A0A060XDY2_ONCMY Loading...

Microsomal glutathione S-transferase 2

AlphaFold DB , UniProt , Accession A0A060XDY2, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene mgst2, Length 146 aa.

						>A0A060XDY2_ONCMY|A0A060XDY2|mgst2
MTTEIPVLLAAVSLFSALQMVYLARQVGLARMTHKVMPPTVTGPPEFERTFRAHQNNVELYPVFLVVLWTSGLLFSEVLAVLGGVVYMVARHMYFSGYVMSTKKRLPGFYLTLGALFFLSVLSTIGILHGILLEYFYKIVSMMVTH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.8	Very low	79.6	Confident	237 Å²	237	97.5 Å²	97.5	100%	1.167	55%	0.548	S	S	*	.				0	102.5	0	-142.7	178	-85.1	0	0	105.5	T3	M1-T3 PolarHBondContact O-N 3.09Å; M1-T3 VanDerWaalsContact O-N 3.16Å
2	T	45.7	Very low	81.1	Confident	121 Å²	121	90.1 Å²	90.1	74%	0.742	51%	0.507	S	S	*	.			trans	-59.9	117.8	170.9	38.2	0	0	0	0	106.1	E4	T2-E4 PolarHBondContact O-N 3.36Å
3	T	57.2	Low	82.5	Confident	133 Å²	133	84.5 Å²	84.5	82%	0.816	48%	0.478	S	S	*	.			trans	-67.1	87.1	169.9	45.7	0	0	0	0	106.2	M1 I5	M1-T3 PolarHBondContact O-N 3.09Å; M1-T3 VanDerWaalsContact O-N 3.16Å; T3-I5 PolarHBondContact O-N 2.77Å
4	E	72.1	Confident	83.6	Confident	155 Å²	155	86.3 Å²	86.3	72%	0.724	48%	0.484	S	S	*	.			trans	-57.6	117.1	168.3	-67.1	-163.6	170.6	0	0	106	T2	T2-E4 PolarHBondContact O-N 3.36Å
5	I	82.9	Confident	84.6	Confident	133 Å²	133	88.9 Å²	88.9	68%	0.682	49%	0.489	S	S	*	.			trans	-56.8	128.6	176.7	-62	170.2	0	0	0	105.5	T3 V7	T3-I5 PolarHBondContact O-N 2.77Å; I5-V7 HydrophobicContact CB-CG2 4.07Å; I5-V7 HydrophobicContact CG2-CG2 3.83Å; I5-V7 WeakPolarHBondContact O-CG2 3.22Å; I5-V7 PolarHBondContact O-N 2.92Å
6	P	89	Confident	85.5	Confident	30 Å²	30	83.4 Å²	83.4	20%	0.195	46%	0.459	C	S	.	.			trans	-76.1	66.9	-176.3	31.8	-36.5	0	0	0	110.3	L8 L9 A10 W69 L73 E77	P6-L8 PolarHBondContact O-N 3.06Å; P6-L9 HydrophobicContact CB-CB 4.16Å; P6-L9 HydrophobicContact CB-CD1 3.78Å; P6-L9 HydrophobicContact CB-CG 4.02Å; P6-L9 PolarHBondContact O-N 3.28Å; P6-A10 PolarHBondContact O-N 3.02Å; P6-W69 HydrophobicContact CG-CH2 4.3Å; P6-W69 HydrophobicContact CG-CZ3 3.85Å; P6-L73 HydrophobicContact CB-CD2 4.42Å; P6-L73 HydrophobicContact CG-CD2 4.21Å; P6-E77 WeakPolarHBondContact CA-OE1 3.16Å
7	V	93.9	Very high	86.3	Confident	93 Å²	93	80.7 Å²	80.7	56%	0.564	45%	0.45	S	S	*	.	H	α-helix	trans	-63.8	-32.5	-172.4	175.4	0	0	0	0	110.4	I5 A10 A11 E77	I5-V7 HydrophobicContact CB-CG2 4.07Å; I5-V7 HydrophobicContact CG2-CG2 3.83Å; I5-V7 WeakPolarHBondContact O-CG2 3.22Å; I5-V7 PolarHBondContact O-N 2.92Å; V7-A10 PolarHBondContact O-N 2.94Å; V7-A11 WeakPolarHBondContact O-CB 3.35Å; V7-A11 PolarHBondContact O-N 2.9Å; V7-E77 PolarHBondContact N-OE1 3.44Å
8	L	95.5	Very high	87	Confident	88 Å²	88	81.6 Å²	81.6	46%	0.461	45%	0.453	S	S	.	.	H	α-helix	trans	-73	-40.2	179.2	-55.4	177.4	0	0	0	110.7	P6 A10 A11 V12 E77 V81	P6-L8 PolarHBondContact O-N 3.06Å; L8-A10 VanDerWaalsContact C-N 3.32Å; L8-A10 PolarHBondContact O-N 3.23Å; L8-A11 PolarHBondContact O-N 3.3Å; L8-V12 WeakPolarHBondContact O-CG2 3.46Å; L8-V12 PolarHBondContact O-N 3.39Å; L8-E77 WeakPolarHBondContact CA-OE1 3.48Å; L8-E77 HydrophobicContact CB-CG 4.09Å; L8-E77 VanDerWaalsContact CB-OE1 3.3Å; L8-E77 WeakPolarHBondContact CB-OE1 3.39Å; L8-E77 HydrophobicContact CD1-CG 4.41Å; L8-E77 PolarHBondContact N-OE1 3.47Å; L8-V81 HydrophobicContact CB-CG2 3.48Å; L8-V81 VanDerWaalsContact CB-CG2 3.48Å
9	L	97.3	Very high	87.6	Confident	0 Å²	0	78.6 Å²	78.6	0%	0	44%	0.435	C	S	.	.	H	α-helix	trans	-61.6	-42.7	172.3	-58.8	-177.5	0	0	0	111.4	P6 V12 S13 L68 W69 L73 E77 A80 V81	P6-L9 HydrophobicContact CB-CB 4.16Å; P6-L9 HydrophobicContact CB-CD1 3.78Å; P6-L9 HydrophobicContact CB-CG 4.02Å; P6-L9 PolarHBondContact O-N 3.28Å; L9-V12 PolarHBondContact O-N 2.98Å; L9-S13 WeakPolarHBondContact O-CB 3.43Å; L9-S13 PolarHBondContact O-N 2.85Å; L9-S13 PolarHBondContact O-OG 2.99Å; L9-L68 HydrophobicContact CD2-CD1 4.14Å; L9-L68 HydrophobicContact CD2-CG 4.31Å; L9-W69 HydrophobicContact CB-CH2 4.46Å; L9-W69 HydrophobicContact CB-CZ2 4.45Å; L9-W69 HydrophobicContact CD1-CE3 4.14Å; L9-W69 HydrophobicContact CD1-CZ3 4.44Å; L9-L73 HydrophobicContact CD1-CD2 4.4Å; L9-L73 HydrophobicContact CD1-CG 4.44Å; L9-E77 HydrophobicContact CD2-CG 4.2Å; L9-E77 HydrophobicContact CG-CG 4Å; L9-E77 PolarHBondContact N-OE1 3.41Å; L9-A80 HydrophobicContact CD2-CB 3.89Å; L9-V81 HydrophobicContact CD2-CG2 4.04Å
10	A	97.3	Very high	88.1	Confident	46 Å²	46	76 Å²	76	38%	0.38	42%	0.42	S	S	.	.	H	α-helix	trans	-62.7	-42.5	177.3	0	0	0	0	0	111.5	P6 V7 L8 S13 L14	P6-A10 PolarHBondContact O-N 3.02Å; V7-A10 PolarHBondContact O-N 2.94Å; L8-A10 VanDerWaalsContact C-N 3.32Å; L8-A10 PolarHBondContact O-N 3.23Å; A10-S13 PolarHBondContact O-N 3.09Å; A10-L14 WeakPolarHBondContact O-CB 3.27Å; A10-L14 PolarHBondContact O-N 3.16Å
11	A	97.8	Very high	88.6	Confident	36 Å²	36	77 Å²	77	30%	0.298	43%	0.428	S	S	.	.	H	α-helix	trans	-61.7	-49.7	175.8	0	0	0	0	0	111.7	V7 L8 S13 L14 F15	V7-A11 WeakPolarHBondContact O-CB 3.35Å; V7-A11 PolarHBondContact O-N 2.9Å; L8-A11 PolarHBondContact O-N 3.3Å; A11-S13 VanDerWaalsContact C-N 3.3Å; A11-S13 PolarHBondContact O-N 2.95Å; A11-L14 PolarHBondContact O-N 2.99Å; A11-F15 HydrophobicContact CB-CE2 4.4Å; A11-F15 WeakPolarHBondContact O-CD2 3.45Å; A11-F15 PolarHBondContact O-N 3.2Å
12	V	98.4	Very high	91.1	Very high	9 Å²	9	70.3 Å²	70.3	6%	0.055	39%	0.39	C	S	.	.	H	α-helix	trans	-59.9	-41.9	176.5	172.3	0	0	0	0	110.9	L8 L9 L14 F15 S16 F64 L68 V81 V85 M88	L8-V12 WeakPolarHBondContact O-CG2 3.46Å; L8-V12 PolarHBondContact O-N 3.39Å; L9-V12 PolarHBondContact O-N 2.98Å; V12-L14 PolarHBondContact O-N 3.07Å; V12-F15 PolarHBondContact O-N 3.18Å; V12-S16 VanDerWaalsContact O-CB 3.27Å; V12-S16 WeakPolarHBondContact O-CB 3.35Å; V12-S16 PolarHBondContact O-N 3.11Å; V12-S16 PolarHBondContact O-OG 3.47Å; V12-F64 HydrophobicContact CG1-CZ 4.13Å; V12-L68 HydrophobicContact CB-CD2 4.43Å; V12-L68 HydrophobicContact CG1-CD1 4.31Å; V12-L68 HydrophobicContact CG1-CD2 3.9Å; V12-V81 HydrophobicContact CG2-CB 4.26Å; V12-V81 HydrophobicContact CG2-CG1 3.87Å; V12-V81 HydrophobicContact CG2-CG2 3.96Å; V12-V85 HydrophobicContact CG2-CG2 4.41Å; V12-M88 HydrophobicContact CG1-SD 4.21Å
13	S	98.5	Very high	93.6	Very high	18 Å²	18	64.5 Å²	64.5	13%	0.126	36%	0.355	C	S	.	.	H	α-helix	trans	-59.6	-48.3	176.1	-61.2	0	0	0	0	111.1	L9 A10 A11 S16 A17 W69	L9-S13 WeakPolarHBondContact O-CB 3.43Å; L9-S13 PolarHBondContact O-N 2.85Å; L9-S13 PolarHBondContact O-OG 2.99Å; A10-S13 PolarHBondContact O-N 3.09Å; A11-S13 VanDerWaalsContact C-N 3.3Å; A11-S13 PolarHBondContact O-N 2.95Å; S13-S16 PolarHBondContact O-N 3.31Å; S13-S16 PolarHBondContact O-OG 3.22Å; S13-A17 WeakPolarHBondContact O-CB 3.18Å; S13-A17 PolarHBondContact O-N 2.96Å; S13-W69 PolarHBondContact OG-NE1 3.44Å; S13-W69 VanDerWaalsContact OG-NE1 3.07Å
14	L	98.6	Very high	95.6	Very high	109 Å²	109	60.3 Å²	60.3	57%	0.571	33%	0.333	S	S	*	.	H	α-helix	trans	-61.8	-48.4	178	180	61.4	0	0	0	112.1	A10 A11 V12 S16 A17 L18	A10-L14 WeakPolarHBondContact O-CB 3.27Å; A10-L14 PolarHBondContact O-N 3.16Å; A11-L14 PolarHBondContact O-N 2.99Å; V12-L14 PolarHBondContact O-N 3.07Å; L14-S16 VanDerWaalsContact C-N 3.32Å; L14-S16 PolarHBondContact O-N 2.91Å; L14-A17 WeakPolarHBondContact O-CB 3.24Å; L14-A17 PolarHBondContact O-N 3.47Å; L14-L18 HydrophobicContact CG-CD1 4.46Å; L14-L18 WeakPolarHBondContact O-CG 3.41Å; L14-L18 PolarHBondContact O-N 3.05Å
15	F	98.6	Very high	96.9	Very high	126 Å²	126	60.9 Å²	60.9	55%	0.553	33%	0.329	S	S	*	.	H	α-helix	trans	-64.1	-37.4	179	-72.7	-64.3	0	0	0	112.3	A11 V12 A17 L18 Q19 M88	A11-F15 HydrophobicContact CB-CE2 4.4Å; A11-F15 WeakPolarHBondContact O-CD2 3.45Å; A11-F15 PolarHBondContact O-N 3.2Å; V12-F15 PolarHBondContact O-N 3.18Å; F15-A17 VanDerWaalsContact C-N 3.34Å; F15-L18 HydrophobicContact CD1-CD1 4.41Å; F15-L18 PolarHBondContact O-N 2.88Å; F15-Q19 PolarHBondContact O-N 2.95Å; F15-M88 HydrophobicContact CB-CE 3.65Å; F15-M88 HydrophobicContact CB-SD 4.34Å
16	S	98.6	Very high	97.6	Very high	1 Å²	1	57 Å²	57	1%	0.007	31%	0.308	C	S	.	.	H	α-helix	trans	-66.6	-35.3	174.8	76.4	0	0	0	0	112.2	V12 S13 L14 Q19 M20 Y61	V12-S16 VanDerWaalsContact O-CB 3.27Å; V12-S16 WeakPolarHBondContact O-CB 3.35Å; V12-S16 PolarHBondContact O-N 3.11Å; V12-S16 PolarHBondContact O-OG 3.47Å; S13-S16 PolarHBondContact O-N 3.31Å; S13-S16 PolarHBondContact O-OG 3.22Å; L14-S16 VanDerWaalsContact C-N 3.32Å; L14-S16 PolarHBondContact O-N 2.91Å; S16-Q19 WeakPolarHBondContact O-CB 3.41Å; S16-Q19 PolarHBondContact O-N 3.35Å; S16-M20 WeakPolarHBondContact O-CG 3.44Å; S16-M20 PolarHBondContact O-N 3.19Å; S16-Y61 WeakPolarHBondContact OG-CE2 3.43Å; S16-Y61 PolarHBondContact OG-OH 3.37Å
17	A	98.8	Very high	98	Very high	37 Å²	37	56.1 Å²	56.1	31%	0.306	30%	0.302	S	S	.	.	H	α-helix	trans	-66.8	-42.5	174.2	0	0	0	0	0	111.2	S13 L14 F15 Q19 M20 V21 Y61	S13-A17 WeakPolarHBondContact O-CB 3.18Å; S13-A17 PolarHBondContact O-N 2.96Å; L14-A17 WeakPolarHBondContact O-CB 3.24Å; L14-A17 PolarHBondContact O-N 3.47Å; F15-A17 VanDerWaalsContact C-N 3.34Å; A17-Q19 VanDerWaalsContact C-N 3.28Å; A17-Q19 PolarHBondContact O-N 3.43Å; A17-M20 WeakPolarHBondContact O-CB 3.43Å; A17-M20 PolarHBondContact O-N 2.92Å; A17-M20 VanDerWaalsContact O-N 3.11Å; A17-V21 WeakPolarHBondContact O-CG2 3.41Å; A17-V21 PolarHBondContact O-N 2.84Å; A17-Y61 WeakPolarHBondContact CA-OH 3.41Å; A17-Y61 PolarHBondContact N-OH 3.3Å
18	L	98.8	Very high	98.2	Very high	96 Å²	96	53.2 Å²	53.2	50%	0.503	29%	0.291	S	S	.	.	H	α-helix	trans	-61.3	-37.1	173	-67.6	174.4	0	0	0	111.9	L14 F15 V21 Y22	L14-L18 HydrophobicContact CG-CD1 4.46Å; L14-L18 WeakPolarHBondContact O-CG 3.41Å; L14-L18 PolarHBondContact O-N 3.05Å; F15-L18 HydrophobicContact CD1-CD1 4.41Å; F15-L18 PolarHBondContact O-N 2.88Å; L18-V21 PolarHBondContact O-N 3.45Å; L18-Y22 PolarHBondContact O-N 3.13Å
19	Q	98.7	Very high	98.4	Very high	25 Å²	25	52 Å²	52	12%	0.117	29%	0.285	C	S	.	.	H	α-helix	trans	-60.6	-45.7	171.5	-177.9	-177.3	44	0	0	111.1	F15 S16 A17 V21 Y22 L23 M88	F15-Q19 PolarHBondContact O-N 2.95Å; S16-Q19 WeakPolarHBondContact O-CB 3.41Å; S16-Q19 PolarHBondContact O-N 3.35Å; A17-Q19 VanDerWaalsContact C-N 3.28Å; A17-Q19 PolarHBondContact O-N 3.43Å; Q19-V21 VanDerWaalsContact C-N 3.33Å; Q19-V21 PolarHBondContact O-N 3.09Å; Q19-Y22 WeakPolarHBondContact O-CB 3.24Å; Q19-Y22 PolarHBondContact O-N 2.93Å; Q19-L23 HydrophobicContact CG-CD1 4.49Å; Q19-L23 HydrophobicContact CG-CG 4.46Å; Q19-L23 VanDerWaalsContact O-CG 3.31Å; Q19-L23 WeakPolarHBondContact O-CG 3.44Å; Q19-L23 PolarHBondContact O-N 3.01Å; Q19-M88 PolarHBondContact NE2-O 3.25Å
20	M	98.7	Very high	98.4	Very high	26 Å²	26	52.4 Å²	52.4	13%	0.128	29%	0.288	C	S	.	.	H	α-helix	trans	-59.4	-42.5	176.3	-68.8	-59.5	-59.7	0	0	112.2	S16 A17 Y22 L23 A24 N57 V58 Y61	S16-M20 WeakPolarHBondContact O-CG 3.44Å; S16-M20 PolarHBondContact O-N 3.19Å; A17-M20 WeakPolarHBondContact O-CB 3.43Å; A17-M20 PolarHBondContact O-N 2.92Å; A17-M20 VanDerWaalsContact O-N 3.11Å; M20-Y22 PolarHBondContact O-N 3.41Å; M20-L23 PolarHBondContact O-N 3.34Å; M20-A24 WeakPolarHBondContact O-CB 3.27Å; M20-A24 PolarHBondContact O-N 3.15Å; M20-N57 HydrophobicContact CE-CB 4.02Å; M20-N57 HydrophobicContact SD-CB 3.87Å; M20-V58 HydrophobicContact CE-CB 4.25Å; M20-V58 HydrophobicContact CE-CG2 3.53Å; M20-Y61 HydrophobicContact CG-CD1 4.23Å; M20-Y61 HydrophobicContact CG-CD2 3.85Å; M20-Y61 HydrophobicContact CG-CE1 4.25Å; M20-Y61 HydrophobicContact CG-CE2 3.91Å; M20-Y61 HydrophobicContact CG-CG 4.03Å; M20-Y61 HydrophobicContact SD-CD2 4.13Å; M20-Y61 HydrophobicContact SD-CG 4.22Å
