Q52 VanDerWaalsContact C-N 3.29Å; V50-Q52 PolarHBondContact O-N 2.97Å
51	I	63.7	Low	62.6	Low	165 Å²	165	128.2 Å²	128.2	85%	0.846	76%	0.763	S	S	*	*			trans	-58.8	100.9	168.1	-60.4	174.5	0	0	0	105.3	M49 D53	M49-I51 PolarHBondContact O-N 3.44Å; I51-D53 PolarHBondContact O-N 3.01Å
52	Q	55.4	Low	64	Low	147 Å²	147	130.5 Å²	130.5	69%	0.687	77%	0.765	S	S	*	*			trans	-76.3	111.9	173.2	-83.1	177	-11.3	0	0	106.4	V50 E54	V50-Q52 VanDerWaalsContact C-N 3.29Å; V50-Q52 PolarHBondContact O-N 2.97Å; Q52-E54 VanDerWaalsContact C-N 3.34Å; Q52-E54 PolarHBondContact O-N 3.46Å
53	D	62.3	Low	65.2	Low	128 Å²	128	133.9 Å²	133.9	68%	0.684	77%	0.768	S	S	*	*			trans	-64.1	101.6	158.9	-166	-22.1	0	0	0	106.1	I51 S55	I51-D53 PolarHBondContact O-N 3.01Å; D53-S55 PolarHBondContact O-N 3.27Å; D53-S55 WeakPolarHBondContact OD1-CB 3.36Å; D53-S55 PolarHBondContact OD1-OG 3.14Å
54	E	60.9	Low	66.9	Low	172 Å²	172	135.3 Å²	135.3	80%	0.804	77%	0.765	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.1	9.6	-172.8	-57.8	-122.5	156.1	0	0	113.1	Q52 L56	Q52-E54 VanDerWaalsContact C-N 3.34Å; Q52-E54 PolarHBondContact O-N 3.46Å; E54-L56 VanDerWaalsContact C-N 3.3Å; E54-L56 PolarHBondContact O-N 2.95Å
55	S	64.9	Low	68.6	Low	81 Å²	81	141.2 Å²	141.2	57%	0.566	77%	0.773	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77	-12.3	179.3	57.9	0	0	0	0	114	D53	D53-S55 PolarHBondContact O-N 3.27Å; D53-S55 WeakPolarHBondContact OD1-CB 3.36Å; D53-S55 PolarHBondContact OD1-OG 3.14Å
56	L	64.4	Low	70.4	Confident	138 Å²	138	141.4 Å²	141.4	72%	0.723	77%	0.774	S	S	*	*	S	Bend	trans	-115.1	123.7	-178.2	-58.4	-176.1	0	0	0	111.6	E54 A58	E54-L56 VanDerWaalsContact C-N 3.3Å; E54-L56 PolarHBondContact O-N 2.95Å; L56-A58 PolarHBondContact O-N 3.42Å
57	P	70.8	Confident	71.8	Confident	124 Å²	124	137.4 Å²	137.4	81%	0.805	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-59.4	131.5	176.7	24.1	-31.9	0	0	0	109.9	A59	P57-A59 PolarHBondContact O-N 3.3Å
58	A	73.5	Confident	73.2	Confident	97 Å²	97	140.3 Å²	140.3	80%	0.802	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-53.5	125.9	176	0	0	0	0	0	109.9	L56	L56-A58 PolarHBondContact O-N 3.42Å
59	A	77.1	Confident	74.6	Confident	88 Å²	88	146.7 Å²	146.7	73%	0.727	78%	0.778	S	S	*	*	P	Polyproline II helix	trans	-57.8	138	-177.6	0	0	0	0	0	110.6	P57	P57-A59 PolarHBondContact O-N 3.3Å
60	P	83.4	Confident	76	Confident	116 Å²	116	143.2 Å²	143.2	75%	0.753	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-59.2	140.9	179.7	22.5	-31.3	0	0	0	110.3
61	P	82.3	Confident	76.6	Confident	116 Å²	116	143.4 Å²	143.4	75%	0.753	78%	0.775	S	S	*	*	P	Polyproline II helix	trans	-60	141	-177.6	24.6	-33.6	0	0	0	110.5	Q63	P61-Q63 PolarHBondContact O-N 3.48Å
62	P	84.2	Confident	76.7	Confident	122 Å²	122	139.5 Å²	139.5	79%	0.792	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-62.7	129	-177	25.8	-34.1	0	0	0	110.4	I64	P62-I64 PolarHBondContact O-N 3.04Å
63	Q	86.2	Confident	77.2	Confident	186 Å²	186	140.7 Å²	140.7	87%	0.869	77%	0.774	S	S	*	*			trans	-86.8	113	-177	-144.8	173.5	18	0	0	109.9	P61	P61-Q63 PolarHBondContact O-N 3.48Å
64	I	85.5	Confident	77.4	Confident	148 Å²	148	137.9 Å²	137.9	76%	0.759	78%	0.775	S	S	*	*			trans	-87.5	135.9	173.8	61	171.8	0	0	0	110.2	P62	P62-I64 PolarHBondContact O-N 3.04Å
65	R	88.6	Confident	77.1	Confident	234 Å²	234	134.4 Å²	134.4	88%	0.883	77%	0.77	S	S	*	*			trans	-121.5	114.1	174.7	-66	178.8	68	170.4	1	108.8
66	I	86.6	Confident	76.7	Confident	158 Å²	158	139 Å²	139	81%	0.81	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-86.1	121.4	178.4	-58.2	173.5	0	0	0	108.2
