A0A060XCI7_ONCMY Loading...

Coiled-coil domain-containing protein 167

AlphaFold DB , UniProt , Accession A0A060XCI7, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene ccdc167, Length 100 aa.

						>A0A060XCI7_ONCMY|A0A060XCI7|ccdc167
MTKSKDKREKVSVASEIDRVEERRLRCHDSIERAEFRRRREELSDQDRQSLEDEMTIMNDRMQKYDKELEVLRGENRRNMMLSVALLAVSALFYYAFIHY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.7	Very low	46.2	Very low	237 Å²	237	165.4 Å²	165.4	100%	1.167	81%	0.806	S	S	*	*				0	128.2	0	-73.4	-172.3	155.9	0	0	106.5
2	T	36.9	Very low	47.9	Very low	125 Å²	125	157.3 Å²	157.3	77%	0.767	78%	0.778	S	S	*	*			cis	-164.2	126.4	20.6	6.9	0	0	0	0	108
3	K	46.3	Very low	50	Low	171 Å²	171	153.3 Å²	153.3	74%	0.743	77%	0.768	S	S	*	*			trans	15.1	112.4	151.9	-60.4	179	-179.4	171.1	0	118.8
4	S	43.2	Very low	51.8	Low	132 Å²	132	145.9 Å²	145.9	92%	0.923	74%	0.742	S	S	*	*			trans	-119.6	73	139.7	-66.6	0	0	0	0	108.1	D6	S4-D6 PolarHBondContact O-N 3.45Å
5	K	40.3	Very low	53.5	Low	166 Å²	166	140.3 Å²	140.3	72%	0.722	72%	0.722	S	S	*	*			trans	-58.7	123	170.7	-104.5	175.9	164.9	178.3	0	108.6	K7	K5-K7 PolarHBondContact O-N 3.4Å
6	D	45.6	Very low	55.3	Low	120 Å²	120	137.9 Å²	137.9	64%	0.642	71%	0.706	S	S	*	*				56.7	67.5	123.5	-156.6	42.4	0	0	0	115	S4	S4-D6 PolarHBondContact O-N 3.45Å
7	K	45.7	Very low	56.9	Low	217 Å²	217	134.5 Å²	134.5	94%	0.943	69%	0.689	S	S	*	*			trans	-105	19.5	169.6	-139	-175.9	-170.8	-171.4	0	112.1	K5	K5-K7 PolarHBondContact O-N 3.4Å
8	R	52.8	Low	58.4	Low	195 Å²	195	132.4 Å²	132.4	74%	0.736	68%	0.68	S	S	*	*	S	Bend	trans	-104.8	134.1	169.3	-143.8	175.5	-178.2	174.2	-1.6	105.3
9	E	52.2	Low	59.9	Low	163 Å²	163	132.2 Å²	132.2	76%	0.762	67%	0.669	S	S	*	*			trans	72.9	62.9	163.3	-61.3	161.2	-152.3	0	0	117.7
10	K	54.8	Low	61.3	Low	186 Å²	186	129.9 Å²	129.9	81%	0.809	66%	0.662	S	S	*	*			trans	-138.6	56.3	145.7	-63.7	-170.8	-174.4	-175.5	0	110.4	S12	K10-S12 VanDerWaalsContact C-N 3.28Å; K10-S12 PolarHBondContact O-N 3.05Å
11	V	57.2	Low	62.5	Low	107 Å²	107	129 Å²	129	65%	0.648	66%	0.655	S	S	*	*			trans	-61.1	110.4	147	178.4	0	0	0	0	103.1	V13	V11-V13 PolarHBondContact O-N 3.2Å
12	S	66.2	Low	65.1	Low	68 Å²	68	122.3 Å²	122.3	48%	0.476	62%	0.621	S	S	.	*			trans	-52.6	135.1	-177.5	-177.6	0	0	0	0	107.7	K10 A14 S15 E16	K10-S12 VanDerWaalsContact C-N 3.28Å; K10-S12 PolarHBondContact O-N 3.05Å; S12-A14 CarbonylContact O-C 3.57Å; S12-A14 PolarHBondContact O-N 2.78Å; S12-S15 WeakPolarHBondContact O-CB 3.48Å; S12-S15 PolarHBondContact O-N 3.4Å; S12-E16 PolarHBondContact O-N 2.71Å
13	V	75.3	Confident	67.7	Low	106 Å²	106	123.4 Å²	123.4	64%	0.642	61%	0.611	S	S	*	*	H	α-helix	trans	-48.8	-33.1	176.6	173.6	0	0	0	0	110.5	V11 E16 I17	V11-V13 PolarHBondContact O-N 3.2Å; V13-E16 PolarHBondContact O-N 2.98Å; V13-I17 HydrophobicContact CG1-CD1 3.74Å; V13-I17 HydrophobicContact CG1-CG1 4.29Å; V13-I17 WeakPolarHBondContact O-CB 3.48Å; V13-I17 WeakPolarHBondContact O-CG1 3.4Å; V13-I17 PolarHBondContact O-N 2.77Å
14	A	75.3	Confident	69.9	Low	49 Å²	49	124 Å²	124	41%	0.405	61%	0.609	S	S	.	*	H	α-helix	trans	-56.5	-48	171.5	0	0	0	0	0	113.7	S12 E16 I17 D18	S12-A14 CarbonylContact O-C 3.57Å; S12-A14 PolarHBondContact O-N 2.78Å; A14-E16 VanDerWaalsContact C-N 3.28Å; A14-E16 PolarHBondContact O-N 3.29Å; A14-I17 WeakPolarHBondContact O-CB 3.48Å; A14-I17 PolarHBondContact O-N 2.91Å; A14-D18 PolarHBondContact O-N 3.46Å
15	S	77.5	Confident	72.2	Confident	63 Å²	63	123.3 Å²	123.3	44%	0.441	59%	0.594	S	S	.	*	H	α-helix	trans	-68	-28.7	179.9	-53.3	0	0	0	0	113.1	S12 R19	S12-S15 WeakPolarHBondContact O-CB 3.48Å; S12-S15 PolarHBondContact O-N 3.4Å; S15-R19 WeakPolarHBondContact O-CB 3.3Å; S15-R19 PolarHBondContact O-N 3.23Å
16	E	82.5	Confident	74.5	Confident	102 Å²	102	121.5 Å²	121.5	48%	0.477	58%	0.582	S	S	.	*	H	α-helix	trans	-76.4	-38.2	174.3	-166.4	159.4	-154.5	0	0	111.5	S12 V13 A14 R19 V20	S12-E16 PolarHBondContact O-N 2.71Å; V13-E16 PolarHBondContact O-N 2.98Å; A14-E16 VanDerWaalsContact C-N 3.28Å; A14-E16 PolarHBondContact O-N 3.29Å; E16-R19 PolarHBondContact O-N 2.99Å; E16-V20 VanDerWaalsContact O-CG2 3.28Å; E16-V20 WeakPolarHBondContact O-CG2 3.22Å; E16-V20 PolarHBondContact O-N 3.35Å
17	I	81.6	Confident	76.6	Confident	80 Å²	80	119 Å²	119	41%	0.41	57%	0.573	S	S	.	*	H	α-helix	trans	-59.5	-52.1	170.1	-70.2	167.4	0	0	0	110.2	V13 A14 R19 V20 E21	V13-I17 HydrophobicContact CG1-CD1 3.74Å; V13-I17 HydrophobicContact CG1-CG1 4.29Å; V13-I17 WeakPolarHBondContact O-CB 3.48Å; V13-I17 WeakPolarHBondContact O-CG1 3.4Å; V13-I17 PolarHBondContact O-N 2.77Å; A14-I17 WeakPolarHBondContact O-CB 3.48Å; A14-I17 PolarHBondContact O-N 2.91Å; I17-R19 PolarHBondContact O-N 3.24Å; I17-V20 CarbonylContact O-C 3.58Å; I17-V20 PolarHBondContact O-N 3.41Å; I17-E21 HydrophobicContact CG2-CG 4.16Å; I17-E21 WeakPolarHBondContact O-CG 3.47Å; I17-E21 PolarHBondContact O-N 3.44Å
18	D	84.9	Confident	78.8	Confident	97 Å²	97	114 Å²	114	52%	0.519	55%	0.553	S	S	.	*	H	α-helix	trans	-55.5	-43.1	179.7	-66	-24.7	0	0	0	111.1	A14 V20 E21 E22	A14-D18 PolarHBondContact O-N 3.46Å; D18-V20 VanDerWaalsContact C-N 3.35Å; D18-V20 PolarHBondContact O-N 2.82Å; D18-E21 PolarHBondContact O-N 2.8Å; D18-E22 VanDerWaalsContact O-CB 3.3Å; D18-E22 WeakPolarHBondContact O-CB 3.46Å; D18-E22 PolarHBondContact O-N 3.28Å
19	R	86.6	Confident	80.7	Confident	128 Å²	128	109.3 Å²	109.3	48%	0.483	54%	0.543	S	S	.	.	H	α-helix	trans	-66.3	-36.5	178.4	-165.9	-179.2	76.1	172.8	-1.1	112.4	S15 E16 I17 R23	S15-R19 WeakPolarHBondContact O-CB 3.3Å; S15-R19 PolarHBondContact O-N 3.23Å; E16-R19 PolarHBondContact O-N 2.99Å; I17-R19 PolarHBondContact O-N 3.24Å; R19-R23 VanDerWaalsContact O-CG 3.27Å; R19-R23 WeakPolarHBondContact O-CG 3.28Å; R19-R23 PolarHBondContact O-N 3.13Å
20	V	86.8	Confident	82.5	Confident	86 Å²	86	104.6 Å²	104.6	52%	0.521	53%	0.528	S	S	.	.	H	α-helix	trans	-74.4	-40.5	178	171.2	0	0	0	0	110.7	E16 I17 D18 R23 R24	E16-V20 VanDerWaalsContact O-CG2 3.28Å; E16-V20 WeakPolarHBondContact O-CG2 3.22Å; E16-V20 PolarHBondContact O-N 3.35Å; I17-V20 CarbonylContact O-C 3.58Å; I17-V20 PolarHBondContact O-N 3.41Å; D18-V20 VanDerWaalsContact C-N 3.35Å; D18-V20 PolarHBondContact O-N 2.82Å; V20-R23 PolarHBondContact O-N 3.39Å; V20-R24 WeakPolarHBondContact O-CB 3.35Å; V20-R24 PolarHBondContact O-N 3.37Å