21	V	98.7	Very high	98.4	Very high	99 Å²	99	52.5 Å²	52.5	60%	0.6	28%	0.278	S	S	*	.	H	α-helix	trans	-61.3	-43.9	174.6	173.7	0	0	0	0	111.3	A17 L18 Q19 L23 A24 R25	A17-V21 WeakPolarHBondContact O-CG2 3.41Å; A17-V21 PolarHBondContact O-N 2.84Å; L18-V21 PolarHBondContact O-N 3.45Å; Q19-V21 VanDerWaalsContact C-N 3.33Å; Q19-V21 PolarHBondContact O-N 3.09Å; V21-L23 PolarHBondContact O-N 3.44Å; V21-A24 PolarHBondContact O-N 3.38Å; V21-R25 PolarHBondContact O-N 2.85Å
22	Y	98.6	Very high	98.4	Very high	95 Å²	95	57 Å²	57	37%	0.373	30%	0.295	S	S	.	.	H	α-helix	trans	-58.7	-47.8	174.9	166	-98	0	0	0	111.5	L18 Q19 M20 A24 R25 Q26	L18-Y22 PolarHBondContact O-N 3.13Å; Q19-Y22 WeakPolarHBondContact O-CB 3.24Å; Q19-Y22 PolarHBondContact O-N 2.93Å; M20-Y22 PolarHBondContact O-N 3.41Å; Y22-A24 VanDerWaalsContact C-N 3.35Å; Y22-A24 PolarHBondContact O-N 2.82Å; Y22-R25 WeakPolarHBondContact O-CB 3.36Å; Y22-R25 PolarHBondContact O-N 3.48Å; Y22-Q26 HydrophobicContact CE1-CG 4.12Å; Y22-Q26 HydrophobicContact CE2-CG 4.25Å; Y22-Q26 WeakPolarHBondContact O-CG 3.4Å; Y22-Q26 PolarHBondContact O-N 3.1Å
23	L	98.4	Very high	98.4	Very high	0 Å²	0	61.7 Å²	61.7	0%	0	32%	0.324	C	S	.	.	H	α-helix	trans	-64.3	-38.7	179	-62.3	-174.9	0	0	0	112.2	Q19 M20 V21 R25 Q26 V27 N57 F95	Q19-L23 HydrophobicContact CG-CD1 4.49Å; Q19-L23 HydrophobicContact CG-CG 4.46Å; Q19-L23 VanDerWaalsContact O-CG 3.31Å; Q19-L23 WeakPolarHBondContact O-CG 3.44Å; Q19-L23 PolarHBondContact O-N 3.01Å; M20-L23 PolarHBondContact O-N 3.34Å; V21-L23 PolarHBondContact O-N 3.44Å; L23-R25 VanDerWaalsContact C-N 3.34Å; L23-Q26 WeakPolarHBondContact O-CB 3.49Å; L23-Q26 PolarHBondContact O-N 3.09Å; L23-V27 PolarHBondContact O-N 3.36Å; L23-N57 HydrophobicContact CD1-CB 3.96Å; L23-N57 WeakPolarHBondContact CD1-OD1 3.19Å; L23-F95 HydrophobicContact CB-CD2 4.47Å; L23-F95 HydrophobicContact CB-CE2 4.31Å; L23-F95 HydrophobicContact CD1-CB 4.47Å; L23-F95 HydrophobicContact CD1-CD2 4.19Å; L23-F95 HydrophobicContact CD1-CG 4.4Å; L23-F95 HydrophobicContact CD2-CB 3.95Å; L23-F95 HydrophobicContact CD2-CD1 3.49Å; L23-F95 VanDerWaalsContact CD2-CD1 3.49Å; L23-F95 HydrophobicContact CD2-CD2 3.69Å; L23-F95 HydrophobicContact CD2-CE1 3.82Å; L23-F95 HydrophobicContact CD2-CE2 4.01Å; L23-F95 HydrophobicContact CD2-CG 3.42Å; L23-F95 VanDerWaalsContact CD2-CG 3.42Å; L23-F95 HydrophobicContact CD2-CZ 4.06Å; L23-F95 HydrophobicContact CG-CD2 4.34Å; L23-F95 HydrophobicContact CG-CG 4.45Å
24	A	98.4	Very high	98.3	Very high	44 Å²	44	63 Å²	63	36%	0.364	33%	0.328	S	S	.	.	H	α-helix	trans	-62.2	-41.8	174.3	0	0	0	0	0	111.5	M20 V21 Y22 Q26 V27 G28 H54	M20-A24 WeakPolarHBondContact O-CB 3.27Å; M20-A24 PolarHBondContact O-N 3.15Å; V21-A24 PolarHBondContact O-N 3.38Å; Y22-A24 VanDerWaalsContact C-N 3.35Å; Y22-A24 PolarHBondContact O-N 2.82Å; A24-Q26 VanDerWaalsContact C-N 3.31Å; A24-Q26 PolarHBondContact O-N 2.95Å; A24-V27 WeakPolarHBondContact O-CB 3.31Å; A24-V27 PolarHBondContact O-N 3.31Å; A24-V27 VanDerWaalsContact O-N 3.17Å; A24-G28 PolarHBondContact O-N 3.17Å; A24-H54 PolarHBondContact N-CD2 3Å
25	R	98.6	Very high	98.3	Very high	168 Å²	168	66.5 Å²	66.5	63%	0.634	34%	0.339	S	S	*	.	H	α-helix	trans	-59.1	-41.4	173.9	-177.2	-175.8	176.2	-157.2	-0.8	111.5	V21 Y22 L23 V27 G28 L29	V21-R25 PolarHBondContact O-N 2.85Å; Y22-R25 WeakPolarHBondContact O-CB 3.36Å; Y22-R25 PolarHBondContact O-N 3.48Å; L23-R25 VanDerWaalsContact C-N 3.34Å; R25-V27 VanDerWaalsContact C-N 3.29Å; R25-V27 PolarHBondContact O-N 3.29Å; R25-G28 WeakPolarHBondContact O-CA 3.47Å; R25-G28 PolarHBondContact O-N 3.24Å; R25-L29 WeakPolarHBondContact O-CG 3.45Å; R25-L29 PolarHBondContact O-N 3.37Å
26	Q	98.4	Very high	98.2	Very high	52 Å²	52	61 Å²	61	24%	0.243	32%	0.315	C	S	.	.	H	α-helix	trans	-61	-37.2	177.1	-63.9	-55.7	101.9	0	0	112.4	Y22 L23 A24 L29 A30 F95	Y22-Q26 HydrophobicContact CE1-CG 4.12Å; Y22-Q26 HydrophobicContact CE2-CG 4.25Å; Y22-Q26 WeakPolarHBondContact O-CG 3.4Å; Y22-Q26 PolarHBondContact O-N 3.1Å; L23-Q26 WeakPolarHBondContact O-CB 3.49Å; L23-Q26 PolarHBondContact O-N 3.09Å; A24-Q26 VanDerWaalsContact C-N 3.31Å; A24-Q26 PolarHBondContact O-N 2.95Å; Q26-L29 PolarHBondContact O-N 3.41Å; Q26-A30 WeakPolarHBondContact O-CB 3.44Å; Q26-A30 PolarHBondContact O-N 3.06Å; Q26-F95 HydrophobicContact CB-CE1 4.02Å; Q26-F95 HydrophobicContact CB-CZ 3.71Å; Q26-F95 HydrophobicContact CG-CE1 4.1Å; Q26-F95 HydrophobicContact CG-CZ 4.26Å
27	V	98.4	Very high	98.1	Very high	10 Å²	10	67.9 Å²	67.9	6%	0.061	35%	0.349	C	S	.	.	H	α-helix	trans	-64.1	-43.1	171.8	177.9	0	0	0	0	111	L23 A24 R25 L29 A30 R31 T50 F51 H54	L23-V27 PolarHBondContact O-N 3.36Å; A24-V27 WeakPolarHBondContact O-CB 3.31Å; A24-V27 PolarHBondContact O-N 3.31Å; A24-V27 VanDerWaalsContact O-N 3.17Å; R25-V27 VanDerWaalsContact C-N 3.29Å; R25-V27 PolarHBondContact O-N 3.29Å; V27-L29 VanDerWaalsContact C-N 3.35Å; V27-L29 PolarHBondContact O-N 3.22Å; V27-A30 PolarHBondContact O-N 3.2Å; V27-R31 WeakPolarHBondContact O-CG 3.48Å; V27-R31 PolarHBondContact O-N 3.34Å; V27-T50 HydrophobicContact CG2-CG2 4.28Å; V27-F51 HydrophobicContact CG1-CD2 3.83Å; V27-H54 HydrophobicContact CG2-CB 3.37Å
28	G	98.1	Very high	97.9	Very high	32 Å²	32	70.5 Å²	70.5	33%	0.33	36%	0.363	S	S	.	.	H	α-helix	trans	-58.8	-43.8	175.5	0	0	0	0	0	112.8	A24 R25 R31 M32	A24-G28 PolarHBondContact O-N 3.17Å; R25-G28 WeakPolarHBondContact O-CA 3.47Å; R25-G28 PolarHBondContact O-N 3.24Å; G28-R31 WeakPolarHBondContact O-CB 3.46Å; G28-R31 PolarHBondContact O-N 2.91Å; G28-M32 PolarHBondContact O-N 3.43Å
29	L	98.3	Very high	97.8	Very high	63 Å²	63	72 Å²	72	33%	0.33	38%	0.378	S	S	.	.	H	α-helix	trans	-61.4	-46.1	173.7	-65.9	178.2	0	0	0	111.4	R25 Q26 V27 R31 M32 T33	R25-L29 WeakPolarHBondContact O-CG 3.45Å; R25-L29 PolarHBondContact O-N 3.37Å; Q26-L29 PolarHBondContact O-N 3.41Å; V27-L29 VanDerWaalsContact C-N 3.35Å; V27-L29 PolarHBondContact O-N 3.22Å; L29-R31 VanDerWaalsContact C-N 3.29Å; L29-R31 PolarHBondContact O-N 3.38Å; L29-M32 HydrophobicContact CD2-CE 3.46Å; L29-M32 VanDerWaalsContact CD2-CE 3.46Å; L29-M32 PolarHBondContact O-N 3.01Å; L29-M32 VanDerWaalsContact O-N 3.11Å; L29-T33 PolarHBondContact O-N 2.99Å; L29-T33 PolarHBondContact O-OG1 3.41Å; L29-T33 VanDerWaalsContact O-OG1 3.13Å
30	A	97.9	Very high	97.7	Very high	9 Å²	9	74 Å²	74	7%	0.074	39%	0.392	C	S	.	.	H	α-helix	trans	-61.5	-36.3	177.8	0	0	0	0	0	112.4	Q26 V27 T33 H34 F47 T50	Q26-A30 WeakPolarHBondContact O-CB 3.44Å; Q26-A30 PolarHBondContact O-N 3.06Å; V27-A30 PolarHBondContact O-N 3.2Å; A30-T33 PolarHBondContact O-N 2.94Å; A30-H34 WeakPolarHBondContact O-CB 3.38Å; A30-H34 PolarHBondContact O-CD2 3.44Å; A30-H34 PolarHBondContact O-N 2.99Å; A30-F47 HydrophobicContact CB-CD2 4.02Å; A30-T50 HydrophobicContact CB-CG2 4.04Å
31	R	98.1	Very high	97.7	Very high	47 Å²	47	76 Å²	76	18%	0.177	41%	0.406	C	S	.	.	H	α-helix	trans	-59.8	-44.9	172.8	-73.2	-176.4	173.2	-74.7	-0.6	111.9	V27 G28 L29 K35 V36 T40 F47	V27-R31 WeakPolarHBondContact O-CG 3.48Å; V27-R31 PolarHBondContact O-N 3.34Å; G28-R31 WeakPolarHBondContact O-CB 3.46Å; G28-R31 PolarHBondContact O-N 2.91Å; L29-R31 VanDerWaalsContact C-N 3.29Å; L29-R31 PolarHBondContact O-N 3.38Å; R31-K35 CarbonylContact O-C 3.53Å; R31-K35 VanDerWaalsContact O-CA 3.27Å; R31-K35 WeakPolarHBondContact O-CA 3.46Å; R31-K35 PolarHBondContact O-N 3.47Å; R31-V36 PolarHBondContact NH1-O 3.2Å; R31-V36 PolarHBondContact O-N 3.32Å; R31-T40 PolarHBondContact NH1-O 3.05Å; R31-T40 PolarHBondContact NH2-O 3.24Å; R31-T40 VanDerWaalsContact NH2-O 3.09Å; R31-F47 HydrophobicContact CB-CE2 4.5Å; R31-F47 HydrophobicContact CG-CD2 4.34Å; R31-F47 HydrophobicContact CG-CE2 3.49Å; R31-F47 VanDerWaalsContact CG-CE2 3.49Å; R31-F47 HydrophobicContact CG-CZ 4.14Å
32	M	97.8	Very high	97.6	Very high	131 Å²	131	75.6 Å²	75.6	65%	0.645	40%	0.404	S	S	*	.	H	α-helix	trans	-65.7	-47.6	178.5	-65.3	-170	-60.7	0	0	111.4	G28 L29 H34 K35	G28-M32 PolarHBondContact O-N 3.43Å; L29-M32 HydrophobicContact CD2-CE 3.46Å; L29-M32 VanDerWaalsContact CD2-CE 3.46Å; L29-M32 PolarHBondContact O-N 3.01Å; L29-M32 VanDerWaalsContact O-N 3.11Å; M32-H34 VanDerWaalsContact C-N 3.34Å; M32-H34 PolarHBondContact O-N 3.41Å; M32-K35 PolarHBondContact O-N 3.34Å
33	T	97.6	Very high	97.5	Very high	107 Å²	107	72.6 Å²	72.6	66%	0.656	40%	0.402	S	S	*	.	H	α-helix	trans	-59	-44.1	-180	-58.5	0	0	0	0	112.1	L29 A30	L29-T33 PolarHBondContact O-N 2.99Å; L29-T33 PolarHBondContact O-OG1 3.41Å; L29-T33 VanDerWaalsContact O-OG1 3.13Å; A30-T33 PolarHBondContact O-N 2.94Å
34	H	97.1	Very high	97.4	Very high	46 Å²	46	75.1 Å²	75.1	21%	0.213	42%	0.418	C	S	.	.	T	Hydrogen-bonded Turn	trans	-96.2	5.3	-176.9	-61.5	-64.2	0	0	0	113.9	A30 M32 V36 P44 E46 F47	A30-H34 WeakPolarHBondContact O-CB 3.38Å; A30-H34 PolarHBondContact O-CD2 3.44Å; A30-H34 PolarHBondContact O-N 2.99Å; M32-H34 VanDerWaalsContact C-N 3.34Å; M32-H34 PolarHBondContact O-N 3.41Å; H34-V36 HydrophobicContact CB-CG2 3.94Å; H34-V36 PolarHBondContact O-N 2.89Å; H34-P44 HydrophobicContact CB-CG 4.05Å; H34-E46 IonicContact CE1-OE2 3.18Å; H34-E46 PolarHBondContact CE1-OE2 2.93Å; H34-E46 IonicContact NE2-OE2 3.69Å; H34-F47 HydrophobicContact CB-CB 4.19Å
35	K	97.5	Very high	97.4	Very high	183 Å²	183	77.2 Å²	77.2	80%	0.796	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.2	36.8	-178.2	-56.5	179.5	-179.1	178.3	0	113.6	R31 M32 M37	R31-K35 CarbonylContact O-C 3.53Å; R31-K35 VanDerWaalsContact O-CA 3.27Å; R31-K35 WeakPolarHBondContact O-CA 3.46Å; R31-K35 PolarHBondContact O-N 3.47Å; M32-K35 PolarHBondContact O-N 3.34Å; K35-M37 PolarHBondContact O-N 3.23Å
36	V	97.6	Very high	97.3	Very high	11 Å²	11	74.5 Å²	74.5	7%	0.067	42%	0.423	C	S	.	.			trans	-88.9	92.1	178.4	-174.3	0	0	0	0	109.9	R31 H34 T40 F47	R31-V36 PolarHBondContact NH1-O 3.2Å; R31-V36 PolarHBondContact O-N 3.32Å; H34-V36 HydrophobicContact CB-CG2 3.94Å; H34-V36 PolarHBondContact O-N 2.89Å; V36-T40 HydrophobicContact CG1-CG2 3.92Å; V36-F47 HydrophobicContact CB-CD1 4.28Å; V36-F47 HydrophobicContact CB-CD2 4.43Å; V36-F47 HydrophobicContact CB-CE1 4.12Å; V36-F47 HydrophobicContact CB-CE2 4.31Å; V36-F47 HydrophobicContact CB-CG 4.43Å; V36-F47 HydrophobicContact CB-CZ 4.13Å; V36-F47 HydrophobicContact CG1-CD1 4.16Å; V36-F47 HydrophobicContact CG1-CE1 3.63Å; V36-F47 HydrophobicContact CG1-CE2 4.46Å; V36-F47 HydrophobicContact CG1-CZ 3.8Å; V36-F47 HydrophobicContact CG2-CB 4.48Å; V36-F47 HydrophobicContact CG2-CD1 3.85Å; V36-F47 HydrophobicContact CG2-CD2 4.34Å; V36-F47 HydrophobicContact CG2-CE1 4.18Å; V36-F47 HydrophobicContact CG2-CG 3.94Å
37	M	95.5	Very high	97.3	Very high	144 Å²	144	72 Å²	72	71%	0.709	41%	0.411	S	S	*	.			trans	-69.6	136.9	179.5	-66.5	-62.5	-70.7	0	0	111.7	K35 T40	K35-M37 PolarHBondContact O-N 3.23Å; M37-T40 WeakPolarHBondContact O-CB 3.15Å; M37-T40 PolarHBondContact O-N 3.29Å; M37-T40 PolarHBondContact O-OG1 3.27Å
38	P	94.2	Very high	97.3	Very high	92 Å²	92	75 Å²	75	60%	0.597	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.5	146.4	166.9	-23.1	34.3	0	0	0	111.3
39	P	96.3	Very high	97.3	Very high	127 Å²	127	75.9 Å²	75.9	83%	0.825	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	cis	-84.8	5.4	6.2	34.9	-36.8	0	0	0	114.9
40	T	97.4	Very high	97.3	Very high	67 Å²	67	73.5 Å²	73.5	41%	0.411	41%	0.406	S	S	.	.			trans	-61.6	137.4	-174.3	-53.7	0	0	0	0	112.3	R31 V36 M37 T42	R31-T40 PolarHBondContact NH1-O 3.05Å; R31-T40 PolarHBondContact NH2-O 3.24Å; R31-T40 VanDerWaalsContact NH2-O 3.09Å; V36-T40 HydrophobicContact CG1-CG2 3.92Å; M37-T40 WeakPolarHBondContact O-CB 3.15Å; M37-T40 PolarHBondContact O-N 3.29Å; M37-T40 PolarHBondContact O-OG1 3.27Å; T40-T42 WeakPolarHBondContact CG2-O 3.34Å