67	L	87.3	Confident	76.1	Confident	157 Å²	157	134.7 Å²	134.7	82%	0.822	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-71.4	140.4	174.8	-157.8	118.5	0	0	0	109.8	R69	L67-R69 PolarHBondContact O-N 3.32Å
68	K	87.6	Confident	75.3	Confident	175 Å²	175	133.3 Å²	133.3	76%	0.761	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-57.3	128.7	177.2	-168.2	176.5	71.5	172.8	0	109.2
69	R	86.1	Confident	74.5	Confident	224 Å²	224	134.7 Å²	134.7	85%	0.845	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-56.4	137.9	174.9	-68	-178.3	169.7	-166.1	-2.8	109.5	L67 S71	L67-R69 PolarHBondContact O-N 3.32Å; R69-S71 PolarHBondContact O-N 3.17Å
70	P	82.5	Confident	73.4	Confident	113 Å²	113	134.1 Å²	134.1	73%	0.734	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-62.5	136.3	171.7	25.2	-31.5	0	0	0	109.5	S72	P70-S72 PolarHBondContact O-N 2.97Å; P70-S72 VanDerWaalsContact O-N 3.13Å
71	S	74.6	Confident	71.7	Confident	122 Å²	122	131.9 Å²	131.9	85%	0.853	76%	0.763	S	S	*	*	S	Bend	trans	-69.8	-3.7	-178.5	-35.1	0	0	0	0	113.8	R69	R69-S71 PolarHBondContact O-N 3.17Å
72	S	66.4	Low	70.4	Confident	84 Å²	84	132.2 Å²	132.2	59%	0.587	77%	0.769	S	S	*	*			trans	-96.2	96.7	177.1	-179.8	0	0	0	0	109.2	P70 G74	P70-S72 PolarHBondContact O-N 2.97Å; P70-S72 VanDerWaalsContact O-N 3.13Å; S72-G74 PolarHBondContact O-N 3.21Å
73	N	65.9	Low	69.2	Low	171 Å²	171	133.7 Å²	133.7	91%	0.914	77%	0.77	S	S	*	*			trans	-75.9	108.4	165.1	-154.6	15.2	0	0	0	107.2
74	G	65.8	Low	67.9	Low	70 Å²	70	132.4 Å²	132.4	72%	0.722	76%	0.757	S	S	*	*			trans	79	53.4	159.3	0	0	0	0	0	118.3	S72	S72-G74 PolarHBondContact O-N 3.21Å
75	S	55.4	Low	66.5	Low	98 Å²	98	130.3 Å²	130.3	69%	0.685	75%	0.753	S	S	*	*			trans	-113.6	90.4	141.2	-167.9	0	0	0	0	108.7	G77	S75-G77 PolarHBondContact O-N 3.48Å
76	L	57.2	Low	64.7	Low	178 Å²	178	124.5 Å²	124.5	93%	0.932	74%	0.744	S	S	*	*			trans	-63.8	70.3	151.3	-79.6	146.5	0	0	0	107.1	S78	L76-S78 PolarHBondContact O-N 3.36Å
77	G	51.2	Low	63.5	Low	48 Å²	48	122.8 Å²	122.8	50%	0.495	73%	0.732	S	S	.	*			trans	-64.6	91.2	156.2	0	0	0	0	0	106.2	S75 S79	S75-G77 PolarHBondContact O-N 3.48Å; G77-S79 PolarHBondContact O-N 3.38Å; G77-S79 PolarHBondContact O-OG 2.92Å; G77-S79 VanDerWaalsContact O-OG 3.06Å
78	S	53.9	Low	62.6	Low	95 Å²	95	122 Å²	122	66%	0.664	72%	0.724	S	S	*	*			trans	-32.6	98.4	172.4	-178.5	0	0	0	0	111.2	L76	L76-S78 PolarHBondContact O-N 3.36Å
79	S	57.1	Low	62	Low	125 Å²	125	119.4 Å²	119.4	87%	0.874	73%	0.725	S	S	*	*			trans	-111	78	170.4	-58.6	0	0	0	0	105.7	G77	G77-S79 PolarHBondContact O-N 3.38Å; G77-S79 PolarHBondContact O-OG 2.92Å; G77-S79 VanDerWaalsContact O-OG 3.06Å
80	G	53.1	Low	61.9	Low	77 Å²	77	111.9 Å²	111.9	79%	0.794	70%	0.699	S	S	*	*	S	Bend	trans	160.7	0.5	175.6	0	0	0	0	0	119.8
81	S	49.4	Very low	61.9	Low	69 Å²	69	110.2 Å²	110.2	48%	0.483	69%	0.69	S	S	.	*			trans	-148	82.8	169.9	-168	0	0	0	0	111.4	N83	S81-N83 PolarHBondContact O-N 3.37Å
82	S	54.9	Low	62.4	Low	123 Å²	123	109.5 Å²	109.5	86%	0.86	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	6.8	175.6	-168.4	0	0	0	0	113.6
83	N	57.6	Low	63.4	Low	152 Å²	152	108.5 Å²	108.5	81%	0.813	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.2	-3	-174.1	-73.1	-27.5	0	0	0	115.2	S81 P85	S81-N83 PolarHBondContact O-N 3.37Å; N83-P85 WeakPolarHBondContact O-CD 3.26Å
84	R	58.4	Low	64.7	Low	159 Å²	159	105.4 Å²	105.4	60%	0.6	65%	0.653	S	S	*	*	S	Bend	trans	-94	112.1	172.9	-163.9	173.1	-172.6	-101.8	0.1	108.5	T86	R84-T86 PolarHBondContact O-N 3Å