21	E	87.3	Confident	84.1	Confident	110 Å²	110	100 Å²	100	51%	0.514	51%	0.511	S	S	.	.	H	α-helix	trans	-63.5	-43.3	175.4	-73.5	-170.9	165.9	0	0	111.7	I17 D18 R23 R24 L25	I17-E21 HydrophobicContact CG2-CG 4.16Å; I17-E21 WeakPolarHBondContact O-CG 3.47Å; I17-E21 PolarHBondContact O-N 3.44Å; D18-E21 PolarHBondContact O-N 2.8Å; E21-R23 VanDerWaalsContact C-N 3.3Å; E21-R23 PolarHBondContact O-N 2.91Å; E21-R24 WeakPolarHBondContact O-CB 3.39Å; E21-R24 PolarHBondContact O-N 3.31Å; E21-R24 VanDerWaalsContact O-N 3.13Å; E21-L25 WeakPolarHBondContact O-CB 3.46Å; E21-L25 WeakPolarHBondContact O-CG 3.26Å; E21-L25 PolarHBondContact O-N 3.31Å
22	E	88.6	Confident	85.7	Confident	97 Å²	97	100.4 Å²	100.4	45%	0.453	51%	0.506	S	S	.	.	H	α-helix	trans	-63.4	-37.7	176.1	-162.8	-161.1	-177.8	0	0	111.7	D18 R26	D18-E22 VanDerWaalsContact O-CB 3.3Å; D18-E22 WeakPolarHBondContact O-CB 3.46Å; D18-E22 PolarHBondContact O-N 3.28Å; E22-R26 VanDerWaalsContact CD-CZ 3.41Å; E22-R26 WeakPolarHBondContact O-CB 3.46Å; E22-R26 WeakPolarHBondContact O-CG 3.38Å; E22-R26 PolarHBondContact O-N 3.22Å; E22-R26 IonicContact OE1-CZ 3.78Å; E22-R26 IonicContact OE1-NH1 3.78Å; E22-R26 PolarHBondContact OE1-NH1 3.02Å; E22-R26 IonicContact OE1-NH2 2.71Å; E22-R26 IonicContact OE2-CZ 3.58Å; E22-R26 IonicContact OE2-NH1 3.48Å; E22-R26 PolarHBondContact OE2-NH1 3.02Å; E22-R26 IonicContact OE2-NH2 3.4Å; E22-R26 PolarHBondContact OE2-NH2 2.8Å
23	R	91.1	Very high	86.7	Confident	148 Å²	148	105 Å²	105	56%	0.558	51%	0.513	S	S	*	.	H	α-helix	trans	-67.4	-40	172.6	-74.5	175.6	-175.6	-142.2	0.3	112	R19 V20 E21 R26 C27	R19-R23 VanDerWaalsContact O-CG 3.27Å; R19-R23 WeakPolarHBondContact O-CG 3.28Å; R19-R23 PolarHBondContact O-N 3.13Å; V20-R23 PolarHBondContact O-N 3.39Å; E21-R23 VanDerWaalsContact C-N 3.3Å; E21-R23 PolarHBondContact O-N 2.91Å; R23-R26 PolarHBondContact O-N 3.36Å; R23-C27 VanDerWaalsContact O-CB 3.32Å; R23-C27 WeakPolarHBondContact O-CB 3.27Å; R23-C27 PolarHBondContact O-N 2.98Å
24	R	93.2	Very high	87.1	Confident	185 Å²	185	102 Å²	102	70%	0.698	50%	0.499	S	S	*	.	H	α-helix	trans	-64.1	-44.6	177	-175.9	179.6	176.8	-107.5	-3.1	111	V20 E21 C27 H28	V20-R24 WeakPolarHBondContact O-CB 3.35Å; V20-R24 PolarHBondContact O-N 3.37Å; E21-R24 WeakPolarHBondContact O-CB 3.39Å; E21-R24 PolarHBondContact O-N 3.31Å; E21-R24 VanDerWaalsContact O-N 3.13Å; R24-C27 PolarHBondContact O-N 3.46Å; R24-H28 WeakPolarHBondContact O-CB 3.44Å; R24-H28 PolarHBondContact O-N 3.28Å
25	L	91.1	Very high	87.6	Confident	117 Å²	117	103.9 Å²	103.9	61%	0.613	50%	0.5	S	S	*	.	H	α-helix	trans	-62.6	-45.8	176.6	-74.7	167.6	0	0	0	111.4	E21 C27 H28 D29	E21-L25 WeakPolarHBondContact O-CB 3.46Å; E21-L25 WeakPolarHBondContact O-CG 3.26Å; E21-L25 PolarHBondContact O-N 3.31Å; L25-C27 VanDerWaalsContact C-N 3.33Å; L25-C27 PolarHBondContact O-N 3.43Å; L25-H28 PolarHBondContact O-N 2.83Å; L25-D29 WeakPolarHBondContact O-CB 3.4Å; L25-D29 PolarHBondContact O-N 2.98Å
26	R	89.5	Confident	87.7	Confident	127 Å²	127	107.7 Å²	107.7	48%	0.479	51%	0.509	S	S	.	.	H	α-helix	trans	-61.3	-41	174.4	-78	-172.2	-74.7	-114.8	-7.5	112.9	E22 R23 S30	E22-R26 VanDerWaalsContact CD-CZ 3.41Å; E22-R26 WeakPolarHBondContact O-CB 3.46Å; E22-R26 WeakPolarHBondContact O-CG 3.38Å; E22-R26 PolarHBondContact O-N 3.22Å; E22-R26 IonicContact OE1-CZ 3.78Å; E22-R26 IonicContact OE1-NH1 3.78Å; E22-R26 PolarHBondContact OE1-NH1 3.02Å; E22-R26 IonicContact OE1-NH2 2.71Å; E22-R26 IonicContact OE2-CZ 3.58Å; E22-R26 IonicContact OE2-NH1 3.48Å; E22-R26 PolarHBondContact OE2-NH1 3.02Å; E22-R26 IonicContact OE2-NH2 3.4Å; E22-R26 PolarHBondContact OE2-NH2 2.8Å; R23-R26 PolarHBondContact O-N 3.36Å; R26-S30 WeakPolarHBondContact O-CB 3.36Å; R26-S30 PolarHBondContact O-N 2.9Å; R26-S30 PolarHBondContact O-OG 3.21Å
27	C	89	Confident	87.6	Confident	67 Å²	67	109 Å²	109	45%	0.453	51%	0.509	S	S	.	.	H	α-helix	trans	-65	-44.4	176.7	-167.7	0	0	0	0	110.8	R23 R24 L25 S30 I31	R23-C27 VanDerWaalsContact O-CB 3.32Å; R23-C27 WeakPolarHBondContact O-CB 3.27Å; R23-C27 PolarHBondContact O-N 2.98Å; R24-C27 PolarHBondContact O-N 3.46Å; L25-C27 VanDerWaalsContact C-N 3.33Å; L25-C27 PolarHBondContact O-N 3.43Å; C27-S30 PolarHBondContact O-N 3.49Å; C27-S30 PolarHBondContact O-OG 2.94Å; C27-I31 WeakPolarHBondContact O-CG1 3.35Å; C27-I31 PolarHBondContact O-N 2.89Å
28	H	92.6	Very high	87.4	Confident	112 Å²	112	112.4 Å²	112.4	52%	0.519	52%	0.517	S	S	.	.	H	α-helix	trans	-59.9	-49.1	176.9	-172.4	-78.4	0	0	0	112	R24 L25 S30 I31 E32	R24-H28 WeakPolarHBondContact O-CB 3.44Å; R24-H28 PolarHBondContact O-N 3.28Å; L25-H28 PolarHBondContact O-N 2.83Å; H28-S30 VanDerWaalsContact C-N 3.28Å; H28-S30 PolarHBondContact O-N 3.47Å; H28-I31 PolarHBondContact O-N 3.07Å; H28-E32 IonicContact CE1-OE2 2.85Å; H28-E32 IonicContact ND1-OE2 3.9Å; H28-E32 WeakPolarHBondContact O-CB 3.36Å; H28-E32 PolarHBondContact O-N 3.46Å
29	D	91	Very high	87.1	Confident	97 Å²	97	114.7 Å²	114.7	52%	0.519	52%	0.518	S	S	.	.	H	α-helix	trans	-58.8	-40.6	175.6	-177.4	70.5	0	0	0	111.5	L25 I31 E32 R33	L25-D29 WeakPolarHBondContact O-CB 3.4Å; L25-D29 PolarHBondContact O-N 2.98Å; D29-I31 VanDerWaalsContact C-N 3.34Å; D29-I31 PolarHBondContact O-N 2.66Å; D29-E32 PolarHBondContact O-N 3.44Å; D29-R33 VanDerWaalsContact O-CB 3.26Å; D29-R33 WeakPolarHBondContact O-CB 3.48Å; D29-R33 PolarHBondContact O-N 3.3Å
30	S	89.8	Confident	86.7	Confident	65 Å²	65	117.4 Å²	117.4	46%	0.455	53%	0.528	S	S	.	.	H	α-helix	trans	-64.8	-36.9	177.6	77.2	0	0	0	0	113.3	R26 C27 H28 A34	R26-S30 WeakPolarHBondContact O-CB 3.36Å; R26-S30 PolarHBondContact O-N 2.9Å; R26-S30 PolarHBondContact O-OG 3.21Å; C27-S30 PolarHBondContact O-N 3.49Å; C27-S30 PolarHBondContact O-OG 2.94Å; H28-S30 VanDerWaalsContact C-N 3.28Å; H28-S30 PolarHBondContact O-N 3.47Å; S30-A34 WeakPolarHBondContact O-CB 3.32Å; S30-A34 PolarHBondContact O-N 2.83Å; S30-A34 VanDerWaalsContact O-N 3.07Å