41	V	97.8	Very high	97.3	Very high	70 Å²	70	74.6 Å²	74.6	42%	0.424	41%	0.409	S	S	.	.			trans	-124.9	3.4	179.8	-64	0	0	0	0	113.5	F51	V41-F51 HydrophobicContact CB-CD1 4.42Å; V41-F51 HydrophobicContact CB-CE1 3.87Å; V41-F51 HydrophobicContact CB-CE2 4.46Å; V41-F51 HydrophobicContact CB-CZ 3.89Å; V41-F51 HydrophobicContact CG1-CE1 4.03Å; V41-F51 HydrophobicContact CG1-CE2 3.96Å; V41-F51 HydrophobicContact CG1-CZ 3.52Å
42	T	97.4	Very high	97.4	Very high	89 Å²	89	79.6 Å²	79.6	55%	0.546	43%	0.428	S	S	.	.			trans	-111.8	157.8	173.8	52.1	0	0	0	0	110.3	T40 E48	T40-T42 WeakPolarHBondContact CG2-O 3.34Å; T42-E48 WeakPolarHBondContact CA-OE1 3.49Å; T42-E48 WeakPolarHBondContact CB-OE1 3.4Å
43	G	96.3	Very high	97.4	Very high	33 Å²	33	73.3 Å²	73.3	34%	0.34	40%	0.397	S	S	.	.			trans	166.8	-152.7	-176.9	0	0	0	0	0	112.9	E48	G43-E48 PolarHBondContact N-OE1 3.41Å
44	P	97.5	Very high	97.4	Very high	53 Å²	53	69.5 Å²	69.5	34%	0.344	37%	0.372	S	S	.	.	S	Bend	trans	-56	145.3	175.7	-26.7	36.6	0	0	0	111.5	H34 E46 F47 E48	H34-P44 HydrophobicContact CB-CG 4.05Å; P44-E46 PolarHBondContact O-N 3.35Å; P44-F47 WeakPolarHBondContact O-CB 3.37Å; P44-F47 PolarHBondContact O-N 3.12Å; P44-E48 PolarHBondContact O-N 3.19Å; P44-E48 VanDerWaalsContact O-N 3.09Å
45	P	97.4	Very high	97.5	Very high	87 Å²	87	70.5 Å²	70.5	57%	0.565	38%	0.376	S	S	*	.	H	α-helix	trans	-53.7	-29.7	-176.9	-30.3	36.2	0	0	0	114.7	R49	P45-R49 VanDerWaalsContact C-NH1 3.31Å; P45-R49 WeakPolarHBondContact O-CB 3.27Å; P45-R49 VanDerWaalsContact O-CG 3.24Å; P45-R49 WeakPolarHBondContact O-CG 3.48Å; P45-R49 PolarHBondContact O-N 2.75Å; P45-R49 PolarHBondContact O-NH1 2.96Å; P45-R49 VanDerWaalsContact O-NH1 3.16Å
46	E	96.8	Very high	97.6	Very high	111 Å²	111	63.2 Å²	63.2	52%	0.519	35%	0.346	S	S	.	.	H	α-helix	trans	-66.4	-44.9	176	-71.4	165.9	-171.4	0	0	112.6	H34 P44 R49 T50	H34-E46 IonicContact CE1-OE2 3.18Å; H34-E46 PolarHBondContact CE1-OE2 2.93Å; H34-E46 IonicContact NE2-OE2 3.69Å; P44-E46 PolarHBondContact O-N 3.35Å; E46-R49 VanDerWaalsContact CG-NH2 3.26Å; E46-T50 PolarHBondContact O-N 3.23Å; E46-T50 VanDerWaalsContact O-N 3.1Å; E46-T50 PolarHBondContact O-OG1 3.28Å
47	F	98.3	Very high	97.6	Very high	0 Å²	0	62.7 Å²	62.7	0%	0	34%	0.343	C	S	.	.	H	α-helix	trans	-62.1	-49.6	173.2	169.3	-104.9	0	0	0	110.6	A30 R31 H34 V36 P44 R49 T50 F51	A30-F47 HydrophobicContact CB-CD2 4.02Å; R31-F47 HydrophobicContact CB-CE2 4.5Å; R31-F47 HydrophobicContact CG-CD2 4.34Å; R31-F47 HydrophobicContact CG-CE2 3.49Å; R31-F47 VanDerWaalsContact CG-CE2 3.49Å; R31-F47 HydrophobicContact CG-CZ 4.14Å; H34-F47 HydrophobicContact CB-CB 4.19Å; V36-F47 HydrophobicContact CB-CD1 4.28Å; V36-F47 HydrophobicContact CB-CD2 4.43Å; V36-F47 HydrophobicContact CB-CE1 4.12Å; V36-F47 HydrophobicContact CB-CE2 4.31Å; V36-F47 HydrophobicContact CB-CG 4.43Å; V36-F47 HydrophobicContact CB-CZ 4.13Å; V36-F47 HydrophobicContact CG1-CD1 4.16Å; V36-F47 HydrophobicContact CG1-CE1 3.63Å; V36-F47 HydrophobicContact CG1-CE2 4.46Å; V36-F47 HydrophobicContact CG1-CZ 3.8Å; V36-F47 HydrophobicContact CG2-CB 4.48Å; V36-F47 HydrophobicContact CG2-CD1 3.85Å; V36-F47 HydrophobicContact CG2-CD2 4.34Å; V36-F47 HydrophobicContact CG2-CE1 4.18Å; V36-F47 HydrophobicContact CG2-CG 3.94Å; P44-F47 WeakPolarHBondContact O-CB 3.37Å; P44-F47 PolarHBondContact O-N 3.12Å; F47-R49 VanDerWaalsContact C-N 3.34Å; F47-R49 PolarHBondContact O-N 3.02Å; F47-T50 PolarHBondContact O-N 3.43Å; F47-T50 VanDerWaalsContact O-N 3.15Å; F47-F51 HydrophobicContact CE1-CB 4.46Å; F47-F51 HydrophobicContact CE2-CB 4.37Å; F47-F51 HydrophobicContact CZ-CB 4.17Å; F47-F51 HydrophobicContact CZ-CD2 4.28Å; F47-F51 HydrophobicContact CZ-CG 4.38Å; F47-F51 WeakPolarHBondContact O-CB 3.28Å; F47-F51 PolarHBondContact O-N 3.42Å
48	E	98.4	Very high	97.7	Very high	74 Å²	74	58.7 Å²	58.7	35%	0.346	33%	0.326	S	S	.	.	H	α-helix	trans	-61.6	-41.7	-177.3	-66.2	-167.6	172.5	0	0	111.9	T42 G43 P44 F51 R52	T42-E48 WeakPolarHBondContact CA-OE1 3.49Å; T42-E48 WeakPolarHBondContact CB-OE1 3.4Å; G43-E48 PolarHBondContact N-OE1 3.41Å; P44-E48 PolarHBondContact O-N 3.19Å; P44-E48 VanDerWaalsContact O-N 3.09Å; E48-F51 PolarHBondContact O-N 3.3Å; E48-R52 VanDerWaalsContact O-CB 3.24Å; E48-R52 WeakPolarHBondContact O-CB 3.35Å; E48-R52 WeakPolarHBondContact O-CG 3.47Å; E48-R52 PolarHBondContact O-N 3.24Å
49	R	98.4	Very high	97.9	Very high	50 Å²	50	59.9 Å²	59.9	19%	0.189	32%	0.324	C	S	.	.	H	α-helix	trans	-61.5	-45	174.5	-74.8	-172.5	-52.5	-91.5	7.6	111.9	P45 E46 F47 R52 A53 Y98 V99 T102	P45-R49 VanDerWaalsContact C-NH1 3.31Å; P45-R49 WeakPolarHBondContact O-CB 3.27Å; P45-R49 VanDerWaalsContact O-CG 3.24Å; P45-R49 WeakPolarHBondContact O-CG 3.48Å; P45-R49 PolarHBondContact O-N 2.75Å; P45-R49 PolarHBondContact O-NH1 2.96Å; P45-R49 VanDerWaalsContact O-NH1 3.16Å; E46-R49 VanDerWaalsContact CG-NH2 3.26Å; F47-R49 VanDerWaalsContact C-N 3.34Å; F47-R49 PolarHBondContact O-N 3.02Å; R49-R52 PolarHBondContact O-N 3.2Å; R49-A53 WeakPolarHBondContact O-CB 3.21Å; R49-A53 PolarHBondContact O-N 2.88Å; R49-Y98 HydrophobicContact CB-CD2 4.24Å; R49-Y98 HydrophobicContact CB-CE2 4.36Å; R49-Y98 VanDerWaalsContact CD-O 3.31Å; R49-Y98 WeakPolarHBondContact CD-O 3.47Å; R49-Y98 HydrophobicContact CG-CD2 4.19Å; R49-Y98 HydrophobicContact CG-CE2 4.04Å; R49-V99 PolarHBondContact NE-O 3.49Å; R49-V99 VanDerWaalsContact NE-O 3.09Å; R49-T102 HydrophobicContact CG-CG2 4.41Å
50	T	98.5	Very high	98	Very high	12 Å²	12	55.4 Å²	55.4	7%	0.074	29%	0.293	C	S	.	.	H	α-helix	trans	-62.8	-46.1	178.4	-54	0	0	0	0	111.4	V27 A30 E46 F47 A53 H54 F95 V99	V27-T50 HydrophobicContact CG2-CG2 4.28Å; A30-T50 HydrophobicContact CB-CG2 4.04Å; E46-T50 PolarHBondContact O-N 3.23Å; E46-T50 VanDerWaalsContact O-N 3.1Å; E46-T50 PolarHBondContact O-OG1 3.28Å; F47-T50 PolarHBondContact O-N 3.43Å; F47-T50 VanDerWaalsContact O-N 3.15Å; T50-A53 PolarHBondContact O-N 2.89Å; T50-H54 PolarHBondContact O-N 2.99Å; T50-H54 VanDerWaalsContact O-N 3.09Å; T50-F95 HydrophobicContact CG2-CE2 4.43Å; T50-F95 HydrophobicContact CG2-CZ 3.87Å; T50-V99 HydrophobicContact CG2-CG2 4.2Å
51	F	98.6	Very high	98.1	Very high	32 Å²	32	54.2 Å²	54.2	14%	0.14	28%	0.281	C	S	.	.	H	α-helix	trans	-62.5	-47.6	177.5	-179.2	-96	0	0	0	111.9	V27 V41 F47 E48 H54 Q55	V27-F51 HydrophobicContact CG1-CD2 3.83Å; V41-F51 HydrophobicContact CB-CD1 4.42Å; V41-F51 HydrophobicContact CB-CE1 3.87Å; V41-F51 HydrophobicContact CB-CE2 4.46Å; V41-F51 HydrophobicContact CB-CZ 3.89Å; V41-F51 HydrophobicContact CG1-CE1 4.03Å; V41-F51 HydrophobicContact CG1-CE2 3.96Å; V41-F51 HydrophobicContact CG1-CZ 3.52Å; F47-F51 HydrophobicContact CE1-CB 4.46Å; F47-F51 HydrophobicContact CE2-CB 4.37Å; F47-F51 HydrophobicContact CZ-CB 4.17Å; F47-F51 HydrophobicContact CZ-CD2 4.28Å; F47-F51 HydrophobicContact CZ-CG 4.38Å; F47-F51 WeakPolarHBondContact O-CB 3.28Å; F47-F51 PolarHBondContact O-N 3.42Å; E48-F51 PolarHBondContact O-N 3.3Å; F51-H54 PolarHBondContact O-N 3.3Å; F51-Q55 HydrophobicContact CD1-CG 4.24Å; F51-Q55 HydrophobicContact CE1-CG 3.75Å; F51-Q55 HydrophobicContact CE2-CG 4.5Å; F51-Q55 HydrophobicContact CZ-CG 3.89Å; F51-Q55 PolarHBondContact O-N 3.42Å
52	R	98.4	Very high	98.1	Very high	152 Å²	152	54.5 Å²	54.5	57%	0.574	29%	0.285	S	S	*	.	H	α-helix	trans	-64.9	-38.3	177.8	-72.6	-62.8	-145	173.1	7.1	112.6	E48 R49 Q55 N56 Y98	E48-R52 VanDerWaalsContact O-CB 3.24Å; E48-R52 WeakPolarHBondContact O-CB 3.35Å; E48-R52 WeakPolarHBondContact O-CG 3.47Å; E48-R52 PolarHBondContact O-N 3.24Å; R49-R52 PolarHBondContact O-N 3.2Å; R52-Q55 PolarHBondContact O-N 3.35Å; R52-N56 PolarHBondContact O-N 3.49Å; R52-Y98 HydrophobicContact CB-CE1 4.22Å
53	A	98.4	Very high	98.2	Very high	0 Å²	0	53.6 Å²	53.6	0%	0	28%	0.278	C	S	.	.	H	α-helix	trans	-61.8	-45.1	176.1	0	0	0	0	0	111.1	R49 T50 N57 F95 Y98	R49-A53 WeakPolarHBondContact O-CB 3.21Å; R49-A53 PolarHBondContact O-N 2.88Å; T50-A53 PolarHBondContact O-N 2.89Å; A53-N57 PolarHBondContact O-N 2.91Å; A53-N57 PolarHBondContact O-ND2 2.92Å; A53-F95 HydrophobicContact CB-CD2 3.49Å; A53-F95 VanDerWaalsContact CB-CD2 3.49Å; A53-F95 HydrophobicContact CB-CE2 3.84Å; A53-F95 HydrophobicContact CB-CG 4.27Å; A53-Y98 HydrophobicContact CB-CD1 3.68Å; A53-Y98 HydrophobicContact CB-CE1 4.48Å; A53-Y98 HydrophobicContact CB-CG 3.98Å
54	H	98.6	Very high	98.3	Very high	27 Å²	27	52 Å²	52	13%	0.125	26%	0.262	C	S	.	.	H	α-helix	trans	-64.9	-46.4	174.6	175.1	-100.2	0	0	0	112.3	A24 V27 T50 F51 N56 N57 V58 F95	A24-H54 PolarHBondContact N-CD2 3Å; V27-H54 HydrophobicContact CG2-CB 3.37Å; T50-H54 PolarHBondContact O-N 2.99Å; T50-H54 VanDerWaalsContact O-N 3.09Å; F51-H54 PolarHBondContact O-N 3.3Å; H54-N56 VanDerWaalsContact C-N 3.32Å; H54-N56 PolarHBondContact O-N 3.28Å; H54-N57 WeakPolarHBondContact O-CA 3.41Å; H54-N57 VanDerWaalsContact O-CB 3.27Å; H54-N57 WeakPolarHBondContact O-CB 3.39Å; H54-N57 PolarHBondContact O-N 3Å; H54-V58 VanDerWaalsContact CE1-CG2 3.47Å; H54-V58 WeakPolarHBondContact CE1-CG2 3.24Å; H54-V58 PolarHBondContact O-N 3.41Å; H54-F95 HydrophobicContact CB-CE2 4.11Å
55	Q	98.6	Very high	98.4	Very high	67 Å²	67	51.8 Å²	51.8	31%	0.313	26%	0.258	S	S	.	.	H	α-helix	trans	-55.6	-45.4	177.8	-85.5	-69.5	-15.9	0	0	112.3	F51 R52 N57 V58 E59	F51-Q55 HydrophobicContact CD1-CG 4.24Å; F51-Q55 HydrophobicContact CE1-CG 3.75Å; F51-Q55 HydrophobicContact CE2-CG 4.5Å; F51-Q55 HydrophobicContact CZ-CG 3.89Å; F51-Q55 PolarHBondContact O-N 3.42Å; R52-Q55 PolarHBondContact O-N 3.35Å; Q55-N57 PolarHBondContact O-N 2.99Å; Q55-V58 WeakPolarHBondContact O-CA 3.26Å; Q55-V58 WeakPolarHBondContact O-CB 3.48Å; Q55-V58 PolarHBondContact O-N 3.29Å; Q55-E59 WeakPolarHBondContact O-CG 3.48Å; Q55-E59 PolarHBondContact O-N 3.49Å
56	N	98.6	Very high	98.4	Very high	29 Å²	29	52 Å²	52	16%	0.155	26%	0.258	C	S	.	.	H	α-helix	trans	-63.8	-29.1	175.9	-175.8	-101	0	0	0	113.1	R52 H54 L60 R91 Y94	R52-N56 PolarHBondContact O-N 3.49Å; H54-N56 VanDerWaalsContact C-N 3.32Å; H54-N56 PolarHBondContact O-N 3.28Å; N56-L60 PolarHBondContact O-N 3.35Å; N56-R91 PolarHBondContact O-NH2 2.94Å; N56-R91 PolarHBondContact OD1-NH1 3.42Å; N56-R91 PolarHBondContact OD1-NH2 3.49Å; N56-Y94 HydrophobicContact CB-CE1 4.05Å; N56-Y94 WeakPolarHBondContact OD1-CE1 3.42Å; N56-Y94 PolarHBondContact OD1-OH 3.11Å
57	N	98.1	Very high	98.5	Very high	0 Å²	0	47.5 Å²	47.5	0%	0	24%	0.237	C	C	.	.	H	α-helix	trans	-66.9	-42.7	171.3	-80.7	-89.1	0	0	0	110.9	M20 L23 A53 H54 Q55 L60 Y61 R91	M20-N57 HydrophobicContact CE-CB 4.02Å; M20-N57 HydrophobicContact SD-CB 3.87Å; L23-N57 HydrophobicContact CD1-CB 3.96Å; L23-N57 WeakPolarHBondContact CD1-OD1 3.19Å; A53-N57 PolarHBondContact O-N 2.91Å; A53-N57 PolarHBondContact O-ND2 2.92Å; H54-N57 WeakPolarHBondContact O-CA 3.41Å; H54-N57 VanDerWaalsContact O-CB 3.27Å; H54-N57 WeakPolarHBondContact O-CB 3.39Å; H54-N57 PolarHBondContact O-N 3Å; Q55-N57 PolarHBondContact O-N 2.99Å; N57-L60 PolarHBondContact O-N 3.17Å; N57-Y61 WeakPolarHBondContact O-CB 3.45Å; N57-Y61 PolarHBondContact O-N 3.03Å; N57-R91 PolarHBondContact ND2-NH2 3.38Å; N57-R91 WeakPolarHBondContact OD1-CB 3.25Å; N57-R91 PolarHBondContact OD1-NE 3.22Å; N57-R91 PolarHBondContact OD1-NH2 3.36Å
58	V	98.6	Very high	98.5	Very high	60 Å²	60	47.5 Å²	47.5	36%	0.364	24%	0.237	S	C	.	.	H	α-helix	trans	-62.3	-43.9	177.9	174.7	0	0	0	0	111	M20 H54 Q55 L60 Y61 P62	M20-V58 HydrophobicContact CE-CB 4.25Å; M20-V58 HydrophobicContact CE-CG2 3.53Å; H54-V58 VanDerWaalsContact CE1-CG2 3.47Å; H54-V58 WeakPolarHBondContact CE1-CG2 3.24Å; H54-V58 PolarHBondContact O-N 3.41Å; Q55-V58 WeakPolarHBondContact O-CA 3.26Å; Q55-V58 WeakPolarHBondContact O-CB 3.48Å; Q55-V58 PolarHBondContact O-N 3.29Å; V58-L60 VanDerWaalsContact C-N 3.34Å; V58-L60 PolarHBondContact O-N 3.5Å; V58-Y61 PolarHBondContact O-N 3.43Å; V58-P62 WeakPolarHBondContact O-CD 3.36Å