85	P	57.8	Low	65.8	Low	104 Å²	104	109.4 Å²	109.4	68%	0.675	65%	0.646	S	S	*	*			trans	-55.4	135.4	174	22.4	-31	0	0	0	108.5	N83 Q87	N83-P85 WeakPolarHBondContact O-CD 3.26Å; P85-Q87 PolarHBondContact O-N 2.92Å
86	T	50.7	Low	67.5	Low	113 Å²	113	110.5 Å²	110.5	69%	0.693	64%	0.64	S	S	*	*			trans	-53	110.1	173	57.1	0	0	0	0	106.9	R84 Q88	R84-T86 PolarHBondContact O-N 3Å; T86-Q88 VanDerWaalsContact C-N 3.28Å; T86-Q88 PolarHBondContact O-N 2.95Å; T86-Q88 PolarHBondContact OG1-NE2 3.42Å
87	Q	61.4	Low	69	Low	122 Å²	122	105 Å²	105	57%	0.57	62%	0.62	S	S	*	*			trans	-71.9	94.9	-179.2	-73.2	-165.2	-35	0	0	107.2	P85	P85-Q87 PolarHBondContact O-N 2.92Å
88	Q	67.6	Low	70.9	Confident	140 Å²	140	107.4 Å²	107.4	65%	0.654	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-50.5	140.1	164	-60.1	-61	-42.7	0	0	107.8	T86 K90	T86-Q88 VanDerWaalsContact C-N 3.28Å; T86-Q88 PolarHBondContact O-N 2.95Å; T86-Q88 PolarHBondContact OG1-NE2 3.42Å; Q88-K90 PolarHBondContact O-N 3Å
89	P	75.6	Confident	72.7	Confident	121 Å²	121	111 Å²	111	79%	0.786	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-58.2	117.9	-177.8	23.5	-32.4	0	0	0	109.4	S91	P89-S91 PolarHBondContact O-N 3.18Å
90	K	82.3	Confident	74.4	Confident	66 Å²	66	107.6 Å²	107.6	29%	0.287	60%	0.598	S	S	.	*	P	Polyproline II helix	trans	-58.7	135.4	178.6	-60.8	-176.2	-168.2	179.4	0	109.5	Q88 Q94 R95 E98	Q88-K90 PolarHBondContact O-N 3Å; K90-Q94 HydrophobicContact CB-CB 4.28Å; K90-Q94 HydrophobicContact CB-CG 4.27Å; K90-Q94 HydrophobicContact CD-CG 4.34Å; K90-R95 HydrophobicContact CB-CG 4.14Å; K90-R95 PolarHBondContact O-NE 3.43Å; K90-R95 PolarHBondContact O-NH2 3.46Å; K90-E98 IonicContact NZ-OE1 2.67Å; K90-E98 PolarHBondContact NZ-OE1 3Å; K90-E98 IonicContact NZ-OE2 3.36Å; K90-E98 PolarHBondContact NZ-OE2 2.87Å
91	S	84.1	Confident	76.2	Confident	78 Å²	78	110.4 Å²	110.4	55%	0.545	59%	0.59	S	S	.	*	P	Polyproline II helix	trans	-55.5	153.8	172.2	179.1	0	0	0	0	110.6	P89 A93 Q94 R95	P89-S91 PolarHBondContact O-N 3.18Å; S91-A93 VanDerWaalsContact C-N 3.31Å; S91-A93 PolarHBondContact O-N 3.33Å; S91-Q94 WeakPolarHBondContact O-CB 3.35Å; S91-Q94 PolarHBondContact O-N 3.39Å; S91-R95 PolarHBondContact O-N 2.85Å; S91-R95 VanDerWaalsContact O-N 3.14Å
92	L	84.1	Confident	78.3	Confident	107 Å²	107	109.1 Å²	109.1	56%	0.56	58%	0.584	S	S	*	*	H	α-helix	trans	-55.3	-47.7	179	-169.4	162.8	0	0	0	110.7	Q94 R95 E96	L92-Q94 PolarHBondContact O-N 3.27Å; L92-R95 WeakPolarHBondContact O-CB 3.5Å; L92-R95 PolarHBondContact O-N 2.9Å; L92-E96 HydrophobicContact CD2-CG 3.83Å; L92-E96 WeakPolarHBondContact CD2-OE1 3.36Å; L92-E96 PolarHBondContact O-N 3.26Å
93	A	88.1	Confident	80.1	Confident	62 Å²	62	108.9 Å²	108.9	51%	0.512	56%	0.564	S	S	.	*	H	α-helix	trans	-57.7	-34.2	177.5	0	0	0	0	0	113	S91 A97	S91-A93 VanDerWaalsContact C-N 3.31Å; S91-A93 PolarHBondContact O-N 3.33Å; A93-A97 PolarHBondContact O-N 3.37Å; A93-A97 VanDerWaalsContact O-N 3.11Å
94	Q	92.1	Very high	81.6	Confident	107 Å²	107	108.7 Å²	108.7	50%	0.5	55%	0.552	S	S	.	*	H	α-helix	trans	-71.1	-36.6	177.7	-171.4	179.7	8.6	0	0	111.6	K90 S91 L92 E98	K90-Q94 HydrophobicContact CB-CB 4.28Å; K90-Q94 HydrophobicContact CB-CG 4.27Å; K90-Q94 HydrophobicContact CD-CG 4.34Å; S91-Q94 WeakPolarHBondContact O-CB 3.35Å; S91-Q94 PolarHBondContact O-N 3.39Å; L92-Q94 PolarHBondContact O-N 3.27Å; Q94-E98 PolarHBondContact O-N 2.9Å