31	I	88.8	Confident	86.1	Confident	89 Å²	89	119.1 Å²	119.1	46%	0.456	53%	0.531	S	S	.	.	H	α-helix	trans	-71.7	-47.8	177.5	-69.5	168.5	0	0	0	109.9	C27 H28 D29 R33 A34 E35	C27-I31 WeakPolarHBondContact O-CG1 3.35Å; C27-I31 PolarHBondContact O-N 2.89Å; H28-I31 PolarHBondContact O-N 3.07Å; D29-I31 VanDerWaalsContact C-N 3.34Å; D29-I31 PolarHBondContact O-N 2.66Å; I31-R33 VanDerWaalsContact C-N 3.28Å; I31-R33 PolarHBondContact O-N 3.11Å; I31-A34 CarbonylContact O-C 3.59Å; I31-A34 WeakPolarHBondContact O-CA 3.36Å; I31-A34 WeakPolarHBondContact O-CB 3.48Å; I31-A34 PolarHBondContact O-N 2.95Å; I31-E35 HydrophobicContact CG2-CG 4.44Å; I31-E35 PolarHBondContact O-N 3.5Å
32	E	90.5	Very high	85.7	Confident	115 Å²	115	118 Å²	118	54%	0.537	53%	0.525	S	S	.	.	H	α-helix	trans	-58.9	-41.9	178.6	-176.1	171.4	-170.6	0	0	111.4	H28 D29 A34 E35 F36	H28-E32 IonicContact CE1-OE2 2.85Å; H28-E32 IonicContact ND1-OE2 3.9Å; H28-E32 WeakPolarHBondContact O-CB 3.36Å; H28-E32 PolarHBondContact O-N 3.46Å; D29-E32 PolarHBondContact O-N 3.44Å; E32-A34 VanDerWaalsContact C-N 3.34Å; E32-A34 PolarHBondContact O-N 3.33Å; E32-E35 PolarHBondContact O-N 3.31Å; E32-F36 WeakPolarHBondContact O-CB 3.44Å; E32-F36 PolarHBondContact O-N 3.33Å
33	R	87.3	Confident	84.9	Confident	166 Å²	166	118.1 Å²	118.1	63%	0.626	53%	0.529	S	S	*	.	H	α-helix	trans	-67.3	-34	175.5	-154.3	-179.1	-142.4	-164.6	5.7	112.9	D29 I31 R37	D29-R33 VanDerWaalsContact O-CB 3.26Å; D29-R33 WeakPolarHBondContact O-CB 3.48Å; D29-R33 PolarHBondContact O-N 3.3Å; I31-R33 VanDerWaalsContact C-N 3.28Å; I31-R33 PolarHBondContact O-N 3.11Å; R33-R37 WeakPolarHBondContact O-CG 3.45Å; R33-R37 PolarHBondContact O-N 2.9Å; R33-R37 PolarHBondContact O-NH1 2.91Å
34	A	83.8	Confident	84.3	Confident	42 Å²	42	114 Å²	114	35%	0.347	52%	0.523	S	S	.	.	H	α-helix	trans	-71.1	-42.5	175.5	0	0	0	0	0	111.3	S30 I31 E32 F36 R37 R38	S30-A34 WeakPolarHBondContact O-CB 3.32Å; S30-A34 PolarHBondContact O-N 2.83Å; S30-A34 VanDerWaalsContact O-N 3.07Å; I31-A34 CarbonylContact O-C 3.59Å; I31-A34 WeakPolarHBondContact O-CA 3.36Å; I31-A34 WeakPolarHBondContact O-CB 3.48Å; I31-A34 PolarHBondContact O-N 2.95Å; E32-A34 VanDerWaalsContact C-N 3.34Å; E32-A34 PolarHBondContact O-N 3.33Å; A34-F36 PolarHBondContact O-N 3.4Å; A34-R37 PolarHBondContact O-N 3.17Å; A34-R38 WeakPolarHBondContact O-CB 3.45Å; A34-R38 PolarHBondContact O-N 2.83Å
35	E	86.1	Confident	83.8	Confident	89 Å²	89	110.2 Å²	110.2	42%	0.416	52%	0.516	S	S	.	.	H	α-helix	trans	-62.8	-41.1	175.1	-74.7	-168.7	-171.9	0	0	112.3	I31 E32 R37 R38 R39	I31-E35 HydrophobicContact CG2-CG 4.44Å; I31-E35 PolarHBondContact O-N 3.5Å; E32-E35 PolarHBondContact O-N 3.31Å; E35-R37 VanDerWaalsContact C-N 3.34Å; E35-R37 PolarHBondContact O-N 3.24Å; E35-R38 PolarHBondContact O-N 3.03Å; E35-R39 WeakPolarHBondContact O-CG 3.49Å; E35-R39 PolarHBondContact O-N 3.41Å; E35-R39 IonicContact OE2-CZ 2.78Å; E35-R39 IonicContact OE2-NH2 3.49Å; E35-R39 PolarHBondContact OE2-NH2 2.85Å
36	F	79.9	Confident	83.4	Confident	143 Å²	143	110.6 Å²	110.6	63%	0.627	52%	0.515	S	S	*	.	H	α-helix	trans	-62.2	-41.8	177.3	-175.5	-96.7	0	0	0	112	E32 A34 R40	E32-F36 WeakPolarHBondContact O-CB 3.44Å; E32-F36 PolarHBondContact O-N 3.33Å; A34-F36 PolarHBondContact O-N 3.4Å; F36-R40 WeakPolarHBondContact O-CB 3.46Å; F36-R40 PolarHBondContact O-N 3.47Å; F36-R40 VanDerWaalsContact O-N 3.11Å
37	R	80.9	Confident	82.9	Confident	128 Å²	128	109.5 Å²	109.5	48%	0.483	52%	0.519	S	S	.	.	H	α-helix	trans	-63.9	-45.2	173.7	-72.4	-166.5	-59.3	-86	-0.6	111.3	R33 A34 E35 R39 R40 E41	R33-R37 WeakPolarHBondContact O-CG 3.45Å; R33-R37 PolarHBondContact O-N 2.9Å; R33-R37 PolarHBondContact O-NH1 2.91Å; A34-R37 PolarHBondContact O-N 3.17Å; E35-R37 VanDerWaalsContact C-N 3.34Å; E35-R37 PolarHBondContact O-N 3.24Å; R37-R39 PolarHBondContact O-N 2.92Å; R37-R40 PolarHBondContact O-N 3.04Å; R37-E41 WeakPolarHBondContact O-CG 3.21Å; R37-E41 PolarHBondContact O-N 3.5Å
38	R	76.7	Confident	82.7	Confident	152 Å²	152	113.5 Å²	113.5	57%	0.574	52%	0.524	S	S	*	.	H	α-helix	trans	-60.6	-46.9	179.4	-153.7	-166.7	91.9	175.8	9.6	112.1	A34 E35 R40 E41 E42	A34-R38 WeakPolarHBondContact O-CB 3.45Å; A34-R38 PolarHBondContact O-N 2.83Å; E35-R38 PolarHBondContact O-N 3.03Å; R38-R40 VanDerWaalsContact C-N 3.31Å; R38-R40 PolarHBondContact O-N 2.99Å; R38-E41 PolarHBondContact O-N 3.47Å; R38-E42 IonicContact CZ-OE1 3.09Å; R38-E42 IonicContact NE-OE1 2.71Å; R38-E42 PolarHBondContact NE-OE1 3.21Å; R38-E42 IonicContact NE-OE2 3.93Å; R38-E42 IonicContact NH2-OE1 2.76Å; R38-E42 PolarHBondContact NH2-OE1 3.49Å; R38-E42 IonicContact NH2-OE2 3.66Å; R38-E42 WeakPolarHBondContact O-CB 3.49Å; R38-E42 WeakPolarHBondContact O-CG 3.36Å; R38-E42 PolarHBondContact O-N 3.07Å
39	R	79.2	Confident	82.4	Confident	146 Å²	146	113.9 Å²	113.9	55%	0.551	53%	0.526	S	S	*	.	H	α-helix	trans	-62.5	-38.5	177.1	-70.4	-177.9	-148.2	178.6	7.6	111.9	E35 R37 L43	E35-R39 WeakPolarHBondContact O-CG 3.49Å; E35-R39 PolarHBondContact O-N 3.41Å; E35-R39 IonicContact OE2-CZ 2.78Å; E35-R39 IonicContact OE2-NH2 3.49Å; E35-R39 PolarHBondContact OE2-NH2 2.85Å; R37-R39 PolarHBondContact O-N 2.92Å; R39-L43 WeakPolarHBondContact O-CB 3.36Å; R39-L43 WeakPolarHBondContact O-CD1 3.34Å; R39-L43 VanDerWaalsContact O-CG 3.22Å; R39-L43 WeakPolarHBondContact O-CG 3.43Å; R39-L43 PolarHBondContact O-N 3.23Å
40	R	77.1	Confident	82.1	Confident	184 Å²	184	112.2 Å²	112.2	69%	0.694	52%	0.522	S	S	*	.	H	α-helix	trans	-68.4	-38.2	177.4	-177.7	178.6	143.7	167	-3.8	112.2	F36 R37 R38 S44	F36-R40 WeakPolarHBondContact O-CB 3.46Å; F36-R40 PolarHBondContact O-N 3.47Å; F36-R40 VanDerWaalsContact O-N 3.11Å; R37-R40 PolarHBondContact O-N 3.04Å; R38-R40 VanDerWaalsContact C-N 3.31Å; R38-R40 PolarHBondContact O-N 2.99Å; R40-S44 PolarHBondContact O-N 2.85Å