59	E	98.4	Very high	98.5	Very high	118 Å²	118	48.2 Å²	48.2	55%	0.551	24%	0.237	S	C	*	.	H	α-helix	trans	-61.9	-38	179.7	-70.1	165.5	-179.2	0	0	112.9	Q55	Q55-E59 WeakPolarHBondContact O-CG 3.48Å; Q55-E59 PolarHBondContact O-N 3.49Å
60	L	98.1	Very high	98.5	Very high	33 Å²	33	47.6 Å²	47.6	17%	0.173	24%	0.239	C	C	.	.	H	α-helix	trans	-88.7	-17.6	-178	-75.3	170.7	0	0	0	114	N56 N57 V58 V63 F64 T112 L116	N56-L60 PolarHBondContact O-N 3.35Å; N57-L60 PolarHBondContact O-N 3.17Å; V58-L60 VanDerWaalsContact C-N 3.34Å; V58-L60 PolarHBondContact O-N 3.5Å; L60-V63 WeakPolarHBondContact O-CB 3.39Å; L60-V63 PolarHBondContact O-N 3.33Å; L60-F64 PolarHBondContact O-N 3.1Å; L60-T112 HydrophobicContact CD1-CG2 4.24Å; L60-L116 HydrophobicContact CD2-CD1 4.04Å
61	Y	98.7	Very high	98.5	Very high	42 Å²	42	47 Å²	47	17%	0.165	24%	0.235	C	C	.	.	H	α-helix	trans	-60.2	-42.5	-176	-168.8	-117.9	0	0	0	113.9	S16 A17 M20 N57 V58 V63 F64 L65	S16-Y61 WeakPolarHBondContact OG-CE2 3.43Å; S16-Y61 PolarHBondContact OG-OH 3.37Å; A17-Y61 WeakPolarHBondContact CA-OH 3.41Å; A17-Y61 PolarHBondContact N-OH 3.3Å; M20-Y61 HydrophobicContact CG-CD1 4.23Å; M20-Y61 HydrophobicContact CG-CD2 3.85Å; M20-Y61 HydrophobicContact CG-CE1 4.25Å; M20-Y61 HydrophobicContact CG-CE2 3.91Å; M20-Y61 HydrophobicContact CG-CG 4.03Å; M20-Y61 HydrophobicContact SD-CD2 4.13Å; M20-Y61 HydrophobicContact SD-CG 4.22Å; N57-Y61 WeakPolarHBondContact O-CB 3.45Å; N57-Y61 PolarHBondContact O-N 3.03Å; V58-Y61 PolarHBondContact O-N 3.43Å; Y61-V63 PolarHBondContact O-N 2.72Å; Y61-F64 AromaticContact CD2-CD1 3.98Å; Y61-F64 HydrophobicContact CD2-CD1 3.98Å; Y61-F64 AromaticContact CE2-CD1 3.93Å; Y61-F64 HydrophobicContact CE2-CD1 3.93Å; Y61-F64 HydrophobicContact CE2-CE1 4.2Å; Y61-F64 WeakPolarHBondContact O-CB 3.4Å; Y61-F64 PolarHBondContact O-N 3.23Å; Y61-L65 HydrophobicContact CD1-CD1 4.06Å; Y61-L65 HydrophobicContact CE1-CD1 3.66Å; Y61-L65 HydrophobicContact CE1-CG 4.23Å; Y61-L65 HydrophobicContact CE2-CD2 4.43Å; Y61-L65 HydrophobicContact CE2-CG 4.43Å; Y61-L65 WeakPolarHBondContact O-CG 3.37Å; Y61-L65 PolarHBondContact O-N 3.02Å
62	P	98.7	Very high	98.5	Very high	76 Å²	76	46 Å²	46	49%	0.494	23%	0.233	S	C	.	.	H	α-helix	trans	-62.3	-41.1	174.5	-23.7	34.4	0	0	0	113	V58 F64 L65 V66	V58-P62 WeakPolarHBondContact O-CD 3.36Å; P62-F64 VanDerWaalsContact C-N 3.32Å; P62-F64 PolarHBondContact O-N 3.46Å; P62-L65 PolarHBondContact O-N 3Å; P62-V66 WeakPolarHBondContact O-CG2 3.44Å; P62-V66 PolarHBondContact O-N 3.47Å
63	V	98.6	Very high	98.4	Very high	69 Å²	69	43.9 Å²	43.9	42%	0.418	23%	0.233	S	C	.	.	H	α-helix	trans	-60.3	-47	177.6	-179.3	0	0	0	0	109.8	L60 Y61 V66 V67	L60-V63 WeakPolarHBondContact O-CB 3.39Å; L60-V63 PolarHBondContact O-N 3.33Å; Y61-V63 PolarHBondContact O-N 2.72Å; V63-V66 PolarHBondContact O-N 2.96Å; V63-V67 WeakPolarHBondContact O-CG2 3.31Å; V63-V67 PolarHBondContact O-N 3.33Å; V63-V67 VanDerWaalsContact O-N 3.1Å
64	F	98.8	Very high	98.2	Very high	0 Å²	0	48.1 Å²	48.1	0%	0	26%	0.255	C	S	.	.	H	α-helix	trans	-56.2	-50.2	175.6	163.8	-113.6	0	0	0	112.5	V12 L60 Y61 P62 V66 V67 L68 Y87 L116 L119	V12-F64 HydrophobicContact CG1-CZ 4.13Å; L60-F64 PolarHBondContact O-N 3.1Å; Y61-F64 AromaticContact CD2-CD1 3.98Å; Y61-F64 HydrophobicContact CD2-CD1 3.98Å; Y61-F64 AromaticContact CE2-CD1 3.93Å; Y61-F64 HydrophobicContact CE2-CD1 3.93Å; Y61-F64 HydrophobicContact CE2-CE1 4.2Å; Y61-F64 WeakPolarHBondContact O-CB 3.4Å; Y61-F64 PolarHBondContact O-N 3.23Å; P62-F64 VanDerWaalsContact C-N 3.32Å; P62-F64 PolarHBondContact O-N 3.46Å; F64-V66 VanDerWaalsContact C-N 3.34Å; F64-V66 PolarHBondContact O-N 3.41Å; F64-V67 WeakPolarHBondContact O-CG2 3.45Å; F64-V67 PolarHBondContact O-N 2.86Å; F64-L68 HydrophobicContact CD2-CB 4.44Å; F64-L68 HydrophobicContact CE1-CD2 4.22Å; F64-L68 HydrophobicContact CE2-CB 4.04Å; F64-L68 HydrophobicContact CE2-CD1 4.34Å; F64-L68 HydrophobicContact CE2-CD2 4.21Å; F64-L68 HydrophobicContact CE2-CG 4.42Å; F64-L68 HydrophobicContact CZ-CB 4.36Å; F64-L68 HydrophobicContact CZ-CD1 4.5Å; F64-L68 HydrophobicContact CZ-CD2 3.71Å; F64-L68 HydrophobicContact CZ-CG 4.41Å; F64-L68 VanDerWaalsContact O-CB 3.23Å; F64-L68 WeakPolarHBondContact O-CB 3.41Å; F64-L68 PolarHBondContact O-N 2.94Å; F64-Y87 HydrophobicContact CB-CD1 4.25Å; F64-Y87 HydrophobicContact CB-CD2 4.38Å; F64-Y87 HydrophobicContact CB-CE1 3.7Å; F64-Y87 HydrophobicContact CB-CE2 3.83Å; F64-Y87 VanDerWaalsContact CB-CZ 3.47Å; F64-Y87 AromaticContact CD1-CD1 3.86Å; F64-Y87 HydrophobicContact CD1-CD1 3.86Å; F64-Y87 AromaticContact CD1-CE1 3.53Å; F64-Y87 HydrophobicContact CD1-CE1 3.53Å; F64-Y87 AromaticContact CD2-CD1 3.37Å; F64-Y87 HydrophobicContact CD2-CD1 3.37Å; F64-Y87 AromaticContact CD2-CD2 3.98Å; F64-Y87 HydrophobicContact CD2-CD2 3.98Å; F64-Y87 AromaticContact CD2-CE1 3.71Å; F64-Y87 HydrophobicContact CD2-CE1 3.71Å; F64-Y87 HydrophobicContact CD2-CE2 4.26Å; F64-Y87 AromaticContact CD2-CG 3.53Å; F64-Y87 HydrophobicContact CD2-CG 3.53Å; F64-Y87 AromaticContact CE1-CD1 3.99Å; F64-Y87 HydrophobicContact CE1-CD1 3.99Å; F64-Y87 HydrophobicContact CE1-CE1 4.04Å; F64-Y87 AromaticContact CE2-CD1 3.55Å; F64-Y87 HydrophobicContact CE2-CD1 3.55Å; F64-Y87 HydrophobicContact CE2-CE1 4.23Å; F64-Y87 AromaticContact CE2-CG 3.83Å; F64-Y87 HydrophobicContact CE2-CG 3.83Å; F64-Y87 AromaticContact CG-CD1 3.52Å; F64-Y87 HydrophobicContact CG-CD1 3.52Å; F64-Y87 HydrophobicContact CG-CD2 4.32Å; F64-Y87 AromaticContact CG-CE1 3.32Å; F64-Y87 HydrophobicContact CG-CE1 3.32Å; F64-Y87 HydrophobicContact CG-CE2 4.15Å; F64-Y87 HydrophobicContact CG-CG 4.04Å; F64-Y87 AromaticContact CG-CZ 3.67Å; F64-Y87 AromaticContact CZ-CD1 3.83Å; F64-Y87 HydrophobicContact CZ-CD1 3.83Å; F64-Y87 HydrophobicContact CZ-CE1 4.35Å; F64-L116 HydrophobicContact CB-CD2 4.05Å; F64-L119 HydrophobicContact CD2-CD1 4.27Å; F64-L119 HydrophobicContact CE2-CD1 4.28Å
65	L	98.7	Very high	98.1	Very high	48 Å²	48	51.2 Å²	51.2	25%	0.251	27%	0.268	S	S	.	.	H	α-helix	trans	-60.8	-43.7	-179.5	-71.2	178.1	0	0	0	111.7	Y61 P62 V67 L68 W69	Y61-L65 HydrophobicContact CD1-CD1 4.06Å; Y61-L65 HydrophobicContact CE1-CD1 3.66Å; Y61-L65 HydrophobicContact CE1-CG 4.23Å; Y61-L65 HydrophobicContact CE2-CD2 4.43Å; Y61-L65 HydrophobicContact CE2-CG 4.43Å; Y61-L65 WeakPolarHBondContact O-CG 3.37Å; Y61-L65 PolarHBondContact O-N 3.02Å; P62-L65 PolarHBondContact O-N 3Å; L65-V67 PolarHBondContact O-N 3.17Å; L65-L68 PolarHBondContact O-N 3.31Å; L65-W69 WeakPolarHBondContact O-CB 3.35Å; L65-W69 VanDerWaalsContact O-CD1 3.25Å; L65-W69 PolarHBondContact O-N 3.36Å
66	V	98.7	Very high	98	Very high	93 Å²	93	49.7 Å²	49.7	56%	0.564	27%	0.265	S	S	*	.	H	α-helix	trans	-59.1	-50.4	178.1	170.5	0	0	0	0	110.9	P62 V63 F64 T70	P62-V66 WeakPolarHBondContact O-CG2 3.44Å; P62-V66 PolarHBondContact O-N 3.47Å; V63-V66 PolarHBondContact O-N 2.96Å; F64-V66 VanDerWaalsContact C-N 3.34Å; F64-V66 PolarHBondContact O-N 3.41Å; V66-T70 VanDerWaalsContact O-CB 3.25Å; V66-T70 WeakPolarHBondContact O-CB 3.4Å; V66-T70 PolarHBondContact O-N 2.67Å; V66-T70 PolarHBondContact O-OG1 3.43Å
67	V	98.8	Very high	97.9	Very high	15 Å²	15	50.4 Å²	50.4	9%	0.091	27%	0.268	C	S	.	.	H	α-helix	trans	-73.8	-30.7	-176.9	-57.8	0	0	0	0	112.8	V63 F64 L65 S71 L116 L119 S123	V63-V67 WeakPolarHBondContact O-CG2 3.31Å; V63-V67 PolarHBondContact O-N 3.33Å; V63-V67 VanDerWaalsContact O-N 3.1Å; F64-V67 WeakPolarHBondContact O-CG2 3.45Å; F64-V67 PolarHBondContact O-N 2.86Å; L65-V67 PolarHBondContact O-N 3.17Å; V67-S71 VanDerWaalsContact O-CB 3.28Å; V67-S71 WeakPolarHBondContact O-CB 3.43Å; V67-S71 PolarHBondContact O-N 2.87Å; V67-S71 PolarHBondContact O-OG 3.46Å; V67-L116 HydrophobicContact CG2-CD2 3.98Å; V67-L119 HydrophobicContact CB-CB 3.88Å; V67-L119 HydrophobicContact CG2-CB 3.6Å; V67-L119 HydrophobicContact CG2-CD1 3.93Å; V67-L119 HydrophobicContact CG2-CG 4.42Å; V67-S123 PolarHBondContact O-OG 3.34Å; V67-S123 VanDerWaalsContact O-OG 3.14Å
68	L	98.8	Very high	97.8	Very high	0 Å²	0	54.8 Å²	54.8	0%	0	29%	0.294	C	S	.	.	H	α-helix	trans	-62.4	-52.8	174.1	176.3	70.5	0	0	0	110.7	L9 V12 F64 L65 S71 G72 A80	L9-L68 HydrophobicContact CD2-CD1 4.14Å; L9-L68 HydrophobicContact CD2-CG 4.31Å; V12-L68 HydrophobicContact CB-CD2 4.43Å; V12-L68 HydrophobicContact CG1-CD1 4.31Å; V12-L68 HydrophobicContact CG1-CD2 3.9Å; F64-L68 HydrophobicContact CD2-CB 4.44Å; F64-L68 HydrophobicContact CE1-CD2 4.22Å; F64-L68 HydrophobicContact CE2-CB 4.04Å; F64-L68 HydrophobicContact CE2-CD1 4.34Å; F64-L68 HydrophobicContact CE2-CD2 4.21Å; F64-L68 HydrophobicContact CE2-CG 4.42Å; F64-L68 HydrophobicContact CZ-CB 4.36Å; F64-L68 HydrophobicContact CZ-CD1 4.5Å; F64-L68 HydrophobicContact CZ-CD2 3.71Å; F64-L68 HydrophobicContact CZ-CG 4.41Å; F64-L68 VanDerWaalsContact O-CB 3.23Å; F64-L68 WeakPolarHBondContact O-CB 3.41Å; F64-L68 PolarHBondContact O-N 2.94Å; L65-L68 PolarHBondContact O-N 3.31Å; L68-S71 PolarHBondContact O-OG 2.91Å; L68-S71 VanDerWaalsContact O-OG 3.12Å; L68-G72 PolarHBondContact O-N 3.25Å; L68-A80 HydrophobicContact CD1-CB 4.31Å; L68-A80 VanDerWaalsContact CD1-O 3.31Å; L68-A80 WeakPolarHBondContact CD1-O 3.39Å
69	W	98.6	Very high	97.8	Very high	90 Å²	90	55 Å²	55	34%	0.341	29%	0.293	S	S	.	.	H	α-helix	trans	-69.9	-41.2	-177.1	-80.4	87.5	0	0	0	111.7	P6 L9 S13 L65 G72 L73	P6-W69 HydrophobicContact CG-CH2 4.3Å; P6-W69 HydrophobicContact CG-CZ3 3.85Å; L9-W69 HydrophobicContact CB-CH2 4.46Å; L9-W69 HydrophobicContact CB-CZ2 4.45Å; L9-W69 HydrophobicContact CD1-CE3 4.14Å; L9-W69 HydrophobicContact CD1-CZ3 4.44Å; S13-W69 PolarHBondContact OG-NE1 3.44Å; S13-W69 VanDerWaalsContact OG-NE1 3.07Å; L65-W69 WeakPolarHBondContact O-CB 3.35Å; L65-W69 VanDerWaalsContact O-CD1 3.25Å; L65-W69 PolarHBondContact O-N 3.36Å; W69-G72 PolarHBondContact O-N 3Å; W69-L73 HydrophobicContact CE3-CD1 4.02Å; W69-L73 HydrophobicContact CE3-CD2 4.49Å; W69-L73 HydrophobicContact CE3-CG 4.24Å; W69-L73 VanDerWaalsContact O-CB 3.31Å; W69-L73 WeakPolarHBondContact O-CB 3.4Å; W69-L73 VanDerWaalsContact O-CG 3.25Å; W69-L73 WeakPolarHBondContact O-CG 3.49Å; W69-L73 PolarHBondContact O-N 3.32Å
70	T	98.4	Very high	97.8	Very high	37 Å²	37	49.4 Å²	49.4	23%	0.227	27%	0.267	C	S	.	.	H	α-helix	trans	-63.4	-46.6	178.6	-53.4	0	0	0	0	111.3	V66 L74 I127	V66-T70 VanDerWaalsContact O-CB 3.25Å; V66-T70 WeakPolarHBondContact O-CB 3.4Å; V66-T70 PolarHBondContact O-N 2.67Å; V66-T70 PolarHBondContact O-OG1 3.43Å; T70-L74 HydrophobicContact CG2-CD1 3.81Å; T70-L74 HydrophobicContact CG2-CG 4.49Å; T70-L74 VanDerWaalsContact O-CB 3.27Å; T70-L74 WeakPolarHBondContact O-CB 3.3Å; T70-L74 WeakPolarHBondContact O-CG 3.24Å; T70-L74 PolarHBondContact O-N 3.46Å; T70-I127 HydrophobicContact CG2-CD1 3.88Å; T70-I127 HydrophobicContact CG2-CG1 4.16Å
71	S	98	Very high	97.8	Very high	0 Å²	0	49 Å²	49	0%	0	27%	0.266	C	S	.	.	H	α-helix	trans	-67.2	-37.7	176.6	57.1	0	0	0	0	113	V67 L68 F75 S76 A80 L119 S123	V67-S71 VanDerWaalsContact O-CB 3.28Å; V67-S71 WeakPolarHBondContact O-CB 3.43Å; V67-S71 PolarHBondContact O-N 2.87Å; V67-S71 PolarHBondContact O-OG 3.46Å; L68-S71 PolarHBondContact O-OG 2.91Å; L68-S71 VanDerWaalsContact O-OG 3.12Å; S71-F75 WeakPolarHBondContact O-CA 3.4Å; S71-F75 WeakPolarHBondContact O-CB 3.28Å; S71-F75 PolarHBondContact O-N 2.73Å; S71-S76 PolarHBondContact O-N 3.46Å; S71-A80 WeakPolarHBondContact OG-CB 3.32Å; S71-L119 WeakPolarHBondContact OG-CD2 3.31Å; S71-S123 PolarHBondContact N-OG 2.97Å
72	G	97.3	Very high	97.8	Very high	9 Å²	9	51.9 Å²	51.9	9%	0.093	28%	0.283	C	S	.	.	H	α-helix	trans	-68.9	-41.8	-179.6	0	0	0	0	0	113.2	L68 W69 E77 A80	L68-G72 PolarHBondContact O-N 3.25Å; W69-G72 PolarHBondContact O-N 3Å; G72-E77 PolarHBondContact O-N 2.96Å; G72-A80 VanDerWaalsContact CA-CB 3.46Å