95	R	90.7	Very high	83.2	Confident	154 Å²	154	111.6 Å²	111.6	58%	0.581	56%	0.563	S	S	*	*	H	α-helix	trans	-68.4	-40.2	175.2	-76.1	-175.5	-97.2	163	-5.9	111.8	K90 S91 L92 E98 Y99	K90-R95 HydrophobicContact CB-CG 4.14Å; K90-R95 PolarHBondContact O-NE 3.43Å; K90-R95 PolarHBondContact O-NH2 3.46Å; S91-R95 PolarHBondContact O-N 2.85Å; S91-R95 VanDerWaalsContact O-N 3.14Å; L92-R95 WeakPolarHBondContact O-CB 3.5Å; L92-R95 PolarHBondContact O-N 2.9Å; R95-E98 PolarHBondContact O-N 2.69Å; R95-Y99 WeakPolarHBondContact O-CB 3.39Å; R95-Y99 PolarHBondContact O-N 3.22Å
96	E	89.6	Confident	84.7	Confident	121 Å²	121	113.8 Å²	113.8	57%	0.565	57%	0.568	S	S	*	*	H	α-helix	trans	-64	-43.2	177.1	-70.9	177.4	154.9	0	0	112	L92 Y99 A100	L92-E96 HydrophobicContact CD2-CG 3.83Å; L92-E96 WeakPolarHBondContact CD2-OE1 3.36Å; L92-E96 PolarHBondContact O-N 3.26Å; E96-Y99 PolarHBondContact O-N 2.92Å; E96-A100 WeakPolarHBondContact O-CB 3.32Å; E96-A100 PolarHBondContact O-N 3.28Å
97	A	88.8	Confident	86.5	Confident	62 Å²	62	113 Å²	113	51%	0.512	56%	0.559	S	S	.	*	H	α-helix	trans	-61.8	-45.2	177.2	0	0	0	0	0	112.6	A93 Y99 A100 E101	A93-A97 PolarHBondContact O-N 3.37Å; A93-A97 VanDerWaalsContact O-N 3.11Å; A97-Y99 VanDerWaalsContact C-N 3.35Å; A97-Y99 PolarHBondContact O-N 3.03Å; A97-A100 PolarHBondContact O-N 2.6Å; A97-E101 PolarHBondContact O-N 3.36Å
98	E	91.4	Very high	87.2	Confident	99 Å²	99	108.7 Å²	108.7	46%	0.463	55%	0.548	S	S	.	.	H	α-helix	trans	-64.5	-39.3	176.8	-176.2	174.7	-178.4	0	0	111.6	K90 Q94 R95 E101 A102	K90-E98 IonicContact NZ-OE1 2.67Å; K90-E98 PolarHBondContact NZ-OE1 3Å; K90-E98 IonicContact NZ-OE2 3.36Å; K90-E98 PolarHBondContact NZ-OE2 2.87Å; Q94-E98 PolarHBondContact O-N 2.9Å; R95-E98 PolarHBondContact O-N 2.69Å; E98-E101 PolarHBondContact O-N 3.31Å; E98-A102 WeakPolarHBondContact O-CB 3.37Å; E98-A102 PolarHBondContact O-N 2.88Å
99	Y	92.4	Very high	86.8	Confident	171 Å²	171	107.5 Å²	107.5	67%	0.671	55%	0.554	S	S	*	*	H	α-helix	trans	-64.5	-42.3	175.2	-174.6	-95.2	0	0	0	111.9	R95 E96 A97 A102 R103	R95-Y99 WeakPolarHBondContact O-CB 3.39Å; R95-Y99 PolarHBondContact O-N 3.22Å; E96-Y99 PolarHBondContact O-N 2.92Å; A97-Y99 VanDerWaalsContact C-N 3.35Å; A97-Y99 PolarHBondContact O-N 3.03Å; Y99-A102 PolarHBondContact O-N 3.24Å; Y99-R103 WeakPolarHBondContact O-CB 3.37Å; Y99-R103 PolarHBondContact O-N 3.5Å
100	A	92.2	Very high	85.8	Confident	52 Å²	52	106.3 Å²	106.3	43%	0.43	56%	0.555	S	S	.	*	H	α-helix	trans	-60.4	-46.3	176	0	0	0	0	0	111.2	E96 A97 R103 R104	E96-A100 WeakPolarHBondContact O-CB 3.32Å; E96-A100 PolarHBondContact O-N 3.28Å; A97-A100 PolarHBondContact O-N 2.6Å; A100-R103 PolarHBondContact O-N 3.5Å; A100-R104 WeakPolarHBondContact O-CG 3.41Å; A100-R104 PolarHBondContact O-N 3Å
101	E	91.9	Very high	84.5	Confident	136 Å²	136	105.1 Å²	105.1	64%	0.636	56%	0.555	S	S	*	*	H	α-helix	trans	-60.9	-48.1	176	-173.5	-172.3	-179.2	0	0	111.9	A97 E98 R103 R104 R105	A97-E101 PolarHBondContact O-N 3.36Å; E98-E101 PolarHBondContact O-N 3.31Å; E101-R103 VanDerWaalsContact C-N 3.3Å; E101-R103 PolarHBondContact O-N 3.11Å; E101-R104 WeakPolarHBondContact O-CB 3.34Å; E101-R104 PolarHBondContact O-N 2.93Å; E101-R104 VanDerWaalsContact O-N 3.13Å; E101-R105 PolarHBondContact O-N 3.13Å
102	A	93.1	Very high	82.8	Confident	43 Å²	43	106.2 Å²	106.2	36%	0.355	56%	0.562	S	S	.	*	H	α-helix	trans	-59.6	-41.4	179.1	0	0	0	0	0	111.8	E98 Y99 R105 I106	E98-A102 WeakPolarHBondContact O-CB 3.37Å; E98-A102 PolarHBondContact O-N 2.88Å; Y99-A102 PolarHBondContact O-N 3.24Å; A102-R105 PolarHBondContact O-N 3.08Å; A102-I106 WeakPolarHBondContact O-CG1 3.49Å; A102-I106 PolarHBondContact O-N 3.13Å