41	E	75.2	Confident	81.9	Confident	122 Å²	122	114.7 Å²	114.7	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-68.1	-45.6	174	-74.2	168.4	-170.2	0	0	111.2	R37 R38 L43 S44 D45	R37-E41 WeakPolarHBondContact O-CG 3.21Å; R37-E41 PolarHBondContact O-N 3.5Å; R38-E41 PolarHBondContact O-N 3.47Å; E41-L43 VanDerWaalsContact C-N 3.34Å; E41-L43 PolarHBondContact O-N 3.28Å; E41-S44 WeakPolarHBondContact O-CB 3.49Å; E41-S44 PolarHBondContact O-N 3.39Å; E41-S44 VanDerWaalsContact O-N 3.07Å; E41-D45 PolarHBondContact O-N 2.84Å
42	E	77.4	Confident	82	Confident	87 Å²	87	115.9 Å²	115.9	41%	0.407	53%	0.533	S	S	.	.	H	α-helix	trans	-58.9	-41.5	175	-76.2	171	-179.9	0	0	112.7	R38 S44 D45 Q46	R38-E42 IonicContact CZ-OE1 3.09Å; R38-E42 IonicContact NE-OE1 2.71Å; R38-E42 PolarHBondContact NE-OE1 3.21Å; R38-E42 IonicContact NE-OE2 3.93Å; R38-E42 IonicContact NH2-OE1 2.76Å; R38-E42 PolarHBondContact NH2-OE1 3.49Å; R38-E42 IonicContact NH2-OE2 3.66Å; R38-E42 WeakPolarHBondContact O-CB 3.49Å; R38-E42 WeakPolarHBondContact O-CG 3.36Å; R38-E42 PolarHBondContact O-N 3.07Å; E42-S44 VanDerWaalsContact C-N 3.32Å; E42-S44 PolarHBondContact O-N 3.27Å; E42-D45 PolarHBondContact O-N 2.76Å; E42-Q46 WeakPolarHBondContact O-CB 3.42Å; E42-Q46 PolarHBondContact O-N 3.06Å
43	L	72.9	Confident	82.1	Confident	99 Å²	99	114.4 Å²	114.4	52%	0.518	53%	0.529	S	S	.	.	H	α-helix	trans	-61.9	-40.8	174.1	-76.6	166.6	0	0	0	111.6	R39 E41 D45 Q46 D47	R39-L43 WeakPolarHBondContact O-CB 3.36Å; R39-L43 WeakPolarHBondContact O-CD1 3.34Å; R39-L43 VanDerWaalsContact O-CG 3.22Å; R39-L43 WeakPolarHBondContact O-CG 3.43Å; R39-L43 PolarHBondContact O-N 3.23Å; E41-L43 VanDerWaalsContact C-N 3.34Å; E41-L43 PolarHBondContact O-N 3.28Å; L43-D45 VanDerWaalsContact C-N 3.33Å; L43-D45 PolarHBondContact O-N 2.71Å; L43-Q46 PolarHBondContact O-N 2.89Å; L43-D47 WeakPolarHBondContact O-CB 3.47Å; L43-D47 PolarHBondContact O-N 2.89Å
44	S	77.3	Confident	82.1	Confident	63 Å²	63	112 Å²	112	44%	0.441	53%	0.525	S	S	.	.	H	α-helix	trans	-64.4	-37.8	176.3	-176.2	0	0	0	0	112.2	R40 E41 E42 R48	R40-S44 PolarHBondContact O-N 2.85Å; E41-S44 WeakPolarHBondContact O-CB 3.49Å; E41-S44 PolarHBondContact O-N 3.39Å; E41-S44 VanDerWaalsContact O-N 3.07Å; E42-S44 VanDerWaalsContact C-N 3.32Å; E42-S44 PolarHBondContact O-N 3.27Å; S44-R48 WeakPolarHBondContact O-CB 3.22Å; S44-R48 WeakPolarHBondContact O-CG 3.41Å; S44-R48 PolarHBondContact O-N 2.96Å
45	D	83.9	Confident	82.3	Confident	105 Å²	105	116.8 Å²	116.8	56%	0.561	54%	0.542	S	S	*	.	H	α-helix	trans	-71.2	-38.5	177.7	-72.9	-21.2	0	0	0	111.4	E41 E42 L43 R48 Q49	E41-D45 PolarHBondContact O-N 2.84Å; E42-D45 PolarHBondContact O-N 2.76Å; L43-D45 VanDerWaalsContact C-N 3.33Å; L43-D45 PolarHBondContact O-N 2.71Å; D45-R48 PolarHBondContact O-N 2.94Å; D45-Q49 WeakPolarHBondContact O-CB 3.46Å; D45-Q49 PolarHBondContact O-N 2.88Å
46	Q	82.4	Confident	82.6	Confident	125 Å²	125	116.7 Å²	116.7	58%	0.584	55%	0.547	S	S	*	.	H	α-helix	trans	-65.1	-41.3	174.6	-171.8	176.6	3.3	0	0	112.1	E42 L43 R48 Q49 S50	E42-Q46 WeakPolarHBondContact O-CB 3.42Å; E42-Q46 PolarHBondContact O-N 3.06Å; L43-Q46 PolarHBondContact O-N 2.89Å; Q46-R48 VanDerWaalsContact C-N 3.34Å; Q46-Q49 PolarHBondContact O-N 3.34Å; Q46-S50 WeakPolarHBondContact O-CB 3.41Å; Q46-S50 PolarHBondContact O-N 2.9Å; Q46-S50 PolarHBondContact O-OG 3.19Å
47	D	79.4	Confident	83.1	Confident	104 Å²	104	114 Å²	114	56%	0.556	54%	0.539	S	S	*	.	H	α-helix	trans	-64.4	-40.4	175.7	-72.7	-16.4	0	0	0	110.9	L43 S50 L51	L43-D47 WeakPolarHBondContact O-CB 3.47Å; L43-D47 PolarHBondContact O-N 2.89Å; D47-S50 WeakPolarHBondContact CA-OG 3.49Å; D47-S50 PolarHBondContact O-OG 3.34Å; D47-L51 WeakPolarHBondContact O-CB 3.45Å; D47-L51 PolarHBondContact O-N 3.37Å
48	R	84.7	Confident	83.6	Confident	150 Å²	150	113.4 Å²	113.4	57%	0.566	54%	0.543	S	S	*	.	H	α-helix	trans	-63.7	-45.3	173.7	-74	176	68.6	106.7	11.8	112.2	S44 D45 Q46 L51 E52	S44-R48 WeakPolarHBondContact O-CB 3.22Å; S44-R48 WeakPolarHBondContact O-CG 3.41Å; S44-R48 PolarHBondContact O-N 2.96Å; D45-R48 PolarHBondContact O-N 2.94Å; Q46-R48 VanDerWaalsContact C-N 3.34Å; R48-L51 PolarHBondContact O-N 2.93Å; R48-E52 WeakPolarHBondContact O-CG 3.42Å; R48-E52 PolarHBondContact O-N 2.92Å
49	Q	86.2	Confident	84.2	Confident	121 Å²	121	110.6 Å²	110.6	57%	0.565	54%	0.539	S	S	*	.	H	α-helix	trans	-63.8	-43	179.6	-172.4	171.8	13.9	0	0	111.5	D45 Q46 L51 E52 D53	D45-Q49 WeakPolarHBondContact O-CB 3.46Å; D45-Q49 PolarHBondContact O-N 2.88Å; Q46-Q49 PolarHBondContact O-N 3.34Å; Q49-L51 VanDerWaalsContact C-N 3.33Å; Q49-L51 PolarHBondContact O-N 3.5Å; Q49-E52 PolarHBondContact O-N 3.26Å; Q49-D53 WeakPolarHBondContact O-CB 3.33Å; Q49-D53 PolarHBondContact O-N 2.94Å
50	S	85.5	Confident	84.7	Confident	62 Å²	62	108.6 Å²	108.6	43%	0.434	54%	0.539	S	S	.	.	H	α-helix	trans	-64.3	-37	176.8	63.2	0	0	0	0	112.7	Q46 D47 D53 E54	Q46-S50 WeakPolarHBondContact O-CB 3.41Å; Q46-S50 PolarHBondContact O-N 2.9Å; Q46-S50 PolarHBondContact O-OG 3.19Å; D47-S50 WeakPolarHBondContact CA-OG 3.49Å; D47-S50 PolarHBondContact O-OG 3.34Å; S50-D53 PolarHBondContact O-N 3.44Å; S50-E54 WeakPolarHBondContact O-CB 3.38Å; S50-E54 PolarHBondContact O-N 3.32Å
51	L	85.3	Confident	85.3	Confident	116 Å²	116	106.9 Å²	106.9	61%	0.607	53%	0.533	S	S	*	.	H	α-helix	trans	-66.5	-42.2	173.6	-167.7	78.4	0	0	0	112	D47 R48 Q49 E54 M55	D47-L51 WeakPolarHBondContact O-CB 3.45Å; D47-L51 PolarHBondContact O-N 3.37Å; R48-L51 PolarHBondContact O-N 2.93Å; Q49-L51 VanDerWaalsContact C-N 3.33Å; Q49-L51 PolarHBondContact O-N 3.5Å; L51-E54 PolarHBondContact O-N 3.48Å; L51-M55 WeakPolarHBondContact O-CB 3.47Å; L51-M55 PolarHBondContact O-N 2.93Å
52	E	89.3	Confident	85.8	Confident	115 Å²	115	106.6 Å²	106.6	54%	0.537	53%	0.533	S	S	.	.	H	α-helix	trans	-62.6	-44.8	175.3	-76.9	177.8	-170.5	0	0	111	R48 Q49 E54 M55 T56	R48-E52 WeakPolarHBondContact O-CG 3.42Å; R48-E52 PolarHBondContact O-N 2.92Å; Q49-E52 PolarHBondContact O-N 3.26Å; E52-E54 PolarHBondContact O-N 2.95Å; E52-M55 PolarHBondContact O-N 3.41Å; E52-T56 VanDerWaalsContact O-CG2 3.31Å; E52-T56 WeakPolarHBondContact O-CG2 3.4Å; E52-T56 PolarHBondContact O-N 2.86Å