73	L	96.3	Very high	97.8	Very high	108 Å²	108	48.5 Å²	48.5	57%	0.565	26%	0.262	S	S	*	.	H	α-helix	trans	-79.9	-36.9	-178.9	-65.9	178	0	0	0	113.3	P6 L9 W69	P6-L73 HydrophobicContact CB-CD2 4.42Å; P6-L73 HydrophobicContact CG-CD2 4.21Å; L9-L73 HydrophobicContact CD1-CD2 4.4Å; L9-L73 HydrophobicContact CD1-CG 4.44Å; W69-L73 HydrophobicContact CE3-CD1 4.02Å; W69-L73 HydrophobicContact CE3-CD2 4.49Å; W69-L73 HydrophobicContact CE3-CG 4.24Å; W69-L73 VanDerWaalsContact O-CB 3.31Å; W69-L73 WeakPolarHBondContact O-CB 3.4Å; W69-L73 VanDerWaalsContact O-CG 3.25Å; W69-L73 WeakPolarHBondContact O-CG 3.49Å; W69-L73 PolarHBondContact O-N 3.32Å
74	L	95.5	Very high	97.8	Very high	89 Å²	89	45.2 Å²	45.2	47%	0.466	24%	0.242	S	C	.	.	H	α-helix	trans	-102.8	-10.6	-171.2	-54.9	-176.8	0	0	0	114.1	T70 G126 I127	T70-L74 HydrophobicContact CG2-CD1 3.81Å; T70-L74 HydrophobicContact CG2-CG 4.49Å; T70-L74 VanDerWaalsContact O-CB 3.27Å; T70-L74 WeakPolarHBondContact O-CB 3.3Å; T70-L74 WeakPolarHBondContact O-CG 3.24Å; T70-L74 PolarHBondContact O-N 3.46Å; L74-G126 WeakPolarHBondContact O-CA 2.93Å; L74-I127 HydrophobicContact CD1-CG1 3.6Å
75	F	95.9	Very high	97.8	Very high	92 Å²	92	48.7 Å²	48.7	40%	0.404	26%	0.263	S	S	.	.	T	Hydrogen-bonded Turn	trans	-131	-69.6	-178.9	-172.2	-97.2	0	0	0	113.2	S71 L79 L122 I125	S71-F75 WeakPolarHBondContact O-CA 3.4Å; S71-F75 WeakPolarHBondContact O-CB 3.28Å; S71-F75 PolarHBondContact O-N 2.73Å; F75-L79 HydrophobicContact CD1-CD1 4.34Å; F75-L79 HydrophobicContact CE1-CD1 3.72Å; F75-L122 HydrophobicContact CB-CB 4.46Å; F75-L122 HydrophobicContact CD1-CB 4.05Å; F75-L122 HydrophobicContact CD1-CD1 4.15Å; F75-L122 HydrophobicContact CD1-CD2 3.82Å; F75-L122 HydrophobicContact CD1-CG 4.21Å; F75-L122 HydrophobicContact CE1-CD1 4.5Å; F75-L122 HydrophobicContact CE1-CD2 3.6Å; F75-L122 HydrophobicContact CE1-CG 4.45Å; F75-L122 HydrophobicContact CG-CB 4.32Å; F75-L122 HydrophobicContact CZ-CD2 4.24Å; F75-I125 HydrophobicContact CD2-CB 4.2Å; F75-I125 HydrophobicContact CD2-CG2 3.83Å; F75-I125 HydrophobicContact CE2-CB 4.22Å; F75-I125 HydrophobicContact CE2-CG2 3.58Å
76	S	96.1	Very high	97.8	Very high	35 Å²	35	49.4 Å²	49.4	25%	0.245	27%	0.269	C	S	.	.			trans	-161.3	117.5	-178.3	177.1	0	0	0	0	111.5	S71 V78 L79 A80	S71-S76 PolarHBondContact O-N 3.46Å; S76-V78 VanDerWaalsContact C-N 3.32Å; S76-V78 PolarHBondContact O-N 3.14Å; S76-L79 PolarHBondContact O-N 3.44Å; S76-L79 PolarHBondContact OG-N 2.81Å; S76-A80 WeakPolarHBondContact O-CB 3.47Å; S76-A80 PolarHBondContact O-N 3.05Å
77	E	96.3	Very high	97.8	Very high	45 Å²	45	45 Å²	45	21%	0.21	24%	0.243	C	C	.	.	H	α-helix	trans	-57.4	-43.8	176	175.7	168.1	-153	0	0	112	P6 V7 L8 L9 G72 A80 V81	P6-E77 WeakPolarHBondContact CA-OE1 3.16Å; V7-E77 PolarHBondContact N-OE1 3.44Å; L8-E77 WeakPolarHBondContact CA-OE1 3.48Å; L8-E77 HydrophobicContact CB-CG 4.09Å; L8-E77 VanDerWaalsContact CB-OE1 3.3Å; L8-E77 WeakPolarHBondContact CB-OE1 3.39Å; L8-E77 HydrophobicContact CD1-CG 4.41Å; L8-E77 PolarHBondContact N-OE1 3.47Å; L9-E77 HydrophobicContact CD2-CG 4.2Å; L9-E77 HydrophobicContact CG-CG 4Å; L9-E77 PolarHBondContact N-OE1 3.41Å; G72-E77 PolarHBondContact O-N 2.96Å; E77-A80 PolarHBondContact O-N 3.15Å; E77-V81 HydrophobicContact CG-CG2 4.39Å; E77-V81 WeakPolarHBondContact O-CB 3.44Å; E77-V81 WeakPolarHBondContact O-CG2 3.31Å; E77-V81 PolarHBondContact O-N 2.95Å
78	V	96.7	Very high	97.8	Very high	91 Å²	91	46 Å²	46	55%	0.552	25%	0.247	S	C	*	.	H	α-helix	trans	-62.5	-47.8	-178	177.2	0	0	0	0	111.4	S76 V81 L82	S76-V78 VanDerWaalsContact C-N 3.32Å; S76-V78 PolarHBondContact O-N 3.14Å; V78-V81 PolarHBondContact O-N 3.41Å; V78-L82 HydrophobicContact CG1-CD1 4.47Å; V78-L82 WeakPolarHBondContact O-CG 3.34Å; V78-L82 PolarHBondContact O-N 3.07Å
79	L	98	Very high	97.8	Very high	65 Å²	65	49.7 Å²	49.7	34%	0.34	27%	0.269	S	S	.	.	H	α-helix	trans	-68.7	-36.6	179.7	-66	175	0	0	0	111.8	F75 S76 L82 G83 F118 L122	F75-L79 HydrophobicContact CD1-CD1 4.34Å; F75-L79 HydrophobicContact CE1-CD1 3.72Å; S76-L79 PolarHBondContact O-N 3.44Å; S76-L79 PolarHBondContact OG-N 2.81Å; L79-L82 HydrophobicContact CD2-CD1 4.37Å; L79-L82 PolarHBondContact O-N 2.93Å; L79-G83 PolarHBondContact O-N 2.94Å; L79-F118 HydrophobicContact CB-CZ 4.43Å; L79-L122 HydrophobicContact CB-CD1 3.75Å
80	A	98.3	Very high	97.8	Very high	0 Å²	0	45.4 Å²	45.4	0%	0	25%	0.253	C	S	.	.	H	α-helix	trans	-62.3	-43	174	0	0	0	0	0	111.7	L9 L68 S71 G72 S76 E77 G83 G84 L119	L9-A80 HydrophobicContact CD2-CB 3.89Å; L68-A80 HydrophobicContact CD1-CB 4.31Å; L68-A80 VanDerWaalsContact CD1-O 3.31Å; L68-A80 WeakPolarHBondContact CD1-O 3.39Å; S71-A80 WeakPolarHBondContact OG-CB 3.32Å; G72-A80 VanDerWaalsContact CA-CB 3.46Å; S76-A80 WeakPolarHBondContact O-CB 3.47Å; S76-A80 PolarHBondContact O-N 3.05Å; E77-A80 PolarHBondContact O-N 3.15Å; A80-G83 PolarHBondContact O-N 2.95Å; A80-G84 PolarHBondContact O-N 3.41Å; A80-L119 HydrophobicContact CB-CD2 4.36Å
81	V	98.3	Very high	97.8	Very high	25 Å²	25	43.7 Å²	43.7	15%	0.152	24%	0.242	C	C	.	.	H	α-helix	trans	-62.6	-44.8	175	163.4	0	0	0	0	111.9	L8 L9 V12 E77 V78 G83 G84 V85	L8-V81 HydrophobicContact CB-CG2 3.48Å; L8-V81 VanDerWaalsContact CB-CG2 3.48Å; L9-V81 HydrophobicContact CD2-CG2 4.04Å; V12-V81 HydrophobicContact CG2-CB 4.26Å; V12-V81 HydrophobicContact CG2-CG1 3.87Å; V12-V81 HydrophobicContact CG2-CG2 3.96Å; E77-V81 HydrophobicContact CG-CG2 4.39Å; E77-V81 WeakPolarHBondContact O-CB 3.44Å; E77-V81 WeakPolarHBondContact O-CG2 3.31Å; E77-V81 PolarHBondContact O-N 2.95Å; V78-V81 PolarHBondContact O-N 3.41Å; V81-G83 PolarHBondContact O-N 2.75Å; V81-G84 PolarHBondContact O-N 3.36Å; V81-G84 VanDerWaalsContact O-N 3.16Å; V81-V85 HydrophobicContact CG1-CG2 4.46Å; V81-V85 WeakPolarHBondContact O-CG2 3.25Å; V81-V85 PolarHBondContact O-N 2.96Å
82	L	98.4	Very high	97.8	Very high	103 Å²	103	47.5 Å²	47.5	54%	0.539	26%	0.26	S	S	.	.	H	α-helix	trans	-59	-47.5	175.6	-70.5	174.5	0	0	0	111.2	V78 L79 G84 V85 V86	V78-L82 HydrophobicContact CG1-CD1 4.47Å; V78-L82 WeakPolarHBondContact O-CG 3.34Å; V78-L82 PolarHBondContact O-N 3.07Å; L79-L82 HydrophobicContact CD2-CD1 4.37Å; L79-L82 PolarHBondContact O-N 2.93Å; L82-G84 VanDerWaalsContact C-N 3.3Å; L82-G84 PolarHBondContact O-N 2.88Å; L82-V85 PolarHBondContact O-N 2.79Å; L82-V86 WeakPolarHBondContact O-CG2 3.5Å; L82-V86 PolarHBondContact O-N 3.18Å
83	G	98.7	Very high	97.9	Very high	5 Å²	5	51.2 Å²	51.2	5%	0.052	28%	0.276	C	S	.	.	H	α-helix	trans	-61.1	-38.3	175.1	0	0	0	0	0	112.8	L79 A80 V81 V86 Y87	L79-G83 PolarHBondContact O-N 2.94Å; A80-G83 PolarHBondContact O-N 2.95Å; V81-G83 PolarHBondContact O-N 2.75Å; G83-V86 PolarHBondContact O-N 3.25Å; G83-Y87 WeakPolarHBondContact O-CB 3.23Å; G83-Y87 PolarHBondContact O-N 3.22Å
84	G	98.8	Very high	98	Very high	0 Å²	0	46.3 Å²	46.3	0%	0	25%	0.25	C	C	.	.	H	α-helix	trans	-69.2	-39.7	178.3	0	0	0	0	0	114.1	A80 V81 L82 Y87 M88	A80-G84 PolarHBondContact O-N 3.41Å; V81-G84 PolarHBondContact O-N 3.36Å; V81-G84 VanDerWaalsContact O-N 3.16Å; L82-G84 VanDerWaalsContact C-N 3.3Å; L82-G84 PolarHBondContact O-N 2.88Å; G84-Y87 WeakPolarHBondContact O-CB 3.4Å; G84-Y87 PolarHBondContact O-N 2.9Å; G84-M88 WeakPolarHBondContact O-CG 3.43Å; G84-M88 PolarHBondContact O-N 2.71Å
85	V	98.8	Very high	98.1	Very high	73 Å²	73	42.3 Å²	42.3	44%	0.442	23%	0.229	S	C	.	.	H	α-helix	trans	-63.8	-44.2	172.6	171.9	0	0	0	0	110.5	V12 V81 L82 Y87 M88 V89	V12-V85 HydrophobicContact CG2-CG2 4.41Å; V81-V85 HydrophobicContact CG1-CG2 4.46Å; V81-V85 WeakPolarHBondContact O-CG2 3.25Å; V81-V85 PolarHBondContact O-N 2.96Å; L82-V85 PolarHBondContact O-N 2.79Å; V85-Y87 VanDerWaalsContact C-N 3.33Å; V85-Y87 PolarHBondContact O-N 3.44Å; V85-M88 PolarHBondContact O-N 2.67Å; V85-V89 WeakPolarHBondContact O-CG2 3.27Å; V85-V89 PolarHBondContact O-N 3.04Å
86	V	98.8	Very high	98.2	Very high	62 Å²	62	40 Å²	40	38%	0.376	22%	0.224	S	C	.	.	H	α-helix	trans	-60.1	-43.6	175.2	173.7	0	0	0	0	110.9	L82 G83 M88 V89 A90 L111 A115	L82-V86 WeakPolarHBondContact O-CG2 3.5Å; L82-V86 PolarHBondContact O-N 3.18Å; G83-V86 PolarHBondContact O-N 3.25Å; V86-M88 PolarHBondContact O-N 2.97Å; V86-V89 PolarHBondContact O-N 2.95Å; V86-A90 WeakPolarHBondContact O-CB 3.5Å; V86-A90 PolarHBondContact O-N 3.5Å; V86-L111 HydrophobicContact CG1-CD1 3.97Å; V86-L111 HydrophobicContact CG1-CG 4.17Å; V86-A115 HydrophobicContact CG1-CB 4.15Å
87	Y	98.8	Very high	98.3	Very high	2 Å²	2	38.8 Å²	38.8	1%	0.008	22%	0.217	C	C	.	.	H	α-helix	trans	-56.6	-49.3	174.3	172.3	-91.9	0	0	0	111.6	F64 G83 G84 V85 V89 A90 R91 T112 L116	F64-Y87 HydrophobicContact CB-CD1 4.25Å; F64-Y87 HydrophobicContact CB-CD2 4.38Å; F64-Y87 HydrophobicContact CB-CE1 3.7Å; F64-Y87 HydrophobicContact CB-CE2 3.83Å; F64-Y87 VanDerWaalsContact CB-CZ 3.47Å; F64-Y87 AromaticContact CD1-CD1 3.86Å; F64-Y87 HydrophobicContact CD1-CD1 3.86Å; F64-Y87 AromaticContact CD1-CE1 3.53Å; F64-Y87 HydrophobicContact CD1-CE1 3.53Å; F64-Y87 AromaticContact CD2-CD1 3.37Å; F64-Y87 HydrophobicContact CD2-CD1 3.37Å; F64-Y87 AromaticContact CD2-CD2 3.98Å; F64-Y87 HydrophobicContact CD2-CD2 3.98Å; F64-Y87 AromaticContact CD2-CE1 3.71Å; F64-Y87 HydrophobicContact CD2-CE1 3.71Å; F64-Y87 HydrophobicContact CD2-CE2 4.26Å; F64-Y87 AromaticContact CD2-CG 3.53Å; F64-Y87 HydrophobicContact CD2-CG 3.53Å; F64-Y87 AromaticContact CE1-CD1 3.99Å; F64-Y87 HydrophobicContact CE1-CD1 3.99Å; F64-Y87 HydrophobicContact CE1-CE1 4.04Å; F64-Y87 AromaticContact CE2-CD1 3.55Å; F64-Y87 HydrophobicContact CE2-CD1 3.55Å; F64-Y87 HydrophobicContact CE2-CE1 4.23Å; F64-Y87 AromaticContact CE2-CG 3.83Å; F64-Y87 HydrophobicContact CE2-CG 3.83Å; F64-Y87 AromaticContact CG-CD1 3.52Å; F64-Y87 HydrophobicContact CG-CD1 3.52Å; F64-Y87 HydrophobicContact CG-CD2 4.32Å; F64-Y87 AromaticContact CG-CE1 3.32Å; F64-Y87 HydrophobicContact CG-CE1 3.32Å; F64-Y87 HydrophobicContact CG-CE2 4.15Å; F64-Y87 HydrophobicContact CG-CG 4.04Å; F64-Y87 AromaticContact CG-CZ 3.67Å; F64-Y87 AromaticContact CZ-CD1 3.83Å; F64-Y87 HydrophobicContact CZ-CD1 3.83Å; F64-Y87 HydrophobicContact CZ-CE1 4.35Å; G83-Y87 WeakPolarHBondContact O-CB 3.23Å; G83-Y87 PolarHBondContact O-N 3.22Å; G84-Y87 WeakPolarHBondContact O-CB 3.4Å; G84-Y87 PolarHBondContact O-N 2.9Å; V85-Y87 VanDerWaalsContact C-N 3.33Å; V85-Y87 PolarHBondContact O-N 3.44Å; Y87-V89 PolarHBondContact O-N 2.92Å; Y87-A90 WeakPolarHBondContact O-CB 3.4Å; Y87-A90 PolarHBondContact O-N 3.36Å; Y87-A90 VanDerWaalsContact O-N 3.15Å; Y87-R91 HydrophobicContact CD1-CG 3.96Å; Y87-R91 HydrophobicContact CD2-CG 4.31Å; Y87-R91 HydrophobicContact CE1-CG 3.47Å; Y87-R91 VanDerWaalsContact CE1-CG 3.47Å; Y87-R91 HydrophobicContact CE2-CG 3.87Å; Y87-R91 HydrophobicContact CG-CG 4.35Å; Y87-R91 VanDerWaalsContact CZ-CG 3.42Å; Y87-R91 WeakPolarHBondContact O-CG 3.26Å; Y87-R91 PolarHBondContact O-N 2.85Å; Y87-T112 HydrophobicContact CD2-CG2 3.88Å; Y87-T112 HydrophobicContact CE2-CG2 3.6Å; Y87-L116 HydrophobicContact CD2-CD2 3.86Å; Y87-L116 HydrophobicContact CD2-CG 4.04Å; Y87-L116 HydrophobicContact CE2-CD1 4.27Å; Y87-L116 HydrophobicContact CE2-CD2 3.83Å; Y87-L116 HydrophobicContact CE2-CG 4.07Å
88	M	98.8	Very high	98.4	Very high	36 Å²	36	37.9 Å²	37.9	18%	0.177	21%	0.212	C	C	.	.	H	α-helix	trans	-60.5	-44	179.8	-72.3	173.4	57.5	0	0	112.4	V12 F15 Q19 G84 V85 V86 A90 R91 H92	V12-M88 HydrophobicContact CG1-SD 4.21Å; F15-M88 HydrophobicContact CB-CE 3.65Å; F15-M88 HydrophobicContact CB-SD 4.34Å; Q19-M88 PolarHBondContact NE2-O 3.25Å; G84-M88 WeakPolarHBondContact O-CG 3.43Å; G84-M88 PolarHBondContact O-N 2.71Å; V85-M88 PolarHBondContact O-N 2.67Å; V86-M88 PolarHBondContact O-N 2.97Å; M88-A90 VanDerWaalsContact C-N 3.33Å; M88-A90 PolarHBondContact O-N 3.45Å; M88-R91 PolarHBondContact O-N 2.82Å; M88-H92 PolarHBondContact O-N 2.76Å