103	R	92.8	Very high	81.3	Confident	117 Å²	117	108 Å²	108	44%	0.442	57%	0.568	S	S	.	*	H	α-helix	trans	-62.5	-44.3	175.1	-171.1	177.8	-180	-75.6	-1	111.2	Y99 A100 E101 R105 I106 L107 S111	Y99-R103 WeakPolarHBondContact O-CB 3.37Å; Y99-R103 PolarHBondContact O-N 3.5Å; A100-R103 PolarHBondContact O-N 3.5Å; E101-R103 VanDerWaalsContact C-N 3.3Å; E101-R103 PolarHBondContact O-N 3.11Å; R103-R105 VanDerWaalsContact C-N 3.29Å; R103-R105 PolarHBondContact O-N 3.22Å; R103-I106 PolarHBondContact O-N 3.27Å; R103-L107 VanDerWaalsContact O-CB 3.26Å; R103-L107 WeakPolarHBondContact O-CB 3.43Å; R103-L107 PolarHBondContact O-N 3.37Å; R103-S111 PolarHBondContact NH1-OG 3.31Å; R103-S111 PolarHBondContact NH2-OG 3.48Å
104	R	88.5	Confident	79.2	Confident	149 Å²	149	112.7 Å²	112.7	56%	0.562	58%	0.58	S	S	*	*	H	α-helix	trans	-61.8	-36.7	175.2	-68.9	-175.2	80.7	90	3.1	112	A100 E101 G108 E113	A100-R104 WeakPolarHBondContact O-CG 3.41Å; A100-R104 PolarHBondContact O-N 3Å; E101-R104 WeakPolarHBondContact O-CB 3.34Å; E101-R104 PolarHBondContact O-N 2.93Å; E101-R104 VanDerWaalsContact O-N 3.13Å; R104-G108 WeakPolarHBondContact O-CA 3.43Å; R104-G108 PolarHBondContact O-N 3.11Å; R104-E113 IonicContact NH1-OE2 3.48Å; R104-E113 PolarHBondContact NH1-OE2 3.29Å
105	R	91.6	Very high	76.6	Confident	219 Å²	219	112 Å²	112	83%	0.826	58%	0.582	S	S	*	*	H	α-helix	trans	-69.6	-40.8	178.2	-178.1	175	177.2	155	0.1	113.3	E101 A102 R103	E101-R105 PolarHBondContact O-N 3.13Å; A102-R105 PolarHBondContact O-N 3.08Å; R103-R105 VanDerWaalsContact C-N 3.29Å; R103-R105 PolarHBondContact O-N 3.22Å
106	I	90.7	Very high	74.6	Confident	151 Å²	151	110.9 Å²	110.9	77%	0.774	60%	0.595	S	S	*	*	H	α-helix	trans	-81.1	-46.8	-177.2	-65.3	168.4	0	0	0	111.1	A102 R103	A102-I106 WeakPolarHBondContact O-CG1 3.49Å; A102-I106 PolarHBondContact O-N 3.13Å; R103-I106 PolarHBondContact O-N 3.27Å
107	L	87	Confident	72.1	Confident	95 Å²	95	111.8 Å²	111.8	50%	0.497	60%	0.599	S	S	.	*	H	α-helix	trans	-90.6	-15.5	-172.7	-167.4	56.3	0	0	0	112.8	R103	R103-L107 VanDerWaalsContact O-CB 3.26Å; R103-L107 WeakPolarHBondContact O-CB 3.43Å; R103-L107 PolarHBondContact O-N 3.37Å
108	G	77.5	Confident	69.9	Low	33 Å²	33	115.6 Å²	115.6	34%	0.34	61%	0.611	S	S	.	*	G	3₁₀ helix	trans	68.5	172.3	179.4	0	0	0	0	0	113.6	R104 A110 S111	R104-G108 WeakPolarHBondContact O-CA 3.43Å; R104-G108 PolarHBondContact O-N 3.11Å; G108-A110 PolarHBondContact O-N 3.26Å; G108-S111 PolarHBondContact O-N 3.08Å
109	S	59.1	Low	67.3	Low	114 Å²	114	119.2 Å²	119.2	80%	0.797	63%	0.625	S	S	*	*	G	3₁₀ helix	trans	-66.1	8.1	-179.7	48	0	0	0	0	115.3
110	A	54.3	Low	65.1	Low	97 Å²	97	116.6 Å²	116.6	80%	0.802	63%	0.63	S	S	*	*	G	3₁₀ helix	trans	-85.2	-14.6	174.6	0	0	0	0	0	113.2	G108 S112	G108-A110 PolarHBondContact O-N 3.26Å; A110-S112 VanDerWaalsContact C-N 3.31Å; A110-S112 PolarHBondContact O-N 3.01Å; A110-S112 VanDerWaalsContact O-N 3.13Å
111	S	54.3	Low	62.8	Low	40 Å²	40	125.5 Å²	125.5	28%	0.28	65%	0.652	S	S	.	*	S	Bend	trans	-80.6	87.3	161.9	-175.5	0	0	0	0	106.9	R103 G108 E113	R103-S111 PolarHBondContact NH1-OG 3.31Å; R103-S111 PolarHBondContact NH2-OG 3.48Å; G108-S111 PolarHBondContact O-N 3.08Å; S111-E113 PolarHBondContact O-N 3.15Å
112	S	48.6	Very low	60.8	Low	101 Å²	101	125.3 Å²	125.3	71%	0.706	66%	0.663	S	S	*	*			trans	-48.1	133	170	-169.3	0	0	0	0	109.1	A110 E114	A110-S112 VanDerWaalsContact C-N 3.31Å; A110-S112 PolarHBondContact O-N 3.01Å; A110-S112 VanDerWaalsContact O-N 3.13Å; S112-E114 PolarHBondContact O-N 2.98Å
113	E	52.3	Low	58.3	Low	145 Å²	145	131.9 Å²	131.9	68%	0.678	69%	0.686	S	S	*	*			trans	-40.4	114.1	162.2	-165.7	78.9	-148.1	0	0	109.4	R104 S111	R104-E113 IonicContact NH1-OE2 3.48Å; R104-E113 PolarHBondContact NH1-OE2 3.29Å; S111-E113 PolarHBondContact O-N 3.15Å