53	D	92.6	Very high	86.3	Confident	83 Å²	83	107 Å²	107	44%	0.444	54%	0.535	S	S	.	.	H	α-helix	trans	-60.5	-45.8	175.2	-73.5	-21.2	0	0	0	111.2	Q49 S50 M55 T56 I57	Q49-D53 WeakPolarHBondContact O-CB 3.33Å; Q49-D53 PolarHBondContact O-N 2.94Å; S50-D53 PolarHBondContact O-N 3.44Å; D53-M55 VanDerWaalsContact C-N 3.33Å; D53-M55 PolarHBondContact O-N 3.26Å; D53-T56 PolarHBondContact O-N 3.26Å; D53-T56 PolarHBondContact O-OG1 3.44Å; D53-I57 WeakPolarHBondContact O-CG1 3.47Å; D53-I57 PolarHBondContact O-N 3.28Å
54	E	88.4	Confident	87.1	Confident	117 Å²	117	108 Å²	108	55%	0.547	54%	0.535	S	S	.	.	H	α-helix	trans	-61.5	-41.6	176.7	-171.8	173.8	-171.5	0	0	111.9	S50 L51 E52 T56 I57 M58	S50-E54 WeakPolarHBondContact O-CB 3.38Å; S50-E54 PolarHBondContact O-N 3.32Å; L51-E54 PolarHBondContact O-N 3.48Å; E52-E54 PolarHBondContact O-N 2.95Å; E54-T56 PolarHBondContact O-N 3.43Å; E54-I57 PolarHBondContact O-N 2.97Å; E54-M58 WeakPolarHBondContact O-CG 3.4Å; E54-M58 PolarHBondContact O-N 3.17Å
55	M	88.5	Confident	87.5	Confident	141 Å²	141	111.4 Å²	111.4	70%	0.695	54%	0.539	S	S	*	.	H	α-helix	trans	-63.6	-40.3	177.2	-168	175.1	-171.3	0	0	111.8	L51 E52 D53 M58 N59	L51-M55 WeakPolarHBondContact O-CB 3.47Å; L51-M55 PolarHBondContact O-N 2.93Å; E52-M55 PolarHBondContact O-N 3.41Å; D53-M55 VanDerWaalsContact C-N 3.33Å; D53-M55 PolarHBondContact O-N 3.26Å; M55-M58 PolarHBondContact O-N 3.4Å; M55-N59 WeakPolarHBondContact O-CB 3.31Å; M55-N59 PolarHBondContact O-N 3.48Å
56	T	91.1	Very high	87.5	Confident	87 Å²	87	110.7 Å²	110.7	53%	0.534	54%	0.535	S	S	.	.	H	α-helix	trans	-64.9	-42	176.4	63.9	0	0	0	0	112	E52 D53 E54 N59 D60	E52-T56 VanDerWaalsContact O-CG2 3.31Å; E52-T56 WeakPolarHBondContact O-CG2 3.4Å; E52-T56 PolarHBondContact O-N 2.86Å; D53-T56 PolarHBondContact O-N 3.26Å; D53-T56 PolarHBondContact O-OG1 3.44Å; E54-T56 PolarHBondContact O-N 3.43Å; T56-N59 PolarHBondContact O-N 2.96Å; T56-D60 PolarHBondContact O-N 3.33Å
57	I	91.7	Very high	87.6	Confident	88 Å²	88	111.1 Å²	111.1	45%	0.451	54%	0.535	S	S	.	.	H	α-helix	trans	-63.2	-44.7	177	-67	165.9	0	0	0	110.7	D53 E54 N59 D60 R61	D53-I57 WeakPolarHBondContact O-CG1 3.47Å; D53-I57 PolarHBondContact O-N 3.28Å; E54-I57 PolarHBondContact O-N 2.97Å; I57-N59 VanDerWaalsContact C-N 3.34Å; I57-D60 PolarHBondContact O-N 3.31Å; I57-R61 WeakPolarHBondContact O-CG 3.45Å; I57-R61 PolarHBondContact O-N 3.35Å
58	M	90.1	Very high	87.7	Confident	114 Å²	114	110.6 Å²	110.6	56%	0.562	53%	0.529	S	S	*	.	H	α-helix	trans	-64	-40.5	177.3	-73.8	-148.9	-68.3	0	0	112.1	E54 M55 R61 M62	E54-M58 WeakPolarHBondContact O-CG 3.4Å; E54-M58 PolarHBondContact O-N 3.17Å; M55-M58 PolarHBondContact O-N 3.4Å; M58-R61 PolarHBondContact O-N 3.47Å; M58-M62 PolarHBondContact O-N 3.19Å
59	N	89.3	Confident	87.5	Confident	93 Å²	93	107.3 Å²	107.3	50%	0.497	52%	0.523	S	S	.	.	H	α-helix	trans	-64.1	-41.9	178.5	-174.5	68.6	0	0	0	112.3	M55 T56 I57 R61 M62 Q63	M55-N59 WeakPolarHBondContact O-CB 3.31Å; M55-N59 PolarHBondContact O-N 3.48Å; T56-N59 PolarHBondContact O-N 2.96Å; I57-N59 VanDerWaalsContact C-N 3.34Å; N59-R61 PolarHBondContact O-N 3.05Å; N59-M62 WeakPolarHBondContact O-CB 3.45Å; N59-M62 PolarHBondContact O-N 3.35Å; N59-Q63 WeakPolarHBondContact O-CG 3.16Å; N59-Q63 PolarHBondContact O-N 3.5Å
60	D	90.8	Very high	87.2	Confident	104 Å²	104	108.4 Å²	108.4	56%	0.556	53%	0.528	S	S	*	.	H	α-helix	trans	-61.7	-43.2	175.5	-176.8	69.9	0	0	0	112	T56 I57 M62 Q63 K64	T56-D60 PolarHBondContact O-N 3.33Å; I57-D60 PolarHBondContact O-N 3.31Å; D60-M62 VanDerWaalsContact C-N 3.34Å; D60-M62 PolarHBondContact O-N 2.96Å; D60-Q63 PolarHBondContact O-N 3.49Å; D60-K64 PolarHBondContact O-N 3.27Å
61	R	88.9	Confident	86.9	Confident	149 Å²	149	109.5 Å²	109.5	56%	0.562	53%	0.532	S	S	*	.	H	α-helix	trans	-60.8	-43.1	175	-70.4	176.5	-176.2	178.9	3.3	112	I57 M58 N59 Q63 K64 Y65	I57-R61 WeakPolarHBondContact O-CG 3.45Å; I57-R61 PolarHBondContact O-N 3.35Å; M58-R61 PolarHBondContact O-N 3.47Å; N59-R61 PolarHBondContact O-N 3.05Å; R61-Q63 PolarHBondContact O-N 2.73Å; R61-K64 WeakPolarHBondContact O-CB 3.34Å; R61-K64 PolarHBondContact O-N 3.29Å; R61-Y65 HydrophobicContact CB-CE2 4.31Å; R61-Y65 WeakPolarHBondContact O-CD2 3.26Å; R61-Y65 PolarHBondContact O-N 3.02Å
62	M	86	Confident	86.4	Confident	115 Å²	115	108.9 Å²	108.9	57%	0.567	53%	0.528	S	S	*	.	H	α-helix	trans	-59.7	-46.9	177.3	-163.7	72.8	171.7	0	0	111.1	M58 N59 D60 K64 Y65 D66	M58-M62 PolarHBondContact O-N 3.19Å; N59-M62 WeakPolarHBondContact O-CB 3.45Å; N59-M62 PolarHBondContact O-N 3.35Å; D60-M62 VanDerWaalsContact C-N 3.34Å; D60-M62 PolarHBondContact O-N 2.96Å; M62-K64 VanDerWaalsContact C-N 3.29Å; M62-K64 PolarHBondContact O-N 3.02Å; M62-Y65 PolarHBondContact O-N 3.01Å; M62-D66 PolarHBondContact O-N 3.22Å
63	Q	88.6	Confident	85.9	Confident	95 Å²	95	111.9 Å²	111.9	44%	0.444	54%	0.535	S	S	.	.	H	α-helix	trans	-62.2	-35.8	177	-71.4	-174.1	-7.1	0	0	112.8	N59 D60 R61 K67	N59-Q63 WeakPolarHBondContact O-CG 3.16Å; N59-Q63 PolarHBondContact O-N 3.5Å; D60-Q63 PolarHBondContact O-N 3.49Å; R61-Q63 PolarHBondContact O-N 2.73Å; Q63-K67 WeakPolarHBondContact O-CG 3.37Å; Q63-K67 PolarHBondContact O-N 2.89Å; Q63-K67 VanDerWaalsContact O-N 3.14Å
64	K	88.6	Confident	85.2	Confident	121 Å²	121	109.4 Å²	109.4	53%	0.526	53%	0.529	S	S	.	.	H	α-helix	trans	-64.5	-45.7	174.9	-174.6	178	175.2	-176.7	0	111.5	D60 R61 M62 D66 K67 E68	D60-K64 PolarHBondContact O-N 3.27Å; R61-K64 WeakPolarHBondContact O-CB 3.34Å; R61-K64 PolarHBondContact O-N 3.29Å; M62-K64 VanDerWaalsContact C-N 3.29Å; M62-K64 PolarHBondContact O-N 3.02Å; K64-D66 VanDerWaalsContact C-N 3.34Å; K64-D66 PolarHBondContact O-N 3.36Å; K64-K67 PolarHBondContact O-N 3.47Å; K64-E68 WeakPolarHBondContact CE-OE1 3.47Å; K64-E68 WeakPolarHBondContact O-CG 3.47Å; K64-E68 PolarHBondContact O-N 2.9Å