89	V	98.8	Very high	98.4	Very high	76 Å²	76	35.9 Å²	35.9	46%	0.461	20%	0.2	S	C	.	.	H	α-helix	trans	-60.8	-45.3	175.2	172.7	0	0	0	0	110.2	V85 V86 Y87 R91 H92 M93	V85-V89 WeakPolarHBondContact O-CG2 3.27Å; V85-V89 PolarHBondContact O-N 3.04Å; V86-V89 PolarHBondContact O-N 2.95Å; Y87-V89 PolarHBondContact O-N 2.92Å; V89-R91 VanDerWaalsContact C-N 3.34Å; V89-R91 PolarHBondContact O-N 3.35Å; V89-H92 PolarHBondContact O-N 3.17Å; V89-M93 HydrophobicContact CG1-CG 4.42Å; V89-M93 HydrophobicContact CG1-SD 3.94Å; V89-M93 WeakPolarHBondContact O-CG 3.48Å; V89-M93 PolarHBondContact O-N 2.91Å
90	A	98.7	Very high	98.3	Very high	0 Å²	0	38.7 Å²	38.7	0%	0	21%	0.213	C	C	.	.	H	α-helix	trans	-59.9	-42.3	177.6	0	0	0	0	0	112.6	V86 Y87 M88 M93 Y94 L111	V86-A90 WeakPolarHBondContact O-CB 3.5Å; V86-A90 PolarHBondContact O-N 3.5Å; Y87-A90 WeakPolarHBondContact O-CB 3.4Å; Y87-A90 PolarHBondContact O-N 3.36Å; Y87-A90 VanDerWaalsContact O-N 3.15Å; M88-A90 VanDerWaalsContact C-N 3.33Å; M88-A90 PolarHBondContact O-N 3.45Å; A90-M93 PolarHBondContact O-N 3.42Å; A90-Y94 VanDerWaalsContact O-CB 3.31Å; A90-Y94 WeakPolarHBondContact O-CB 3.38Å; A90-Y94 PolarHBondContact O-N 3.41Å; A90-L111 HydrophobicContact CB-CB 3.77Å; A90-L111 HydrophobicContact CB-CD2 3.77Å; A90-L111 HydrophobicContact CB-CG 3.64Å
91	R	98.5	Very high	98.3	Very high	1 Å²	1	40.5 Å²	40.5	0%	0.004	23%	0.225	C	C	.	.	H	α-helix	trans	-64.9	-39.9	176.8	-70	-41.9	-62	176.4	-3	112.2	N56 N57 Y87 M88 V89 Y94 F95	N56-R91 PolarHBondContact O-NH2 2.94Å; N56-R91 PolarHBondContact OD1-NH1 3.42Å; N56-R91 PolarHBondContact OD1-NH2 3.49Å; N57-R91 PolarHBondContact ND2-NH2 3.38Å; N57-R91 WeakPolarHBondContact OD1-CB 3.25Å; N57-R91 PolarHBondContact OD1-NE 3.22Å; N57-R91 PolarHBondContact OD1-NH2 3.36Å; Y87-R91 HydrophobicContact CD1-CG 3.96Å; Y87-R91 HydrophobicContact CD2-CG 4.31Å; Y87-R91 HydrophobicContact CE1-CG 3.47Å; Y87-R91 VanDerWaalsContact CE1-CG 3.47Å; Y87-R91 HydrophobicContact CE2-CG 3.87Å; Y87-R91 HydrophobicContact CG-CG 4.35Å; Y87-R91 VanDerWaalsContact CZ-CG 3.42Å; Y87-R91 WeakPolarHBondContact O-CG 3.26Å; Y87-R91 PolarHBondContact O-N 2.85Å; M88-R91 PolarHBondContact O-N 2.82Å; V89-R91 VanDerWaalsContact C-N 3.34Å; V89-R91 PolarHBondContact O-N 3.35Å; R91-Y94 PolarHBondContact O-N 2.94Å; R91-F95 WeakPolarHBondContact O-CB 3.34Å; R91-F95 PolarHBondContact O-N 2.89Å
92	H	98.4	Very high	98	Very high	80 Å²	80	43 Å²	43	37%	0.37	24%	0.241	S	C	.	.	H	α-helix	trans	-64.5	-47.2	174	-171.1	74.3	0	0	0	111.3	M88 V89 Y94 F95 S96	M88-H92 PolarHBondContact O-N 2.76Å; V89-H92 PolarHBondContact O-N 3.17Å; H92-Y94 VanDerWaalsContact C-N 3.34Å; H92-Y94 PolarHBondContact O-N 3.14Å; H92-F95 PolarHBondContact O-N 3.44Å; H92-S96 PolarHBondContact NE2-OG 3.22Å; H92-S96 WeakPolarHBondContact O-CB 3.28Å; H92-S96 PolarHBondContact O-N 3.48Å; H92-S96 PolarHBondContact O-OG 2.96Å
93	M	98.5	Very high	97.9	Very high	87 Å²	87	46 Å²	46	43%	0.429	25%	0.25	S	C	.	.	H	α-helix	trans	-59.3	-44	175.9	-70.7	173.5	66	0	0	112	V89 A90 G97 L111	V89-M93 HydrophobicContact CG1-CG 4.42Å; V89-M93 HydrophobicContact CG1-SD 3.94Å; V89-M93 WeakPolarHBondContact O-CG 3.48Å; V89-M93 PolarHBondContact O-N 2.91Å; A90-M93 PolarHBondContact O-N 3.42Å; M93-G97 PolarHBondContact O-N 3.15Å; M93-L111 HydrophobicContact SD-CD2 4.12Å
94	Y	98.7	Very high	97.8	Very high	5 Å²	5	51.3 Å²	51.3	2%	0.02	27%	0.271	C	S	.	.	H	α-helix	trans	-59	-51.2	176.7	175.1	-94.1	0	0	0	110.8	N56 A90 R91 H92 Y98 R105 F109	N56-Y94 HydrophobicContact CB-CE1 4.05Å; N56-Y94 WeakPolarHBondContact OD1-CE1 3.42Å; N56-Y94 PolarHBondContact OD1-OH 3.11Å; A90-Y94 VanDerWaalsContact O-CB 3.31Å; A90-Y94 WeakPolarHBondContact O-CB 3.38Å; A90-Y94 PolarHBondContact O-N 3.41Å; R91-Y94 PolarHBondContact O-N 2.94Å; H92-Y94 VanDerWaalsContact C-N 3.34Å; H92-Y94 PolarHBondContact O-N 3.14Å; Y94-Y98 AromaticContact CE1-CD1 3.75Å; Y94-Y98 HydrophobicContact CE1-CD1 3.75Å; Y94-Y98 HydrophobicContact CE1-CE1 4.43Å; Y94-Y98 HydrophobicContact CE2-CD1 4.42Å; Y94-Y98 AromaticContact CZ-CD1 3.62Å; Y94-Y98 VanDerWaalsContact O-CB 3.24Å; Y94-Y98 WeakPolarHBondContact O-CB 3.45Å; Y94-Y98 PolarHBondContact O-N 3.44Å; Y94-Y98 WeakPolarHBondContact OH-CD1 3.34Å; Y94-Y98 WeakPolarHBondContact OH-CE1 3.34Å; Y94-R105 HydrophobicContact CD2-CB 3.92Å; Y94-R105 HydrophobicContact CD2-CG 4.38Å; Y94-R105 VanDerWaalsContact CD2-O 3.28Å; Y94-R105 WeakPolarHBondContact CD2-O 3.34Å; Y94-R105 HydrophobicContact CE2-CB 3.78Å; Y94-R105 HydrophobicContact CE2-CG 3.86Å; Y94-F109 HydrophobicContact CD2-CB 3.67Å; Y94-F109 HydrophobicContact CD2-CD2 4.22Å; Y94-F109 HydrophobicContact CD2-CG 4.44Å; Y94-F109 HydrophobicContact CE2-CB 3.83Å; Y94-F109 AromaticContact CE2-CD2 3.78Å; Y94-F109 HydrophobicContact CE2-CD2 3.78Å; Y94-F109 HydrophobicContact CE2-CG 4.2Å
95	F	98.6	Very high	97.7	Very high	5 Å²	5	55.3 Å²	55.3	2%	0.022	29%	0.286	C	S	.	.	H	α-helix	trans	-62.5	-54.4	-177.9	-177.9	-90.1	0	0	0	111.5	L23 Q26 T50 A53 H54 R91 H92 G97 Y98 V99	L23-F95 HydrophobicContact CB-CD2 4.47Å; L23-F95 HydrophobicContact CB-CE2 4.31Å; L23-F95 HydrophobicContact CD1-CB 4.47Å; L23-F95 HydrophobicContact CD1-CD2 4.19Å; L23-F95 HydrophobicContact CD1-CG 4.4Å; L23-F95 HydrophobicContact CD2-CB 3.95Å; L23-F95 HydrophobicContact CD2-CD1 3.49Å; L23-F95 VanDerWaalsContact CD2-CD1 3.49Å; L23-F95 HydrophobicContact CD2-CD2 3.69Å; L23-F95 HydrophobicContact CD2-CE1 3.82Å; L23-F95 HydrophobicContact CD2-CE2 4.01Å; L23-F95 HydrophobicContact CD2-CG 3.42Å; L23-F95 VanDerWaalsContact CD2-CG 3.42Å; L23-F95 HydrophobicContact CD2-CZ 4.06Å; L23-F95 HydrophobicContact CG-CD2 4.34Å; L23-F95 HydrophobicContact CG-CG 4.45Å; Q26-F95 HydrophobicContact CB-CE1 4.02Å; Q26-F95 HydrophobicContact CB-CZ 3.71Å; Q26-F95 HydrophobicContact CG-CE1 4.1Å; Q26-F95 HydrophobicContact CG-CZ 4.26Å; T50-F95 HydrophobicContact CG2-CE2 4.43Å; T50-F95 HydrophobicContact CG2-CZ 3.87Å; A53-F95 HydrophobicContact CB-CD2 3.49Å; A53-F95 VanDerWaalsContact CB-CD2 3.49Å; A53-F95 HydrophobicContact CB-CE2 3.84Å; A53-F95 HydrophobicContact CB-CG 4.27Å; H54-F95 HydrophobicContact CB-CE2 4.11Å; R91-F95 WeakPolarHBondContact O-CB 3.34Å; R91-F95 PolarHBondContact O-N 2.89Å; H92-F95 PolarHBondContact O-N 3.44Å; F95-G97 VanDerWaalsContact C-N 3.3Å; F95-G97 PolarHBondContact O-N 3.03Å; F95-Y98 PolarHBondContact O-N 2.65Å; F95-Y98 VanDerWaalsContact O-N 3.12Å; F95-V99 HydrophobicContact CD1-CG2 4.05Å; F95-V99 HydrophobicContact CE1-CG2 3.68Å; F95-V99 HydrophobicContact CE2-CG2 4.47Å; F95-V99 HydrophobicContact CZ-CG2 3.92Å; F95-V99 WeakPolarHBondContact O-CG2 3.37Å; F95-V99 PolarHBondContact O-N 3.36Å
96	S	98.2	Very high	97.6	Very high	45 Å²	45	55 Å²	55	32%	0.315	28%	0.282	S	S	.	.	H	α-helix	trans	-59.6	-42.1	-178.9	-63	0	0	0	0	111.5	H92 M100	H92-S96 PolarHBondContact NE2-OG 3.22Å; H92-S96 WeakPolarHBondContact O-CB 3.28Å; H92-S96 PolarHBondContact O-N 3.48Å; H92-S96 PolarHBondContact O-OG 2.96Å; S96-M100 WeakPolarHBondContact O-CG 3.28Å; S96-M100 PolarHBondContact O-N 3Å
97	G	98.2	Very high	97.6	Very high	9 Å²	9	56 Å²	56	9%	0.093	29%	0.289	C	S	.	.	H	α-helix	trans	-63.1	-44.3	174.6	0	0	0	0	0	112.8	M93 F95 M100 S101 K104	M93-G97 PolarHBondContact O-N 3.15Å; F95-G97 VanDerWaalsContact C-N 3.3Å; F95-G97 PolarHBondContact O-N 3.03Å; G97-M100 PolarHBondContact O-N 3.42Å; G97-S101 PolarHBondContact O-N 3.32Å; G97-K104 VanDerWaalsContact O-CB 3.26Å; G97-K104 WeakPolarHBondContact O-CB 3.36Å
98	Y	98.1	Very high	97.6	Very high	26 Å²	26	56 Å²	56	10%	0.102	29%	0.29	C	S	.	.	H	α-helix	trans	-67.5	-40.3	-177.8	-158.2	170.7	0	0	0	112.2	R49 R52 A53 Y94 F95 M100 S101 T102 R105	R49-Y98 HydrophobicContact CB-CD2 4.24Å; R49-Y98 HydrophobicContact CB-CE2 4.36Å; R49-Y98 VanDerWaalsContact CD-O 3.31Å; R49-Y98 WeakPolarHBondContact CD-O 3.47Å; R49-Y98 HydrophobicContact CG-CD2 4.19Å; R49-Y98 HydrophobicContact CG-CE2 4.04Å; R52-Y98 HydrophobicContact CB-CE1 4.22Å; A53-Y98 HydrophobicContact CB-CD1 3.68Å; A53-Y98 HydrophobicContact CB-CE1 4.48Å; A53-Y98 HydrophobicContact CB-CG 3.98Å; Y94-Y98 AromaticContact CE1-CD1 3.75Å; Y94-Y98 HydrophobicContact CE1-CD1 3.75Å; Y94-Y98 HydrophobicContact CE1-CE1 4.43Å; Y94-Y98 HydrophobicContact CE2-CD1 4.42Å; Y94-Y98 AromaticContact CZ-CD1 3.62Å; Y94-Y98 VanDerWaalsContact O-CB 3.24Å; Y94-Y98 WeakPolarHBondContact O-CB 3.45Å; Y94-Y98 PolarHBondContact O-N 3.44Å; Y94-Y98 WeakPolarHBondContact OH-CD1 3.34Å; Y94-Y98 WeakPolarHBondContact OH-CE1 3.34Å; F95-Y98 PolarHBondContact O-N 2.65Å; F95-Y98 VanDerWaalsContact O-N 3.12Å; Y98-M100 PolarHBondContact O-N 2.89Å; Y98-S101 WeakPolarHBondContact CA-O 3.46Å; Y98-S101 CarbonylContact O-C 3.54Å; Y98-S101 PolarHBondContact O-N 2.9Å; Y98-T102 HydrophobicContact CE2-CG2 4.14Å; Y98-R105 HydrophobicContact CD1-CB 4.1Å; Y98-R105 HydrophobicContact CD1-CG 4.49Å; Y98-R105 HydrophobicContact CD2-CB 4.3Å; Y98-R105 VanDerWaalsContact CE1-NH1 3.3Å; Y98-R105 HydrophobicContact CG-CB 3.75Å; Y98-R105 HydrophobicContact CG-CG 4.39Å; Y98-R105 PolarHBondContact OH-NH1 3.21Å
99	V	97	Very high	97.5	Very high	49 Å²	49	57.2 Å²	57.2	30%	0.297	29%	0.294	S	S	.	.	H	α-helix	trans	-54.1	-44.7	174.3	172.1	0	0	0	0	110.5	R49 T50 F95	R49-V99 PolarHBondContact NE-O 3.49Å; R49-V99 VanDerWaalsContact NE-O 3.09Å; T50-V99 HydrophobicContact CG2-CG2 4.2Å; F95-V99 HydrophobicContact CD1-CG2 4.05Å; F95-V99 HydrophobicContact CE1-CG2 3.68Å; F95-V99 HydrophobicContact CE2-CG2 4.47Å; F95-V99 HydrophobicContact CZ-CG2 3.92Å; F95-V99 WeakPolarHBondContact O-CG2 3.37Å; F95-V99 PolarHBondContact O-N 3.36Å
100	M	95.8	Very high	97.5	Very high	123 Å²	123	60.6 Å²	60.6	61%	0.606	30%	0.3	S	S	*	.	H	α-helix	trans	-67	-51.2	177.7	-62.5	-180	85.7	0	0	112.9	S96 G97 Y98 K104	S96-M100 WeakPolarHBondContact O-CG 3.28Å; S96-M100 PolarHBondContact O-N 3Å; G97-M100 PolarHBondContact O-N 3.42Å; Y98-M100 PolarHBondContact O-N 2.89Å; M100-K104 HydrophobicContact CB-CD 4.07Å; M100-K104 HydrophobicContact SD-CD 4.19Å
101	S	96.6	Very high	97.5	Very high	38 Å²	38	64 Å²	64	27%	0.266	32%	0.317	S	S	.	.			trans	-161.6	156.6	176.7	81.5	0	0	0	0	112.8	G97 Y98 K103 K104	G97-S101 PolarHBondContact O-N 3.32Å; Y98-S101 WeakPolarHBondContact CA-O 3.46Å; Y98-S101 CarbonylContact O-C 3.54Å; Y98-S101 PolarHBondContact O-N 2.9Å; S101-K103 PolarHBondContact O-N 2.96Å; S101-K104 PolarHBondContact O-N 2.79Å; S101-K104 WeakPolarHBondContact OG-CG 3.44Å; S101-K104 PolarHBondContact OG-N 3.21Å
102	T	93.1	Very high	97.5	Very high	78 Å²	78	63.9 Å²	63.9	48%	0.479	32%	0.317	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.7	-32.5	179.1	56.4	0	0	0	0	113.3	R49 Y98 R105	R49-T102 HydrophobicContact CG-CG2 4.41Å; Y98-T102 HydrophobicContact CE2-CG2 4.14Å; T102-R105 VanDerWaalsContact O-CD 3.27Å; T102-R105 WeakPolarHBondContact O-CD 3.36Å; T102-R105 WeakPolarHBondContact O-CG 3.43Å; T102-R105 PolarHBondContact O-NE 3.33Å
103	K	95.8	Very high	97.5	Very high	167 Å²	167	63.9 Å²	63.9	73%	0.726	32%	0.319	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.4	-34.8	179.9	-65.1	-175.6	179.4	-178.2	0	112.5	S101 R105 L106	S101-K103 PolarHBondContact O-N 2.96Å; K103-R105 PolarHBondContact O-N 2.92Å; K103-L106 WeakPolarHBondContact O-CG 3.4Å; K103-L106 PolarHBondContact O-N 2.9Å
104	K	96.3	Very high	97.5	Very high	115 Å²	115	61.6 Å²	61.6	50%	0.5	32%	0.318	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.5	-9.7	-177.3	-77.9	-176.5	177.8	-172.4	0	113.9	G97 M100 S101 L106 P107	G97-K104 VanDerWaalsContact O-CB 3.26Å; G97-K104 WeakPolarHBondContact O-CB 3.36Å; M100-K104 HydrophobicContact CB-CD 4.07Å; M100-K104 HydrophobicContact SD-CD 4.19Å; S101-K104 PolarHBondContact O-N 2.79Å; S101-K104 WeakPolarHBondContact OG-CG 3.44Å; S101-K104 PolarHBondContact OG-N 3.21Å; K104-L106 VanDerWaalsContact C-N 3.31Å; K104-P107 WeakPolarHBondContact O-CD 3.49Å