114	E	45.2	Very low	56	Low	161 Å²	161	136.8 Å²	136.8	75%	0.752	70%	0.704	S	S	*	*			trans	-134.1	112.7	155.4	-158.8	-179.5	111.1	0	0	108.7	S112	S112-E114 PolarHBondContact O-N 2.98Å
115	T	37.5	Very low	53.9	Low	91 Å²	91	135.8 Å²	135.8	56%	0.558	72%	0.717	S	S	*	*			trans	-32.4	159.9	162.2	42.6	0	0	0	0	115.8	Q117	T115-Q117 PolarHBondContact O-N 2.67Å
116	P	47.8	Very low	52	Low	131 Å²	131	131.3 Å²	131.3	85%	0.851	71%	0.714	S	S	*	*			trans	-65.2	100.6	170.7	30.3	-33.5	0	0	0	109.5
117	Q	37.2	Very low	49.8	Very low	140 Å²	140	135.9 Å²	135.9	65%	0.654	72%	0.721	S	S	*	*			trans	-108.7	100.1	168.5	-98.1	-81.2	-50.8	0	0	109.2	T115 K119	T115-Q117 PolarHBondContact O-N 2.67Å; Q117-K119 PolarHBondContact O-N 3.06Å
118	D	42.9	Very low	47.9	Very low	143 Å²	143	137.5 Å²	137.5	77%	0.765	74%	0.735	S	S	*	*			trans	-48.7	108.9	149.7	-172.4	-21.3	0	0	0	110.1
119	K	37.5	Very low	46.3	Very low	174 Å²	174	141.8 Å²	141.8	76%	0.757	76%	0.76	S	S	*	*			trans	-169.6	146.8	152.5	-124	64.5	-175.4	179.8	0	112.5	Q117	Q117-K119 PolarHBondContact O-N 3.06Å
120	P	44.3	Very low	45.4	Very low	117 Å²	117	141.2 Å²	141.2	76%	0.76	76%	0.762	S	S	*	*			trans	-88.9	162.8	-169.1	35.3	-28.7	0	0	0	114
121	R	44.5	Very low	44.8	Very low	239 Å²	239	145.2 Å²	145.2	90%	0.902	76%	0.764	S	S	*	*			trans	-37.9	161.8	-177.3	-55.7	179.5	-178.2	-154.2	-0.3	116.6
122	P	49.5	Very low	44.9	Very low	132 Å²	132	147.8 Å²	147.8	86%	0.857	78%	0.779	S	S	*	*				-143	-179.6	105.8	31.3	-11.4	0	0	0	115.7
123	E	41.5	Very low	44.8	Very low	180 Å²	180	149 Å²	149	84%	0.841	79%	0.785	S	S	*	*			trans	-61.5	150.9	-161.3	-60.4	-178.6	124.4	0	0	119.9
124	R	43.7	Very low	44.5	Very low	221 Å²	221	149.5 Å²	149.5	83%	0.834	79%	0.787	S	S	*	*			trans	1.8	149.3	142.2	-65.6	-162.3	-161.2	121.5	-2.9	119.1
125	P	46	Very low	44.8	Very low	128 Å²	128	147.8 Å²	147.8	83%	0.831	79%	0.79	S	S	*	*				-145.3	162.2	65.2	37.4	-16.5	0	0	0	119
126	V	50.3	Low	45.3	Very low	124 Å²	124	151 Å²	151	75%	0.752	80%	0.799	S	S	*	*			trans	-59.1	133.7	171.3	168.7	0	0	0	0	111.6
127	R	44.8	Very low	45.2	Very low	247 Å²	247	152.4 Å²	152.4	93%	0.932	80%	0.798	S	S	*	*			trans	-136.5	127.3	157.4	-107.7	-169.3	-177.5	-143.6	2.4	111.1
128	V	47	Very low	45.7	Very low	130 Å²	130	150.9 Å²	150.9	79%	0.788	80%	0.798	S	S	*	*			trans	-91.1	151.7	177.6	-83.4	0	0	0	0	111.4
129	S	43.4	Very low	46.2	Very low	123 Å²	123	149.7 Å²	149.7	86%	0.86	80%	0.801	S	S	*	*			trans	97.7	135.6	154.1	-155.8	0	0	0	0	120.6
130	A	41.5	Very low	46.9	Very low	101 Å²	101	147.5 Å²	147.5	84%	0.835	80%	0.797	S	S	*	*			trans	92.6	115.9	158.6	0	0	0	0	0	120.1
131	Q	40.7	Very low	47.4	Very low	182 Å²	182	148.1 Å²	148.1	85%	0.85	79%	0.794	S	S	*	*			trans	-103.1	169.4	170.1	175.7	178.7	-37.7	0	0	109.2
132	P	57	Low	48	Very low	93 Å²	93	142.6 Å²	142.6	60%	0.604	78%	0.782	S	S	*	*			cis	-126.5	-163.9	-38.9	37.6	-18.5	0	0	0	112.9
133	P	46.1	Very low	48.8	Very low	127 Å²	127	143.3 Å²	143.3	83%	0.825	77%	0.774	S	S	*	*				-134.3	144.2	102.4	37	-26.4	0	0	0	115.2
134	Q	45.5	Very low	49.9	Very low	156 Å²	156	138.7 Å²	138.7	73%	0.729	76%	0.758	S	S	*	*			trans	-86.4	161.9	164.7	-80.8	-81.1	-42.8	0	0	110.1
135	P	51.5	Low	51.2	Low	125 Å²	125	134.7 Å²	134.7	81%	0.812	75%	0.752	S	S	*	*				-135.4	125.9	101.4	33.5	-19.8	0	0	0	114.7
136	E	48.9	Very low	52.4	Low	157 Å²	157	138.8 Å²	138.8	73%	0.734	75%	0.751	S	S	*	*			trans	17.2	121.8	142.2	-56.1	-168.4	147.8	0	0	120.7