65	Y	87.1	Confident	84.7	Confident	134 Å²	134	109 Å²	109	53%	0.525	53%	0.527	S	S	.	.	H	α-helix	trans	-63.2	-40	177	-65.5	-44.6	0	0	0	112.5	R61 M62 K67 E68 L69	R61-Y65 HydrophobicContact CB-CE2 4.31Å; R61-Y65 WeakPolarHBondContact O-CD2 3.26Å; R61-Y65 PolarHBondContact O-N 3.02Å; M62-Y65 PolarHBondContact O-N 3.01Å; Y65-K67 VanDerWaalsContact C-N 3.34Å; Y65-K67 PolarHBondContact O-N 3.45Å; Y65-E68 PolarHBondContact O-N 2.93Å; Y65-L69 WeakPolarHBondContact O-CB 3.47Å; Y65-L69 WeakPolarHBondContact O-CG 3.41Å; Y65-L69 PolarHBondContact O-N 3.48Å
66	D	82.4	Confident	84.2	Confident	90 Å²	90	107.6 Å²	107.6	48%	0.481	52%	0.523	S	S	.	.	H	α-helix	trans	-61	-42.9	176.2	-77.6	-25.8	0	0	0	111.9	M62 K64 L69 E70	M62-D66 PolarHBondContact O-N 3.22Å; K64-D66 VanDerWaalsContact C-N 3.34Å; K64-D66 PolarHBondContact O-N 3.36Å; D66-L69 PolarHBondContact O-N 3.3Å; D66-E70 WeakPolarHBondContact O-CB 3.33Å; D66-E70 PolarHBondContact O-N 3.12Å
67	K	84.4	Confident	83.5	Confident	135 Å²	135	112.9 Å²	112.9	59%	0.587	53%	0.533	S	S	*	.	H	α-helix	trans	-63.8	-44.2	175.5	-73.8	174.2	-176.6	169.9	0	112.2	Q63 K64 Y65 L69 E70 V71	Q63-K67 WeakPolarHBondContact O-CG 3.37Å; Q63-K67 PolarHBondContact O-N 2.89Å; Q63-K67 VanDerWaalsContact O-N 3.14Å; K64-K67 PolarHBondContact O-N 3.47Å; Y65-K67 VanDerWaalsContact C-N 3.34Å; Y65-K67 PolarHBondContact O-N 3.45Å; K67-L69 VanDerWaalsContact C-N 3.32Å; K67-L69 PolarHBondContact O-N 3.01Å; K67-E70 PolarHBondContact O-N 3.43Å; K67-V71 WeakPolarHBondContact O-CG2 3.45Å; K67-V71 PolarHBondContact O-N 3.31Å
68	E	83.3	Confident	82.7	Confident	92 Å²	92	117.5 Å²	117.5	43%	0.43	54%	0.544	S	S	.	.	H	α-helix	trans	-61.7	-41.8	176.8	-73.4	177.1	-170.5	0	0	111.1	K64 Y65 V71 L72	K64-E68 WeakPolarHBondContact CE-OE1 3.47Å; K64-E68 WeakPolarHBondContact O-CG 3.47Å; K64-E68 PolarHBondContact O-N 2.9Å; Y65-E68 PolarHBondContact O-N 2.93Å; E68-V71 PolarHBondContact O-N 3.14Å; E68-L72 WeakPolarHBondContact O-CB 3.23Å; E68-L72 VanDerWaalsContact O-CG 3.23Å; E68-L72 WeakPolarHBondContact O-CG 3.38Å; E68-L72 PolarHBondContact O-N 3.47Å
69	L	79.7	Confident	82.2	Confident	82 Å²	82	117.5 Å²	117.5	43%	0.429	55%	0.546	S	S	.	.	H	α-helix	trans	-64.6	-39.6	174.9	-76.1	174.1	0	0	0	112.8	Y65 D66 K67 R73	Y65-L69 WeakPolarHBondContact O-CB 3.47Å; Y65-L69 WeakPolarHBondContact O-CG 3.41Å; Y65-L69 PolarHBondContact O-N 3.48Å; D66-L69 PolarHBondContact O-N 3.3Å; K67-L69 VanDerWaalsContact C-N 3.32Å; K67-L69 PolarHBondContact O-N 3.01Å; L69-R73 WeakPolarHBondContact O-CB 3.35Å; L69-R73 VanDerWaalsContact O-CG 3.26Å; L69-R73 WeakPolarHBondContact O-CG 3.16Å; L69-R73 PolarHBondContact O-N 2.98Å
70	E	78.9	Confident	81.7	Confident	144 Å²	144	118.7 Å²	118.7	67%	0.673	55%	0.551	S	S	*	*	H	α-helix	trans	-63.9	-45.6	176.9	-170.2	178.3	178.8	0	0	111.3	D66 K67 R73 G74	D66-E70 WeakPolarHBondContact O-CB 3.33Å; D66-E70 PolarHBondContact O-N 3.12Å; K67-E70 PolarHBondContact O-N 3.43Å; E70-R73 PolarHBondContact O-N 3.38Å; E70-G74 PolarHBondContact O-N 2.93Å
71	V	80.1	Confident	81.2	Confident	84 Å²	84	120.7 Å²	120.7	51%	0.509	56%	0.558	S	S	.	*	H	α-helix	trans	-61.3	-50.1	176.2	172.4	0	0	0	0	110.6	K67 E68 R73 G74 E75	K67-V71 WeakPolarHBondContact O-CG2 3.45Å; K67-V71 PolarHBondContact O-N 3.31Å; E68-V71 PolarHBondContact O-N 3.14Å; V71-R73 VanDerWaalsContact C-N 3.32Å; V71-R73 PolarHBondContact O-N 2.9Å; V71-G74 WeakPolarHBondContact O-CA 3.36Å; V71-G74 PolarHBondContact O-N 3.44Å; V71-G74 VanDerWaalsContact O-N 3.07Å; V71-E75 HydrophobicContact CG1-CG 4.38Å; V71-E75 WeakPolarHBondContact O-CG 3.25Å; V71-E75 PolarHBondContact O-N 2.84Å
72	L	74.6	Confident	80.9	Confident	103 Å²	103	118.7 Å²	118.7	54%	0.539	56%	0.558	S	S	.	*	H	α-helix	trans	-61	-38.8	179.5	-72.9	171.2	0	0	0	112.3	E68 N76	E68-L72 WeakPolarHBondContact O-CB 3.23Å; E68-L72 VanDerWaalsContact O-CG 3.23Å; E68-L72 WeakPolarHBondContact O-CG 3.38Å; E68-L72 PolarHBondContact O-N 3.47Å; L72-N76 VanDerWaalsContact O-CB 3.25Å; L72-N76 WeakPolarHBondContact O-CB 3.46Å; L72-N76 PolarHBondContact O-N 3.35Å
73	R	79.4	Confident	80.9	Confident	178 Å²	178	116.8 Å²	116.8	67%	0.672	56%	0.556	S	S	*	*	H	α-helix	trans	-67	-38.6	174.3	-77.4	174.7	174.1	158.5	0.8	112	L69 E70 V71 R77	L69-R73 WeakPolarHBondContact O-CB 3.35Å; L69-R73 VanDerWaalsContact O-CG 3.26Å; L69-R73 WeakPolarHBondContact O-CG 3.16Å; L69-R73 PolarHBondContact O-N 2.98Å; E70-R73 PolarHBondContact O-N 3.38Å; V71-R73 VanDerWaalsContact C-N 3.32Å; V71-R73 PolarHBondContact O-N 2.9Å; R73-R77 PolarHBondContact O-N 3.28Å; R73-R77 VanDerWaalsContact O-N 3.12Å
74	G	78.2	Confident	80.9	Confident	31 Å²	31	116.8 Å²	116.8	32%	0.32	56%	0.562	S	S	.	*	H	α-helix	trans	-62.9	-46.4	174.5	0	0	0	0	0	112.2	E70 V71 R77 R78	E70-G74 PolarHBondContact O-N 2.93Å; V71-G74 WeakPolarHBondContact O-CA 3.36Å; V71-G74 PolarHBondContact O-N 3.44Å; V71-G74 VanDerWaalsContact O-N 3.07Å; G74-R77 PolarHBondContact O-N 3.44Å; G74-R78 WeakPolarHBondContact O-CG 3.47Å; G74-R78 PolarHBondContact O-N 2.98Å; G74-R78 VanDerWaalsContact O-N 3.08Å
75	E	77.2	Confident	80.9	Confident	108 Å²	108	113.4 Å²	113.4	51%	0.505	56%	0.557	S	S	.	*	H	α-helix	trans	-65.8	-42.3	177.1	-71.4	-175.4	162.1	0	0	112.3	V71 R77 R78 N79	V71-E75 HydrophobicContact CG1-CG 4.38Å; V71-E75 WeakPolarHBondContact O-CG 3.25Å; V71-E75 PolarHBondContact O-N 2.84Å; E75-R77 VanDerWaalsContact C-N 3.35Å; E75-R77 PolarHBondContact O-N 2.89Å; E75-R78 PolarHBondContact O-N 3.08Å; E75-R78 VanDerWaalsContact O-N 3.16Å; E75-N79 WeakPolarHBondContact O-CB 3.34Å; E75-N79 PolarHBondContact O-N 3.07Å
76	N	77.8	Confident	81.1	Confident	113 Å²	113	113.1 Å²	113.1	60%	0.604	56%	0.564	S	S	*	*	H	α-helix	trans	-61.1	-43.4	177.2	-166.9	-26.7	0	0	0	111.5	L72 R78 N79 M80	L72-N76 VanDerWaalsContact O-CB 3.25Å; L72-N76 WeakPolarHBondContact O-CB 3.46Å; L72-N76 PolarHBondContact O-N 3.35Å; N76-R78 PolarHBondContact O-N 2.91Å; N76-N79 PolarHBondContact O-N 3.01Å; N76-M80 WeakPolarHBondContact O-CB 3.33Å; N76-M80 PolarHBondContact O-N 3.36Å