105	R	97	Very high	97.5	Very high	84 Å²	84	61.6 Å²	61.6	32%	0.317	32%	0.319	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.5	-24.3	173.6	83.2	-168.6	173.9	157.5	0.6	113.9	Y94 Y98 T102 K103 G108 F109	Y94-R105 HydrophobicContact CD2-CB 3.92Å; Y94-R105 HydrophobicContact CD2-CG 4.38Å; Y94-R105 VanDerWaalsContact CD2-O 3.28Å; Y94-R105 WeakPolarHBondContact CD2-O 3.34Å; Y94-R105 HydrophobicContact CE2-CB 3.78Å; Y94-R105 HydrophobicContact CE2-CG 3.86Å; Y98-R105 HydrophobicContact CD1-CB 4.1Å; Y98-R105 HydrophobicContact CD1-CG 4.49Å; Y98-R105 HydrophobicContact CD2-CB 4.3Å; Y98-R105 VanDerWaalsContact CE1-NH1 3.3Å; Y98-R105 HydrophobicContact CG-CB 3.75Å; Y98-R105 HydrophobicContact CG-CG 4.39Å; Y98-R105 PolarHBondContact OH-NH1 3.21Å; T102-R105 VanDerWaalsContact O-CD 3.27Å; T102-R105 WeakPolarHBondContact O-CD 3.36Å; T102-R105 WeakPolarHBondContact O-CG 3.43Å; T102-R105 PolarHBondContact O-NE 3.33Å; K103-R105 PolarHBondContact O-N 2.92Å; R105-G108 PolarHBondContact O-N 3.2Å; R105-F109 PolarHBondContact O-N 2.92Å
106	L	97.9	Very high	97.6	Very high	68 Å²	68	62 Å²	62	36%	0.356	32%	0.321	S	S	.	.	H	α-helix	trans	-62.4	-43	-166.5	-65.2	175.4	0	0	0	114.6	K103 K104 G108 F109 Y110	K103-L106 WeakPolarHBondContact O-CG 3.4Å; K103-L106 PolarHBondContact O-N 2.9Å; K104-L106 VanDerWaalsContact C-N 3.31Å; L106-G108 PolarHBondContact O-N 3.49Å; L106-F109 WeakPolarHBondContact O-CB 3.47Å; L106-F109 PolarHBondContact O-N 3.47Å; L106-F109 VanDerWaalsContact O-N 3.14Å; L106-Y110 HydrophobicContact CB-CD2 4.43Å; L106-Y110 HydrophobicContact CB-CE2 4.08Å; L106-Y110 WeakPolarHBondContact O-CD2 3.25Å; L106-Y110 PolarHBondContact O-N 3.41Å
107	P	98.1	Very high	97.6	Very high	82 Å²	82	66.9 Å²	66.9	53%	0.532	34%	0.337	S	S	.	.	H	α-helix	trans	-59.8	-46.9	178.9	-25.5	36.1	0	0	0	112.9	K104 F109 Y110 L111	K104-P107 WeakPolarHBondContact O-CD 3.49Å; P107-F109 VanDerWaalsContact C-N 3.28Å; P107-F109 PolarHBondContact O-N 3.01Å; P107-Y110 PolarHBondContact O-N 2.93Å; P107-L111 PolarHBondContact O-N 2.98Å
108	G	98.2	Very high	97.6	Very high	1 Å²	1	70.4 Å²	70.4	1%	0.01	35%	0.35	C	S	.	.	H	α-helix	trans	-65.2	-32.8	175.7	0	0	0	0	0	112.7	R105 L106 T112	R105-G108 PolarHBondContact O-N 3.2Å; L106-G108 PolarHBondContact O-N 3.49Å; G108-T112 WeakPolarHBondContact O-CB 3.08Å; G108-T112 PolarHBondContact O-N 3.35Å; G108-T112 PolarHBondContact O-OG1 2.88Å
109	F	98.1	Very high	97.6	Very high	62 Å²	62	69.2 Å²	69.2	27%	0.272	35%	0.345	S	S	.	.	H	α-helix	trans	-63.6	-50.5	175.2	-175	-108.3	0	0	0	111.7	Y94 R105 L106 P107 L111 T112 L113	Y94-F109 HydrophobicContact CD2-CB 3.67Å; Y94-F109 HydrophobicContact CD2-CD2 4.22Å; Y94-F109 HydrophobicContact CD2-CG 4.44Å; Y94-F109 HydrophobicContact CE2-CB 3.83Å; Y94-F109 AromaticContact CE2-CD2 3.78Å; Y94-F109 HydrophobicContact CE2-CD2 3.78Å; Y94-F109 HydrophobicContact CE2-CG 4.2Å; R105-F109 PolarHBondContact O-N 2.92Å; L106-F109 WeakPolarHBondContact O-CB 3.47Å; L106-F109 PolarHBondContact O-N 3.47Å; L106-F109 VanDerWaalsContact O-N 3.14Å; P107-F109 VanDerWaalsContact C-N 3.28Å; P107-F109 PolarHBondContact O-N 3.01Å; F109-L111 PolarHBondContact O-N 3.07Å; F109-T112 VanDerWaalsContact O-CB 3.28Å; F109-T112 WeakPolarHBondContact O-CB 3.35Å; F109-T112 PolarHBondContact O-N 2.87Å; F109-T112 VanDerWaalsContact O-N 3.15Å; F109-L113 HydrophobicContact CD1-CD1 4.1Å; F109-L113 HydrophobicContact CE1-CD1 3.58Å; F109-L113 HydrophobicContact CE1-CG 4.21Å; F109-L113 HydrophobicContact CZ-CD1 4.03Å; F109-L113 HydrophobicContact CZ-CD2 4.39Å; F109-L113 HydrophobicContact CZ-CG 4.32Å; F109-L113 PolarHBondContact O-N 3.49Å
110	Y	98.5	Very high	97.7	Very high	147 Å²	147	68.8 Å²	68.8	58%	0.576	35%	0.345	S	S	*	.	H	α-helix	trans	-66.1	-37.7	179.7	-67.1	-53.8	0	0	0	112.5	L106 P107 T112 L113 G114	L106-Y110 HydrophobicContact CB-CD2 4.43Å; L106-Y110 HydrophobicContact CB-CE2 4.08Å; L106-Y110 WeakPolarHBondContact O-CD2 3.25Å; L106-Y110 PolarHBondContact O-N 3.41Å; P107-Y110 PolarHBondContact O-N 2.93Å; Y110-T112 VanDerWaalsContact C-N 3.28Å; Y110-T112 PolarHBondContact O-N 3.39Å; Y110-L113 HydrophobicContact CD1-CD1 4.36Å; Y110-L113 PolarHBondContact O-N 3.44Å; Y110-G114 PolarHBondContact O-N 2.91Å
111	L	98.7	Very high	97.9	Very high	71 Å²	71	65.6 Å²	65.6	37%	0.372	33%	0.332	S	S	.	.	H	α-helix	trans	-64.2	-36.3	173.6	-172.1	63.1	0	0	0	111.6	V86 A90 M93 P107 F109 G114 A115	V86-L111 HydrophobicContact CG1-CD1 3.97Å; V86-L111 HydrophobicContact CG1-CG 4.17Å; A90-L111 HydrophobicContact CB-CB 3.77Å; A90-L111 HydrophobicContact CB-CD2 3.77Å; A90-L111 HydrophobicContact CB-CG 3.64Å; M93-L111 HydrophobicContact SD-CD2 4.12Å; P107-L111 PolarHBondContact O-N 2.98Å; F109-L111 PolarHBondContact O-N 3.07Å; L111-G114 PolarHBondContact O-N 3.39Å; L111-A115 WeakPolarHBondContact O-CB 3.25Å; L111-A115 PolarHBondContact O-N 3.35Å
112	T	98.6	Very high	98	Very high	0 Å²	0	64.3 Å²	64.3	0%	0	32%	0.322	C	S	.	.	H	α-helix	trans	-61.2	-47.5	173.3	-57.7	0	0	0	0	110.7	L60 Y87 G108 F109 Y110 G114 A115 L116	L60-T112 HydrophobicContact CD1-CG2 4.24Å; Y87-T112 HydrophobicContact CD2-CG2 3.88Å; Y87-T112 HydrophobicContact CE2-CG2 3.6Å; G108-T112 WeakPolarHBondContact O-CB 3.08Å; G108-T112 PolarHBondContact O-N 3.35Å; G108-T112 PolarHBondContact O-OG1 2.88Å; F109-T112 VanDerWaalsContact O-CB 3.28Å; F109-T112 WeakPolarHBondContact O-CB 3.35Å; F109-T112 PolarHBondContact O-N 2.87Å; F109-T112 VanDerWaalsContact O-N 3.15Å; Y110-T112 VanDerWaalsContact C-N 3.28Å; Y110-T112 PolarHBondContact O-N 3.39Å; T112-G114 VanDerWaalsContact C-N 3.33Å; T112-G114 PolarHBondContact O-N 3.43Å; T112-A115 PolarHBondContact O-N 2.96Å; T112-L116 HydrophobicContact CG2-CD1 4.05Å; T112-L116 HydrophobicContact CG2-CG 4.38Å; T112-L116 WeakPolarHBondContact O-CG 3.43Å; T112-L116 PolarHBondContact O-N 3.32Å
113	L	98.5	Very high	98.2	Very high	79 Å²	79	61 Å²	61	41%	0.414	30%	0.302	S	S	.	.	H	α-helix	trans	-61.1	-42.7	178.3	-68.5	-178.9	0	0	0	111.7	F109 Y110 L116 F117	F109-L113 HydrophobicContact CD1-CD1 4.1Å; F109-L113 HydrophobicContact CE1-CD1 3.58Å; F109-L113 HydrophobicContact CE1-CG 4.21Å; F109-L113 HydrophobicContact CZ-CD1 4.03Å; F109-L113 HydrophobicContact CZ-CD2 4.39Å; F109-L113 HydrophobicContact CZ-CG 4.32Å; F109-L113 PolarHBondContact O-N 3.49Å; Y110-L113 HydrophobicContact CD1-CD1 4.36Å; Y110-L113 PolarHBondContact O-N 3.44Å; L113-L116 PolarHBondContact O-N 3Å; L113-F117 VanDerWaalsContact O-CB 3.24Å; L113-F117 WeakPolarHBondContact O-CB 3.45Å; L113-F117 PolarHBondContact O-N 3.38Å
114	G	98.7	Very high	98.3	Very high	39 Å²	39	56.7 Å²	56.7	40%	0.402	29%	0.29	S	S	.	.	H	α-helix	trans	-60.6	-45.7	176	0	0	0	0	0	112.7	Y110 L111 T112 F117 F118	Y110-G114 PolarHBondContact O-N 2.91Å; L111-G114 PolarHBondContact O-N 3.39Å; T112-G114 VanDerWaalsContact C-N 3.33Å; T112-G114 PolarHBondContact O-N 3.43Å; G114-F117 PolarHBondContact O-N 3.37Å; G114-F118 WeakPolarHBondContact O-CB 3.47Å; G114-F118 PolarHBondContact O-N 3.05Å
115	A	98.7	Very high	98.4	Very high	5 Å²	5	55 Å²	55	4%	0.041	29%	0.285	C	S	.	.	H	α-helix	trans	-64.1	-44.7	178.2	0	0	0	0	0	112.3	V86 L111 T112 F118 L119	V86-A115 HydrophobicContact CG1-CB 4.15Å; L111-A115 WeakPolarHBondContact O-CB 3.25Å; L111-A115 PolarHBondContact O-N 3.35Å; T112-A115 PolarHBondContact O-N 2.96Å; A115-F118 PolarHBondContact O-N 3.44Å; A115-L119 WeakPolarHBondContact O-CG 3.31Å; A115-L119 PolarHBondContact O-N 3.48Å
116	L	98.8	Very high	98.4	Very high	14 Å²	14	51 Å²	51	7%	0.073	27%	0.271	C	S	.	.	H	α-helix	trans	-65.4	-41.1	177.2	-70.7	178.8	0	0	0	111.8	L60 F64 V67 Y87 T112 L113 L119 S120	L60-L116 HydrophobicContact CD2-CD1 4.04Å; F64-L116 HydrophobicContact CB-CD2 4.05Å; V67-L116 HydrophobicContact CG2-CD2 3.98Å; Y87-L116 HydrophobicContact CD2-CD2 3.86Å; Y87-L116 HydrophobicContact CD2-CG 4.04Å; Y87-L116 HydrophobicContact CE2-CD1 4.27Å; Y87-L116 HydrophobicContact CE2-CD2 3.83Å; Y87-L116 HydrophobicContact CE2-CG 4.07Å; T112-L116 HydrophobicContact CG2-CD1 4.05Å; T112-L116 HydrophobicContact CG2-CG 4.38Å; T112-L116 WeakPolarHBondContact O-CG 3.43Å; T112-L116 PolarHBondContact O-N 3.32Å; L113-L116 PolarHBondContact O-N 3Å; L116-L119 PolarHBondContact O-N 3.01Å; L116-S120 VanDerWaalsContact O-CB 3.3Å; L116-S120 WeakPolarHBondContact O-CB 3.41Å; L116-S120 PolarHBondContact O-N 2.95Å; L116-S120 PolarHBondContact O-OG 3.17Å
117	F	98.8	Very high	98.4	Very high	147 Å²	147	51.3 Å²	51.3	65%	0.645	27%	0.272	S	S	*	.	H	α-helix	trans	-61.4	-47.6	175.9	178.6	-103.3	0	0	0	111	L113 G114 L119 S120 V121	L113-F117 VanDerWaalsContact O-CB 3.24Å; L113-F117 WeakPolarHBondContact O-CB 3.45Å; L113-F117 PolarHBondContact O-N 3.38Å; G114-F117 PolarHBondContact O-N 3.37Å; F117-L119 PolarHBondContact O-N 2.92Å; F117-S120 WeakPolarHBondContact O-CB 3.46Å; F117-S120 PolarHBondContact O-N 3.12Å; F117-V121 HydrophobicContact CD1-CG2 4.35Å; F117-V121 HydrophobicContact CE1-CG2 3.92Å; F117-V121 HydrophobicContact CE2-CG2 4.12Å; F117-V121 HydrophobicContact CZ-CG2 3.8Å; F117-V121 WeakPolarHBondContact O-CG2 3.4Å; F117-V121 PolarHBondContact O-N 3.47Å
118	F	98.8	Very high	98.3	Very high	84 Å²	84	52.5 Å²	52.5	37%	0.368	27%	0.274	S	S	.	.	H	α-helix	trans	-55.1	-53.5	175.6	173.1	-103.8	0	0	0	112	L79 G114 A115 S120 V121 L122	L79-F118 HydrophobicContact CB-CZ 4.43Å; G114-F118 WeakPolarHBondContact O-CB 3.47Å; G114-F118 PolarHBondContact O-N 3.05Å; A115-F118 PolarHBondContact O-N 3.44Å; F118-S120 VanDerWaalsContact C-N 3.28Å; F118-S120 PolarHBondContact O-N 3.14Å; F118-V121 PolarHBondContact O-N 2.98Å; F118-L122 HydrophobicContact CD1-CD1 4.32Å; F118-L122 HydrophobicContact CE1-CD1 3.65Å; F118-L122 HydrophobicContact CE1-CG 4.34Å; F118-L122 HydrophobicContact CE2-CD1 4.31Å; F118-L122 HydrophobicContact CE2-CD2 4.27Å; F118-L122 HydrophobicContact CE2-CG 4.36Å; F118-L122 HydrophobicContact CZ-CD1 3.65Å; F118-L122 HydrophobicContact CZ-CD2 4.37Å; F118-L122 HydrophobicContact CZ-CG 4.19Å; F118-L122 WeakPolarHBondContact O-CG 3.27Å; F118-L122 PolarHBondContact O-N 3.27Å
119	L	98.8	Very high	98	Very high	0 Å²	0	57.7 Å²	57.7	0%	0	30%	0.297	C	S	.	.	H	α-helix	trans	-61.8	-35.6	178.5	-67.6	171.9	0	0	0	112.5	F64 V67 S71 A80 A115 L116 F117 L122 S123	F64-L119 HydrophobicContact CD2-CD1 4.27Å; F64-L119 HydrophobicContact CE2-CD1 4.28Å; V67-L119 HydrophobicContact CB-CB 3.88Å; V67-L119 HydrophobicContact CG2-CB 3.6Å; V67-L119 HydrophobicContact CG2-CD1 3.93Å; V67-L119 HydrophobicContact CG2-CG 4.42Å; S71-L119 WeakPolarHBondContact OG-CD2 3.31Å; A80-L119 HydrophobicContact CB-CD2 4.36Å; A115-L119 WeakPolarHBondContact O-CG 3.31Å; A115-L119 PolarHBondContact O-N 3.48Å; L116-L119 PolarHBondContact O-N 3.01Å; F117-L119 PolarHBondContact O-N 2.92Å; L119-L122 PolarHBondContact O-N 3.37Å; L119-S123 WeakPolarHBondContact O-CB 3.49Å; L119-S123 PolarHBondContact O-N 3.04Å; L119-S123 PolarHBondContact O-OG 3.41Å
120	S	98.8	Very high	97.7	Very high	41 Å²	41	56.4 Å²	56.4	29%	0.287	30%	0.301	S	S	.	.	H	α-helix	trans	-67	-39.6	176.8	-57.9	0	0	0	0	112.1	L116 F117 F118 S123 T124	L116-S120 VanDerWaalsContact O-CB 3.3Å; L116-S120 WeakPolarHBondContact O-CB 3.41Å; L116-S120 PolarHBondContact O-N 2.95Å; L116-S120 PolarHBondContact O-OG 3.17Å; F117-S120 WeakPolarHBondContact O-CB 3.46Å; F117-S120 PolarHBondContact O-N 3.12Å; F118-S120 VanDerWaalsContact C-N 3.28Å; F118-S120 PolarHBondContact O-N 3.14Å; S120-S123 PolarHBondContact O-N 2.91Å; S120-T124 WeakPolarHBondContact O-CB 3.36Å; S120-T124 PolarHBondContact O-N 3.44Å; S120-T124 PolarHBondContact O-OG1 2.88Å