137	L	46.2	Very low	53.8	Low	161 Å²	161	138 Å²	138	84%	0.843	74%	0.739	S	S	*	*				-152.9	89	112	-98.6	171.1	0	0	0	109.3	S139	L137-S139 PolarHBondContact O-N 2.95Å; L137-S139 VanDerWaalsContact O-N 3.12Å
138	V	47.8	Very low	55.3	Low	108 Å²	108	131.5 Å²	131.5	66%	0.655	73%	0.729	S	S	*	*			trans	37.3	63.6	135.4	-53.6	0	0	0	0	118.3	L140	V138-L140 PolarHBondContact O-N 3.29Å
139	S	52.4	Low	56.7	Low	119 Å²	119	129.5 Å²	129.5	83%	0.832	72%	0.717	S	S	*	*			trans	-92.4	75.5	140	-162.1	0	0	0	0	106.6	L137 N141	L137-S139 PolarHBondContact O-N 2.95Å; L137-S139 VanDerWaalsContact O-N 3.12Å; S139-N141 PolarHBondContact O-N 2.91Å
140	L	53	Low	58.3	Low	127 Å²	127	124.7 Å²	124.7	67%	0.665	69%	0.687	S	S	*	*			trans	-41.6	118.9	160.6	-90.3	160.8	0	0	0	105.3	V138 N142	V138-L140 PolarHBondContact O-N 3.29Å; L140-N142 WeakPolarHBondContact O-CB 3.41Å; L140-N142 PolarHBondContact O-N 2.86Å
141	N	53.6	Low	60.3	Low	131 Å²	131	127 Å²	127	70%	0.701	69%	0.693	S	S	*	*			trans	-65.7	73.5	-176.8	-148.6	-14.2	0	0	0	107.5	S139 H143	S139-N141 PolarHBondContact O-N 2.91Å; N141-H143 PolarHBondContact O-N 3.13Å; N141-H143 PolarHBondContact O-ND1 2.8Å; N141-H143 PolarHBondContact OD1-CE1 2.99Å; N141-H143 PolarHBondContact OD1-ND1 3Å
142	N	58.8	Low	62	Low	122 Å²	122	123.7 Å²	123.7	65%	0.652	68%	0.681	S	S	*	*			trans	-79.1	73.8	-173.3	-92.2	-37.3	0	0	0	105.7	L140 V144	L140-N142 WeakPolarHBondContact O-CB 3.41Å; L140-N142 PolarHBondContact O-N 2.86Å; N142-V144 HydrophobicContact CB-CG2 3.97Å; N142-V144 PolarHBondContact O-N 3.14Å
143	H	64.5	Low	63	Low	147 Å²	147	121.8 Å²	121.8	68%	0.681	68%	0.679	S	S	*	*			trans	-68	57.9	162.3	-63.6	93.7	0	0	0	109.1	N141 I145	N141-H143 PolarHBondContact O-N 3.13Å; N141-H143 PolarHBondContact O-ND1 2.8Å; N141-H143 PolarHBondContact OD1-CE1 2.99Å; N141-H143 PolarHBondContact OD1-ND1 3Å; H143-I145 VanDerWaalsContact C-N 3.26Å; H143-I145 PolarHBondContact O-N 3.47Å
144	V	65.4	Low	64.3	Low	83 Å²	83	119 Å²	119	50%	0.503	66%	0.659	S	S	.	*			trans	-75.6	88	174.9	-177.3	0	0	0	0	106.2	N142 R146	N142-V144 HydrophobicContact CB-CG2 3.97Å; N142-V144 PolarHBondContact O-N 3.14Å; V144-R146 VanDerWaalsContact C-N 3.3Å; V144-R146 HydrophobicContact CG1-CG 3.77Å; V144-R146 PolarHBondContact O-N 3.19Å
145	I	71.4	Confident	65.6	Low	138 Å²	138	116.2 Å²	116.2	71%	0.708	65%	0.649	S	S	*	*			trans	-68.3	93.4	167.8	-56.7	-178.6	0	0	0	106.7	H143 Q147	H143-I145 VanDerWaalsContact C-N 3.26Å; H143-I145 PolarHBondContact O-N 3.47Å; I145-Q147 PolarHBondContact O-N 3.07Å
146	R	71.7	Confident	66.7	Low	214 Å²	214	112.5 Å²	112.5	81%	0.808	63%	0.634	S	S	*	*			trans	-72.8	114.1	175.1	-66.2	-172	177.7	-90.6	-0.8	108.6	V144	V144-R146 VanDerWaalsContact C-N 3.3Å; V144-R146 HydrophobicContact CG1-CG 3.77Å; V144-R146 PolarHBondContact O-N 3.19Å
147	Q	78.8	Confident	67.6	Low	107 Å²	107	115 Å²	115	50%	0.5	64%	0.642	S	S	.	*	P	Polyproline II helix	trans	-68.7	137.2	170.3	-65.9	-65.9	-49.3	0	0	108.8	I145 T149	I145-Q147 PolarHBondContact O-N 3.07Å; Q147-T149 PolarHBondContact O-N 3.39Å
148	P	76.6	Confident	68.5	Low	111 Å²	111	114.1 Å²	114.1	72%	0.721	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-57.1	127.8	177.4	23.8	-32.4	0	0	0	109.4
149	T	76.8	Confident	69.2	Low	88 Å²	88	120.5 Å²	120.5	54%	0.54	64%	0.64	S	S	.	*	P	Polyproline II helix	trans	-86.6	139	178	-44.4	0	0	0	0	108.5	Q147 G153 T154	Q147-T149 PolarHBondContact O-N 3.39Å; T149-G153 WeakPolarHBondContact CG2-O 3.42Å; T149-T154 WeakPolarHBondContact CG2-O 3.46Å