77	R	75.6	Confident	81.4	Confident	198 Å²	198	114.5 Å²	114.5	75%	0.747	57%	0.571	S	S	*	*	H	α-helix	trans	-60.4	-43.6	173.1	-81.9	-171.9	176.8	-165.4	1	112.6	R73 G74 E75 M81	R73-R77 PolarHBondContact O-N 3.28Å; R73-R77 VanDerWaalsContact O-N 3.12Å; G74-R77 PolarHBondContact O-N 3.44Å; E75-R77 VanDerWaalsContact C-N 3.35Å; E75-R77 PolarHBondContact O-N 2.89Å; R77-M81 PolarHBondContact O-N 2.96Å
78	R	76.6	Confident	81.7	Confident	185 Å²	185	110.3 Å²	110.3	70%	0.698	56%	0.562	S	S	*	*	H	α-helix	trans	-64.7	-44.1	177.9	-72.4	174.1	-177.9	174.4	1.4	111.4	G74 E75 N76 M81 L82	G74-R78 WeakPolarHBondContact O-CG 3.47Å; G74-R78 PolarHBondContact O-N 2.98Å; G74-R78 VanDerWaalsContact O-N 3.08Å; E75-R78 PolarHBondContact O-N 3.08Å; E75-R78 VanDerWaalsContact O-N 3.16Å; N76-R78 PolarHBondContact O-N 2.91Å; R78-M81 PolarHBondContact O-N 3.44Å; R78-L82 WeakPolarHBondContact O-CG 3.36Å; R78-L82 PolarHBondContact O-N 3.06Å
79	N	78.6	Confident	82.1	Confident	113 Å²	113	109.3 Å²	109.3	60%	0.604	56%	0.562	S	S	*	*	H	α-helix	trans	-66.2	-40	-179.8	-162.1	34.3	0	0	0	111.8	E75 N76 M81 L82 S83	E75-N79 WeakPolarHBondContact O-CB 3.34Å; E75-N79 PolarHBondContact O-N 3.07Å; N76-N79 PolarHBondContact O-N 3.01Å; N79-M81 PolarHBondContact O-N 3.36Å; N79-L82 PolarHBondContact O-N 3.5Å; N79-S83 WeakPolarHBondContact O-CB 3.5Å; N79-S83 PolarHBondContact O-N 2.94Å
80	M	80	Confident	82.5	Confident	119 Å²	119	108.5 Å²	108.5	59%	0.586	56%	0.563	S	S	*	*	H	α-helix	trans	-59.3	-47	172.1	-174.1	-175.2	70.2	0	0	111.1	N76 L82 S83 V84	N76-M80 WeakPolarHBondContact O-CB 3.33Å; N76-M80 PolarHBondContact O-N 3.36Å; M80-L82 VanDerWaalsContact C-N 3.34Å; M80-L82 PolarHBondContact O-N 3.45Å; M80-S83 PolarHBondContact O-N 3.16Å; M80-V84 WeakPolarHBondContact O-CG2 3.47Å; M80-V84 PolarHBondContact O-N 2.8Å
81	M	79.9	Confident	82.9	Confident	145 Å²	145	104 Å²	104	71%	0.714	55%	0.551	S	S	*	*	H	α-helix	trans	-62.9	-39.9	179	-168.4	175.4	-165.9	0	0	112.3	R77 R78 N79 V84 A85	R77-M81 PolarHBondContact O-N 2.96Å; R78-M81 PolarHBondContact O-N 3.44Å; N79-M81 PolarHBondContact O-N 3.36Å; M81-V84 PolarHBondContact O-N 2.95Å; M81-A85 WeakPolarHBondContact O-CB 3.43Å; M81-A85 PolarHBondContact O-N 3.24Å
82	L	82.4	Confident	83.3	Confident	107 Å²	107	106 Å²	106	56%	0.56	56%	0.558	S	S	*	*	H	α-helix	trans	-64.4	-43.5	175.2	-71.3	172.6	0	0	0	112	R78 N79 M80 V84 A85 L86	R78-L82 WeakPolarHBondContact O-CG 3.36Å; R78-L82 PolarHBondContact O-N 3.06Å; N79-L82 PolarHBondContact O-N 3.5Å; M80-L82 VanDerWaalsContact C-N 3.34Å; M80-L82 PolarHBondContact O-N 3.45Å; L82-V84 VanDerWaalsContact C-N 3.35Å; L82-V84 PolarHBondContact O-N 2.94Å; L82-A85 PolarHBondContact O-N 3.35Å; L82-L86 WeakPolarHBondContact O-CG 3.35Å; L82-L86 PolarHBondContact O-N 2.91Å
83	S	85.5	Confident	84.1	Confident	76 Å²	76	106.9 Å²	106.9	53%	0.531	56%	0.557	S	S	.	*	H	α-helix	trans	-60.7	-43.8	176.3	-179.2	0	0	0	0	111.9	N79 M80 L86 L87	N79-S83 WeakPolarHBondContact O-CB 3.5Å; N79-S83 PolarHBondContact O-N 2.94Å; M80-S83 PolarHBondContact O-N 3.16Å; S83-L86 PolarHBondContact O-N 3.41Å; S83-L87 WeakPolarHBondContact O-CB 3.3Å; S83-L87 PolarHBondContact O-N 3.01Å
84	V	87.8	Confident	84.5	Confident	94 Å²	94	106.2 Å²	106.2	57%	0.57	56%	0.556	S	S	*	*	H	α-helix	trans	-63.8	-42.6	175.8	173.2	0	0	0	0	111.4	M80 M81 L82 L87 A88	M80-V84 WeakPolarHBondContact O-CG2 3.47Å; M80-V84 PolarHBondContact O-N 2.8Å; M81-V84 PolarHBondContact O-N 2.95Å; L82-V84 VanDerWaalsContact C-N 3.35Å; L82-V84 PolarHBondContact O-N 2.94Å; V84-L87 PolarHBondContact O-N 3.45Å; V84-A88 WeakPolarHBondContact O-CB 3.5Å; V84-A88 PolarHBondContact O-N 2.96Å
85	A	89.3	Confident	84.9	Confident	51 Å²	51	112 Å²	112	42%	0.421	57%	0.569	S	S	.	*	H	α-helix	trans	-62.7	-43.6	177.7	0	0	0	0	0	112	M81 L82 L87 A88 V89	M81-A85 WeakPolarHBondContact O-CB 3.43Å; M81-A85 PolarHBondContact O-N 3.24Å; L82-A85 PolarHBondContact O-N 3.35Å; A85-L87 VanDerWaalsContact C-N 3.33Å; A85-L87 PolarHBondContact O-N 2.91Å; A85-A88 PolarHBondContact O-N 2.94Å; A85-V89 WeakPolarHBondContact O-CG2 3.3Å; A85-V89 PolarHBondContact O-N 3.29Å
86	L	91.4	Very high	85.1	Confident	128 Å²	128	109.6 Å²	109.6	67%	0.67	57%	0.568	S	S	*	*	H	α-helix	trans	-62.1	-40.6	175.6	-72.7	173.4	0	0	0	112.1	L82 S83 V89 S90	L82-L86 WeakPolarHBondContact O-CG 3.35Å; L82-L86 PolarHBondContact O-N 2.91Å; S83-L86 PolarHBondContact O-N 3.41Å; L86-V89 PolarHBondContact O-N 3.34Å; L86-S90 WeakPolarHBondContact O-CB 3.34Å; L86-S90 PolarHBondContact O-N 2.92Å; L86-S90 PolarHBondContact O-OG 3.5Å
87	L	89.9	Confident	85.1	Confident	118 Å²	118	111.7 Å²	111.7	62%	0.618	57%	0.572	S	S	*	*	H	α-helix	trans	-66.5	-39.1	176.5	-170.4	149.3	0	0	0	111.9	S83 V84 A85 S90 A91	S83-L87 WeakPolarHBondContact O-CB 3.3Å; S83-L87 PolarHBondContact O-N 3.01Å; V84-L87 PolarHBondContact O-N 3.45Å; A85-L87 VanDerWaalsContact C-N 3.33Å; A85-L87 PolarHBondContact O-N 2.91Å; L87-S90 WeakPolarHBondContact CA-OG 3.44Å; L87-S90 PolarHBondContact O-N 3.47Å; L87-S90 PolarHBondContact O-OG 2.88Å; L87-A91 VanDerWaalsContact O-CB 3.3Å; L87-A91 WeakPolarHBondContact O-CB 3.38Å; L87-A91 PolarHBondContact O-N 3.3Å
88	A	89.9	Confident	84.8	Confident	48 Å²	48	107.1 Å²	107.1	40%	0.397	56%	0.561	S	S	.	*	H	α-helix	trans	-64.7	-44	175.3	0	0	0	0	0	111.4	V84 A85 A91 L92	V84-A88 WeakPolarHBondContact O-CB 3.5Å; V84-A88 PolarHBondContact O-N 2.96Å; A85-A88 PolarHBondContact O-N 2.94Å; A88-A91 PolarHBondContact O-N 3.28Å; A88-L92 VanDerWaalsContact O-CG 3.3Å; A88-L92 WeakPolarHBondContact O-CG 3.33Å; A88-L92 PolarHBondContact O-N 3.47Å
89	V	91.6	Very high	84	Confident	71 Å²	71	104.9 Å²	104.9	43%	0.43	56%	0.558	S	S	.	*	H	α-helix	trans	-62.1	-45.1	176.1	170.9	0	0	0	0	110.9	A85 L86 A91 L92 F93	A85-V89 WeakPolarHBondContact O-CG2 3.3Å; A85-V89 PolarHBondContact O-N 3.29Å; L86-V89 PolarHBondContact O-N 3.34Å; V89-A91 PolarHBondContact O-N 3.38Å; V89-L92 PolarHBondContact O-N 3.31Å; V89-F93 HydrophobicContact CG1-CD2 3.63Å; V89-F93 HydrophobicContact CG1-CE2 3.4Å; V89-F93 VanDerWaalsContact CG1-CE2 3.4Å; V89-F93 WeakPolarHBondContact O-CD2 3.37Å; V89-F93 PolarHBondContact O-N 3.35Å