150	G	76.9	Confident	69.4	Low	22 Å²	22	125.4 Å²	125.4	23%	0.227	64%	0.642	C	S	.	*	P	Polyproline II helix	trans	-63.4	161.2	173.9	0	0	0	0	0	111.9	D152 G153 T154	G150-D152 WeakPolarHBondContact CA-OD1 3.37Å; G150-D152 PolarHBondContact O-N 3.27Å; G150-D152 VanDerWaalsContact O-N 3.08Å; G150-G153 PolarHBondContact O-N 3.35Å; G150-T154 PolarHBondContact N-O 3.03Å
151	P	82.4	Confident	69.2	Low	150 Å²	150	134.6 Å²	134.6	97%	0.974	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.6	-14.8	175.9	27.4	-35.4	0	0	0	113.4
152	D	77.8	Confident	70	Confident	111 Å²	111	134.8 Å²	134.8	59%	0.594	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.4	4	174.7	61.2	-10.3	0	0	0	113.4	G150 T154	G150-D152 WeakPolarHBondContact CA-OD1 3.37Å; G150-D152 PolarHBondContact O-N 3.27Å; G150-D152 VanDerWaalsContact O-N 3.08Å; D152-T154 VanDerWaalsContact C-N 3.26Å; D152-T154 HydrophobicContact CB-CG2 4.33Å; D152-T154 VanDerWaalsContact CG-OG1 3.25Å; D152-T154 PolarHBondContact O-N 3.28Å; D152-T154 WeakPolarHBondContact OD1-CB 3.44Å; D152-T154 PolarHBondContact OD1-N 3.29Å; D152-T154 PolarHBondContact OD1-OG1 3.48Å; D152-T154 WeakPolarHBondContact OD2-CG2 3.15Å; D152-T154 PolarHBondContact OD2-OG1 2.82Å; D152-T154 VanDerWaalsContact OD2-OG1 3.08Å
153	G	76.8	Confident	70.6	Confident	54 Å²	54	135.4 Å²	135.4	56%	0.557	67%	0.667	S	S	*	*	S	Bend	trans	78.6	4.8	-176.4	0	0	0	0	0	114.1	T149 G150	T149-G153 WeakPolarHBondContact CG2-O 3.42Å; G150-G153 PolarHBondContact O-N 3.35Å
154	T	74.6	Confident	70.9	Confident	67 Å²	67	134.8 Å²	134.8	41%	0.411	67%	0.666	S	S	.	*			trans	-82.9	152.9	-177.5	69.1	0	0	0	0	112	T149 G150 D152 G156	T149-T154 WeakPolarHBondContact CG2-O 3.46Å; G150-T154 PolarHBondContact N-O 3.03Å; D152-T154 VanDerWaalsContact C-N 3.26Å; D152-T154 HydrophobicContact CB-CG2 4.33Å; D152-T154 VanDerWaalsContact CG-OG1 3.25Å; D152-T154 PolarHBondContact O-N 3.28Å; D152-T154 WeakPolarHBondContact OD1-CB 3.44Å; D152-T154 PolarHBondContact OD1-N 3.29Å; D152-T154 PolarHBondContact OD1-OG1 3.48Å; D152-T154 WeakPolarHBondContact OD2-CG2 3.15Å; D152-T154 PolarHBondContact OD2-OG1 2.82Å; D152-T154 VanDerWaalsContact OD2-OG1 3.08Å; T154-G156 PolarHBondContact O-N 3.47Å; T154-G156 VanDerWaalsContact O-N 3.1Å
155	L	71.3	Confident	71.3	Confident	99 Å²	99	137.8 Å²	137.8	52%	0.518	68%	0.676	S	S	.	*			trans	-79.1	19.1	179.5	-65.5	169.5	0	0	0	113.5	R158	L155-R158 VanDerWaalsContact CD1-NH2 3.26Å
156	G	75.1	Confident	71.3	Confident	47 Å²	47	137.8 Å²	137.8	49%	0.485	67%	0.674	S	S	.	*			trans	56.9	-139.2	175.6	0	0	0	0	0	114.7	T154 R158	T154-G156 PolarHBondContact O-N 3.47Å; T154-G156 VanDerWaalsContact O-N 3.1Å; G156-R158 VanDerWaalsContact C-N 3.29Å; G156-R158 PolarHBondContact O-N 3.44Å
157	F	67.6	Low	71.2	Confident	208 Å²	208	132.7 Å²	132.7	91%	0.912	67%	0.665	S	S	*	*			trans	-70.7	66.5	-169.4	-59	-82	0	0	0	114.4
158	R	65.8	Low	70.7	Confident	143 Å²	143	134.6 Å²	134.6	54%	0.54	68%	0.676	S	S	.	*			trans	-100.4	68	156.6	-61.4	-172.3	-136.6	-79.4	2.2	109.1	L155 G156	L155-R158 VanDerWaalsContact CD1-NH2 3.26Å; G156-R158 VanDerWaalsContact C-N 3.29Å; G156-R158 PolarHBondContact O-N 3.44Å
159	R	61.5	Low	70.2	Confident	243 Å²	243	136.4 Å²	136.4	92%	0.917	67%	0.673	S	S	*	*			trans	-109.8	76.5	165.9	-71.6	-165.8	166.8	-177.1	-2.4	107.9
160	Y	57.7	Low	69.7	Low	222 Å²	222	140.4 Å²	140.4	87%	0.871	68%	0.684	S	S	*	*			trans	-90.6	114	163.8	-69.9	-74.9	0	0	0	108.1
161	R	48.8	Very low	69	Low	319 Å²	319	151.2 Å²	151.2	100%	1.204	73%	0.726	S	S	*	*			trans	-138.9	0	151.1	-152.4	-165.1	-128.1	-149.1	5.5	107.2

Retrieved 161 of 161 residues in 615.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).