90	S	87.9	Confident	82.9	Confident	65 Å²	65	111.8 Å²	111.8	46%	0.455	58%	0.578	S	S	.	*	H	α-helix	trans	-65.3	-37.8	177.9	69.2	0	0	0	0	112.4	L86 L87 F93 Y94	L86-S90 WeakPolarHBondContact O-CB 3.34Å; L86-S90 PolarHBondContact O-N 2.92Å; L86-S90 PolarHBondContact O-OG 3.5Å; L87-S90 WeakPolarHBondContact CA-OG 3.44Å; L87-S90 PolarHBondContact O-N 3.47Å; L87-S90 PolarHBondContact O-OG 2.88Å; S90-F93 PolarHBondContact O-N 3.48Å; S90-Y94 WeakPolarHBondContact O-CB 3.47Å; S90-Y94 PolarHBondContact O-N 3.39Å
91	A	87.7	Confident	83.1	Confident	50 Å²	50	111.5 Å²	111.5	41%	0.413	58%	0.577	S	S	.	*	H	α-helix	trans	-65.5	-39.8	174.7	0	0	0	0	0	112.4	L87 A88 V89 Y94 Y95	L87-A91 VanDerWaalsContact O-CB 3.3Å; L87-A91 WeakPolarHBondContact O-CB 3.38Å; L87-A91 PolarHBondContact O-N 3.3Å; A88-A91 PolarHBondContact O-N 3.28Å; V89-A91 PolarHBondContact O-N 3.38Å; A91-Y94 PolarHBondContact O-N 2.98Å; A91-Y95 WeakPolarHBondContact O-CB 3.15Å; A91-Y95 PolarHBondContact O-N 2.8Å
92	L	88.7	Confident	83.2	Confident	125 Å²	125	109.7 Å²	109.7	65%	0.654	57%	0.57	S	S	*	*	H	α-helix	trans	-63.6	-43.1	174.4	-73.1	172.9	0	0	0	111.5	A88 V89 Y95 A96	A88-L92 VanDerWaalsContact O-CG 3.3Å; A88-L92 WeakPolarHBondContact O-CG 3.33Å; A88-L92 PolarHBondContact O-N 3.47Å; V89-L92 PolarHBondContact O-N 3.31Å; L92-Y95 PolarHBondContact O-N 2.9Å; L92-A96 VanDerWaalsContact O-CB 3.22Å; L92-A96 WeakPolarHBondContact O-CB 3.42Å; L92-A96 PolarHBondContact O-N 2.94Å
93	F	90.4	Very high	83.3	Confident	122 Å²	122	109.8 Å²	109.8	54%	0.535	57%	0.571	S	S	.	*	H	α-helix	trans	-64.2	-45.1	173.1	-78.8	-61.3	0	0	0	111.8	V89 S90 Y95 A96 F97	V89-F93 HydrophobicContact CG1-CD2 3.63Å; V89-F93 HydrophobicContact CG1-CE2 3.4Å; V89-F93 VanDerWaalsContact CG1-CE2 3.4Å; V89-F93 WeakPolarHBondContact O-CD2 3.37Å; V89-F93 PolarHBondContact O-N 3.35Å; S90-F93 PolarHBondContact O-N 3.48Å; F93-Y95 VanDerWaalsContact C-N 3.31Å; F93-Y95 PolarHBondContact O-N 3.42Å; F93-A96 PolarHBondContact O-N 3.45Å; F93-F97 HydrophobicContact CB-CD2 4.32Å; F93-F97 HydrophobicContact CD1-CD2 4.15Å; F93-F97 AromaticContact CD1-CE2 3.82Å; F93-F97 HydrophobicContact CD1-CE2 3.82Å; F93-F97 HydrophobicContact CE1-CE2 4.48Å; F93-F97 WeakPolarHBondContact O-CB 3.44Å; F93-F97 WeakPolarHBondContact O-CD2 3.25Å; F93-F97 PolarHBondContact O-N 3.04Å
94	Y	89.1	Confident	83.1	Confident	163 Å²	163	111.8 Å²	111.8	64%	0.639	57%	0.573	S	S	*	*	H	α-helix	trans	-56.1	-48	176.9	178.5	-91.3	0	0	0	111	S90 A91 I98	S90-Y94 WeakPolarHBondContact O-CB 3.47Å; S90-Y94 PolarHBondContact O-N 3.39Å; A91-Y94 PolarHBondContact O-N 2.98Å; Y94-I98 HydrophobicContact CD1-CD1 3.96Å; Y94-I98 HydrophobicContact CD2-CD1 3.36Å; Y94-I98 HydrophobicContact CE1-CD1 3.62Å; Y94-I98 HydrophobicContact CE2-CD1 2.99Å; Y94-I98 HydrophobicContact CE2-CG1 4.45Å; Y94-I98 HydrophobicContact CG-CD1 3.83Å; Y94-I98 VanDerWaalsContact O-CB 3.25Å; Y94-I98 WeakPolarHBondContact O-CB 3.25Å; Y94-I98 WeakPolarHBondContact O-CG1 3.32Å; Y94-I98 PolarHBondContact O-N 2.8Å
95	Y	85.6	Confident	82.8	Confident	153 Å²	153	112.9 Å²	112.9	60%	0.6	57%	0.573	S	S	*	*	H	α-helix	trans	-63.8	-47.6	176.8	-169.6	-97	0	0	0	111.1	A91 L92 F93 F97 I98 H99	A91-Y95 WeakPolarHBondContact O-CB 3.15Å; A91-Y95 PolarHBondContact O-N 2.8Å; L92-Y95 PolarHBondContact O-N 2.9Å; F93-Y95 VanDerWaalsContact C-N 3.31Å; F93-Y95 PolarHBondContact O-N 3.42Å; Y95-F97 PolarHBondContact O-N 3.39Å; Y95-I98 PolarHBondContact O-N 2.86Å; Y95-H99 AromaticContact CD2-CD2 3.88Å; Y95-H99 HydrophobicContact CE1-CB 4.5Å; Y95-H99 AromaticContact CE2-CD2 3.38Å; Y95-H99 WeakPolarHBondContact CE2-CD2 3.18Å; Y95-H99 AromaticContact CE2-NE2 3.88Å; Y95-H99 AromaticContact CZ-CD2 3.68Å; Y95-H99 VanDerWaalsContact O-CB 3.25Å; Y95-H99 WeakPolarHBondContact O-CB 3.35Å; Y95-H99 PolarHBondContact O-N 3.22Å
96	A	82.6	Confident	82.4	Confident	57 Å²	57	117.1 Å²	117.1	47%	0.471	58%	0.583	S	S	.	*	H	α-helix	trans	-64.4	-34.7	-179.6	0	0	0	0	0	114.1	L92 F93 Y100	L92-A96 VanDerWaalsContact O-CB 3.22Å; L92-A96 WeakPolarHBondContact O-CB 3.42Å; L92-A96 PolarHBondContact O-N 2.94Å; F93-A96 PolarHBondContact O-N 3.45Å; A96-Y100 WeakPolarHBondContact O-CB 3.22Å
97	F	76.8	Confident	81.8	Confident	158 Å²	158	116.3 Å²	116.3	69%	0.693	58%	0.577	S	S	*	*	H	α-helix	trans	-87.1	-18.6	-179	-87.6	-83.6	0	0	0	114.2	F93 Y95	F93-F97 HydrophobicContact CB-CD2 4.32Å; F93-F97 HydrophobicContact CD1-CD2 4.15Å; F93-F97 AromaticContact CD1-CE2 3.82Å; F93-F97 HydrophobicContact CD1-CE2 3.82Å; F93-F97 HydrophobicContact CE1-CE2 4.48Å; F93-F97 WeakPolarHBondContact O-CB 3.44Å; F93-F97 WeakPolarHBondContact O-CD2 3.25Å; F93-F97 PolarHBondContact O-N 3.04Å; Y95-F97 PolarHBondContact O-N 3.39Å
98	I	69.2	Low	81.2	Confident	101 Å²	101	116.2 Å²	116.2	52%	0.518	57%	0.574	S	S	.	*	H	α-helix	trans	-100.4	-28.2	178.7	-71.9	170.7	0	0	0	112	Y94 Y95	Y94-I98 HydrophobicContact CD1-CD1 3.96Å; Y94-I98 HydrophobicContact CD2-CD1 3.36Å; Y94-I98 HydrophobicContact CE1-CD1 3.62Å; Y94-I98 HydrophobicContact CE2-CD1 2.99Å; Y94-I98 HydrophobicContact CE2-CG1 4.45Å; Y94-I98 HydrophobicContact CG-CD1 3.83Å; Y94-I98 VanDerWaalsContact O-CB 3.25Å; Y94-I98 WeakPolarHBondContact O-CB 3.25Å; Y94-I98 WeakPolarHBondContact O-CG1 3.32Å; Y94-I98 PolarHBondContact O-N 2.8Å; Y95-I98 PolarHBondContact O-N 2.86Å
99	H	60.6	Low	80.4	Confident	138 Å²	138	121.8 Å²	121.8	64%	0.639	59%	0.589	S	S	*	*			trans	-89	-0.6	175	-108.2	-75.2	0	0	0	114.2	Y95	Y95-H99 AromaticContact CD2-CD2 3.88Å; Y95-H99 HydrophobicContact CE1-CB 4.5Å; Y95-H99 AromaticContact CE2-CD2 3.38Å; Y95-H99 WeakPolarHBondContact CE2-CD2 3.18Å; Y95-H99 AromaticContact CE2-NE2 3.88Å; Y95-H99 AromaticContact CZ-CD2 3.68Å; Y95-H99 VanDerWaalsContact O-CB 3.25Å; Y95-H99 WeakPolarHBondContact O-CB 3.35Å; Y95-H99 PolarHBondContact O-N 3.22Å
100	Y	55.1	Low	79.4	Confident	259 Å²	259	126.5 Å²	126.5	100%	1.016	60%	0.603	S	S	*	*			trans	-111.1	0	171.5	-170.8	-85.8	0	0	0	109.5	A96	A96-Y100 WeakPolarHBondContact O-CB 3.22Å

Retrieved 100 of 100 residues in 851.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).