121	V	98.8	Very high	97.4	Very high	55 Å²	55	53.4 Å²	53.4	33%	0.333	30%	0.295	S	S	.	.	H	α-helix	trans	-63.3	-47.1	174.6	169.6	0	0	0	0	110.3	F117 F118 S123 T124 I125	F117-V121 HydrophobicContact CD1-CG2 4.35Å; F117-V121 HydrophobicContact CE1-CG2 3.92Å; F117-V121 HydrophobicContact CE2-CG2 4.12Å; F117-V121 HydrophobicContact CZ-CG2 3.8Å; F117-V121 WeakPolarHBondContact O-CG2 3.4Å; F117-V121 PolarHBondContact O-N 3.47Å; F118-V121 PolarHBondContact O-N 2.98Å; V121-S123 VanDerWaalsContact C-N 3.33Å; V121-S123 PolarHBondContact O-N 2.95Å; V121-T124 PolarHBondContact O-N 2.96Å; V121-I125 HydrophobicContact CG1-CD1 3.81Å; V121-I125 HydrophobicContact CG1-CG1 4.49Å; V121-I125 WeakPolarHBondContact O-CG1 3.22Å; V121-I125 PolarHBondContact O-N 3.32Å
122	L	98.5	Very high	97.1	Very high	12 Å²	12	55.1 Å²	55.1	6%	0.063	30%	0.304	C	S	.	.	H	α-helix	trans	-59.5	-44.6	176.5	-61.6	-168.1	0	0	0	111.9	F75 L79 F118 L119 T124 I125 G126	F75-L122 HydrophobicContact CB-CB 4.46Å; F75-L122 HydrophobicContact CD1-CB 4.05Å; F75-L122 HydrophobicContact CD1-CD1 4.15Å; F75-L122 HydrophobicContact CD1-CD2 3.82Å; F75-L122 HydrophobicContact CD1-CG 4.21Å; F75-L122 HydrophobicContact CE1-CD1 4.5Å; F75-L122 HydrophobicContact CE1-CD2 3.6Å; F75-L122 HydrophobicContact CE1-CG 4.45Å; F75-L122 HydrophobicContact CG-CB 4.32Å; F75-L122 HydrophobicContact CZ-CD2 4.24Å; L79-L122 HydrophobicContact CB-CD1 3.75Å; F118-L122 HydrophobicContact CD1-CD1 4.32Å; F118-L122 HydrophobicContact CE1-CD1 3.65Å; F118-L122 HydrophobicContact CE1-CG 4.34Å; F118-L122 HydrophobicContact CE2-CD1 4.31Å; F118-L122 HydrophobicContact CE2-CD2 4.27Å; F118-L122 HydrophobicContact CE2-CG 4.36Å; F118-L122 HydrophobicContact CZ-CD1 3.65Å; F118-L122 HydrophobicContact CZ-CD2 4.37Å; F118-L122 HydrophobicContact CZ-CG 4.19Å; F118-L122 WeakPolarHBondContact O-CG 3.27Å; F118-L122 PolarHBondContact O-N 3.27Å; L119-L122 PolarHBondContact O-N 3.37Å; L122-T124 VanDerWaalsContact C-N 3.33Å; L122-T124 PolarHBondContact O-N 3.48Å; L122-I125 PolarHBondContact O-N 3.37Å; L122-G126 PolarHBondContact O-N 2.94Å
123	S	98.4	Very high	96.5	Very high	7 Å²	7	60 Å²	60	5%	0.049	33%	0.329	C	S	.	.	H	α-helix	trans	-58.2	-45.7	176.3	-60.5	0	0	0	0	111.5	V67 S71 L119 S120 V121 G126 I127	V67-S123 PolarHBondContact O-OG 3.34Å; V67-S123 VanDerWaalsContact O-OG 3.14Å; S71-S123 PolarHBondContact N-OG 2.97Å; L119-S123 WeakPolarHBondContact O-CB 3.49Å; L119-S123 PolarHBondContact O-N 3.04Å; L119-S123 PolarHBondContact O-OG 3.41Å; S120-S123 PolarHBondContact O-N 2.91Å; V121-S123 VanDerWaalsContact C-N 3.33Å; V121-S123 PolarHBondContact O-N 2.95Å; S123-G126 PolarHBondContact O-N 3.5Å; S123-I127 VanDerWaalsContact O-CG1 3.26Å; S123-I127 WeakPolarHBondContact O-CG1 3.48Å; S123-I127 PolarHBondContact O-N 3.47Å
124	T	98.4	Very high	95.9	Very high	78 Å²	78	60.8 Å²	60.8	48%	0.479	33%	0.331	S	S	.	.	H	α-helix	trans	-63.4	-45.8	179.8	-56.5	0	0	0	0	111.3	S120 V121 L122 G126 I127 L128	S120-T124 WeakPolarHBondContact O-CB 3.36Å; S120-T124 PolarHBondContact O-N 3.44Å; S120-T124 PolarHBondContact O-OG1 2.88Å; V121-T124 PolarHBondContact O-N 2.96Å; L122-T124 VanDerWaalsContact C-N 3.33Å; L122-T124 PolarHBondContact O-N 3.48Å; T124-G126 PolarHBondContact O-N 2.9Å; T124-I127 PolarHBondContact O-N 3.49Å; T124-L128 HydrophobicContact CG2-CD1 4.01Å; T124-L128 HydrophobicContact CG2-CG 4.4Å; T124-L128 WeakPolarHBondContact O-CB 3.42Å; T124-L128 VanDerWaalsContact O-CG 3.28Å; T124-L128 WeakPolarHBondContact O-CG 3.31Å; T124-L128 PolarHBondContact O-N 2.95Å
125	I	98.1	Very high	95.2	Very high	78 Å²	78	65.3 Å²	65.3	40%	0.4	34%	0.337	S	S	.	.	H	α-helix	trans	-61.8	-45.3	177.5	-64.9	165.9	0	0	0	110.4	F75 V121 L122 I127 L128 H129	F75-I125 HydrophobicContact CD2-CB 4.2Å; F75-I125 HydrophobicContact CD2-CG2 3.83Å; F75-I125 HydrophobicContact CE2-CB 4.22Å; F75-I125 HydrophobicContact CE2-CG2 3.58Å; V121-I125 HydrophobicContact CG1-CD1 3.81Å; V121-I125 HydrophobicContact CG1-CG1 4.49Å; V121-I125 WeakPolarHBondContact O-CG1 3.22Å; V121-I125 PolarHBondContact O-N 3.32Å; L122-I125 PolarHBondContact O-N 3.37Å; I125-I127 PolarHBondContact O-N 2.94Å; I125-L128 PolarHBondContact O-N 3.01Å; I125-H129 VanDerWaalsContact O-CB 3.31Å; I125-H129 WeakPolarHBondContact O-CB 3.16Å; I125-H129 PolarHBondContact O-N 3.39Å
126	G	96.6	Very high	94.4	Very high	2 Å²	2	71.4 Å²	71.4	2%	0.021	36%	0.362	C	S	.	.	H	α-helix	trans	-59.7	-45.2	177.6	0	0	0	0	0	113	L74 L122 S123 T124 H129 G130	L74-G126 WeakPolarHBondContact O-CA 2.93Å; L122-G126 PolarHBondContact O-N 2.94Å; S123-G126 PolarHBondContact O-N 3.5Å; T124-G126 PolarHBondContact O-N 2.9Å; G126-H129 PolarHBondContact O-N 2.97Å; G126-G130 PolarHBondContact O-N 3.41Å
127	I	97	Very high	93.4	Very high	73 Å²	73	79.1 Å²	79.1	37%	0.374	39%	0.392	S	S	.	.	H	α-helix	trans	-61.5	-49.8	175.6	-69.1	165.2	0	0	0	110.9	T70 L74 S123 T124 I125 H129 G130 I131	T70-I127 HydrophobicContact CG2-CD1 3.88Å; T70-I127 HydrophobicContact CG2-CG1 4.16Å; L74-I127 HydrophobicContact CD1-CG1 3.6Å; S123-I127 VanDerWaalsContact O-CG1 3.26Å; S123-I127 WeakPolarHBondContact O-CG1 3.48Å; S123-I127 PolarHBondContact O-N 3.47Å; T124-I127 PolarHBondContact O-N 3.49Å; I125-I127 PolarHBondContact O-N 2.94Å; I127-H129 VanDerWaalsContact C-N 3.32Å; I127-H129 PolarHBondContact O-N 3.36Å; I127-G130 PolarHBondContact O-N 3.44Å; I127-I131 HydrophobicContact CG2-CD1 3.68Å; I127-I131 HydrophobicContact CG2-CG1 4.33Å; I127-I131 WeakPolarHBondContact O-CG1 3.43Å; I127-I131 PolarHBondContact O-N 3.04Å
128	L	96.2	Very high	92.3	Very high	108 Å²	108	77 Å²	77	57%	0.565	38%	0.382	S	S	*	.	H	α-helix	trans	-61.9	-41	-178.9	-71.4	174.8	0	0	0	111.8	T124 I125 L132	T124-L128 HydrophobicContact CG2-CD1 4.01Å; T124-L128 HydrophobicContact CG2-CG 4.4Å; T124-L128 WeakPolarHBondContact O-CB 3.42Å; T124-L128 VanDerWaalsContact O-CG 3.28Å; T124-L128 WeakPolarHBondContact O-CG 3.31Å; T124-L128 PolarHBondContact O-N 2.95Å; I125-L128 PolarHBondContact O-N 3.01Å; L128-L132 WeakPolarHBondContact O-CB 3.5Å; L128-L132 PolarHBondContact O-N 3.16Å
129	H	93.4	Very high	91.3	Very high	109 Å²	109	77.7 Å²	77.7	51%	0.505	39%	0.389	S	S	.	.	H	α-helix	trans	-63.7	-44.3	175.3	-179.4	-108	0	0	0	111.6	I125 G126 I127 L132 L133	I125-H129 VanDerWaalsContact O-CB 3.31Å; I125-H129 WeakPolarHBondContact O-CB 3.16Å; I125-H129 PolarHBondContact O-N 3.39Å; G126-H129 PolarHBondContact O-N 2.97Å; I127-H129 VanDerWaalsContact C-N 3.32Å; I127-H129 PolarHBondContact O-N 3.36Å; H129-L132 PolarHBondContact O-N 2.81Å; H129-L133 WeakPolarHBondContact CE1-CD1 3.33Å; H129-L133 WeakPolarHBondContact O-CG 3.33Å; H129-L133 PolarHBondContact O-N 3.43Å
130	G	91.1	Very high	90.3	Very high	35 Å²	35	80.3 Å²	80.3	36%	0.361	40%	0.404	S	S	.	.	H	α-helix	trans	-60.8	-46.7	175.9	0	0	0	0	0	112.8	G126 I127 L133 E134	G126-G130 PolarHBondContact O-N 3.41Å; I127-G130 PolarHBondContact O-N 3.44Å; G130-L133 PolarHBondContact O-N 3.46Å; G130-E134 WeakPolarHBondContact O-CB 3.33Å; G130-E134 PolarHBondContact O-N 3.06Å
131	I	92.5	Very high	89.2	Confident	85 Å²	85	80.9 Å²	80.9	44%	0.436	41%	0.409	S	S	.	.	H	α-helix	trans	-60.6	-47.7	175	-68.8	171.5	0	0	0	110.1	I127 L133 E134 Y135	I127-I131 HydrophobicContact CG2-CD1 3.68Å; I127-I131 HydrophobicContact CG2-CG1 4.33Å; I127-I131 WeakPolarHBondContact O-CG1 3.43Å; I127-I131 PolarHBondContact O-N 3.04Å; I131-L133 PolarHBondContact O-N 3.35Å; I131-E134 PolarHBondContact O-N 3.41Å; I131-Y135 HydrophobicContact CB-CD2 4.36Å; I131-Y135 HydrophobicContact CG2-CD2 3.71Å; I131-Y135 HydrophobicContact CG2-CE2 4.15Å; I131-Y135 WeakPolarHBondContact O-CB 3.33Å; I131-Y135 VanDerWaalsContact O-CD2 3.25Å; I131-Y135 WeakPolarHBondContact O-CD2 3.44Å; I131-Y135 PolarHBondContact O-N 3.35Å
132	L	90.9	Very high	88.2	Confident	107 Å²	107	84.4 Å²	84.4	56%	0.56	42%	0.423	S	S	*	.	H	α-helix	trans	-58.8	-48.9	-179.2	-176	67.4	0	0	0	110.9	L128 H129 E134 F136	L128-L132 WeakPolarHBondContact O-CB 3.5Å; L128-L132 PolarHBondContact O-N 3.16Å; H129-L132 PolarHBondContact O-N 2.81Å; L132-E134 PolarHBondContact O-N 2.86Å; L132-F136 HydrophobicContact CD1-CB 4.32Å; L132-F136 WeakPolarHBondContact O-CA 3.32Å; L132-F136 WeakPolarHBondContact O-CB 3.46Å; L132-F136 PolarHBondContact O-N 3.06Å
133	L	87.6	Confident	87.1	Confident	102 Å²	102	89.8 Å²	89.8	53%	0.534	45%	0.449	S	S	.	.	H	α-helix	trans	-62.2	-45.3	179.4	-72.2	-179.8	0	0	0	112.3	H129 G130 I131 Y137	H129-L133 WeakPolarHBondContact CE1-CD1 3.33Å; H129-L133 WeakPolarHBondContact O-CG 3.33Å; H129-L133 PolarHBondContact O-N 3.43Å; G130-L133 PolarHBondContact O-N 3.46Å; I131-L133 PolarHBondContact O-N 3.35Å; L133-Y137 WeakPolarHBondContact O-CB 3.3Å; L133-Y137 PolarHBondContact O-N 3.39Å
134	E	85.5	Confident	86.2	Confident	96 Å²	96	94.8 Å²	94.8	45%	0.449	48%	0.479	S	S	.	.	H	α-helix	trans	-68.6	-47.2	-176	-169.7	179.6	168.1	0	0	112.2	G130 I131 L132 K138	G130-E134 WeakPolarHBondContact O-CB 3.33Å; G130-E134 PolarHBondContact O-N 3.06Å; I131-E134 PolarHBondContact O-N 3.41Å; L132-E134 PolarHBondContact O-N 2.86Å; E134-K138 HydrophobicContact CG-CD 4.35Å; E134-K138 WeakPolarHBondContact O-CB 3.48Å; E134-K138 WeakPolarHBondContact O-CD 3.36Å; E134-K138 VanDerWaalsContact O-CG 3.25Å; E134-K138 WeakPolarHBondContact O-CG 3.4Å; E134-K138 PolarHBondContact O-N 3.24Å; E134-K138 IonicContact OE1-NZ 2.71Å; E134-K138 PolarHBondContact OE1-NZ 3.26Å
135	Y	84.7	Confident	84.9	Confident	134 Å²	134	96.2 Å²	96.2	53%	0.525	49%	0.488	S	S	.	.	H	α-helix	trans	-84.4	-36.7	-173.5	-69.5	-87.7	0	0	0	112.6	I131 K138 I139	I131-Y135 HydrophobicContact CB-CD2 4.36Å; I131-Y135 HydrophobicContact CG2-CD2 3.71Å; I131-Y135 HydrophobicContact CG2-CE2 4.15Å; I131-Y135 WeakPolarHBondContact O-CB 3.33Å; I131-Y135 VanDerWaalsContact O-CD2 3.25Å; I131-Y135 WeakPolarHBondContact O-CD2 3.44Å; I131-Y135 PolarHBondContact O-N 3.35Å; Y135-K138 PolarHBondContact O-N 2.97Å; Y135-I139 WeakPolarHBondContact O-CB 3.23Å; Y135-I139 WeakPolarHBondContact O-CD1 3.46Å; Y135-I139 VanDerWaalsContact O-CG1 3.22Å; Y135-I139 WeakPolarHBondContact O-CG1 3.33Å; Y135-I139 PolarHBondContact O-N 3.33Å
136	F	80.2	Confident	82.8	Confident	133 Å²	133	103 Å²	103	58%	0.583	52%	0.518	S	S	*	.	H	α-helix	trans	-65.9	-43.1	175.6	-171.1	-101.3	0	0	0	111.2	L132 I139 V140	L132-F136 HydrophobicContact CD1-CB 4.32Å; L132-F136 WeakPolarHBondContact O-CA 3.32Å; L132-F136 WeakPolarHBondContact O-CB 3.46Å; L132-F136 PolarHBondContact O-N 3.06Å; F136-I139 PolarHBondContact O-N 2.68Å; F136-V140 HydrophobicContact CD1-CG2 4.13Å; F136-V140 HydrophobicContact CE1-CG2 3.81Å; F136-V140 HydrophobicContact CE2-CG2 4.36Å; F136-V140 HydrophobicContact CZ-CG2 3.93Å; F136-V140 WeakPolarHBondContact O-CG2 3.17Å; F136-V140 PolarHBondContact O-N 3.48Å
137	Y	77.6	Confident	82.1	Confident	175 Å²	175	108.1 Å²	108.1	69%	0.686	54%	0.543	S	S	*	.	H	α-helix	trans	-63.2	-43.9	177.3	-175	-96.5	0	0	0	112.1	L133 I139 V140 S141	L133-Y137 WeakPolarHBondContact O-CB 3.3Å; L133-Y137 PolarHBondContact O-N 3.39Å; Y137-I139 PolarHBondContact O-N 3.34Å; Y137-V140 PolarHBondContact O-N 3.31Å; Y137-S141 VanDerWaalsContact O-CB 3.23Å; Y137-S141 WeakPolarHBondContact O-CB 3.37Å; Y137-S141 PolarHBondContact O-N 3.4Å
138	K	76.4	Confident	81.3	Confident	104 Å²	104	109.9 Å²	109.9	45%	0.452	55%	0.552	S	S	.	*	H	α-helix	trans	-59.2	-46.4	175.8	-80	172.3	178.1	170.8	0	112	E134 Y135 S141 M142	E134-K138 HydrophobicContact CG-CD 4.35Å; E134-K138 WeakPolarHBondContact O-CB 3.48Å; E134-K138 WeakPolarHBondContact O-CD 3.36Å; E134-K138 VanDerWaalsContact O-CG 3.25Å; E134-K138 WeakPolarHBondContact O-CG 3.4Å; E134-K138 PolarHBondContact O-N 3.24Å; E134-K138 IonicContact OE1-NZ 2.71Å; E134-K138 PolarHBondContact OE1-NZ 3.26Å; Y135-K138 PolarHBondContact O-N 2.97Å; K138-S141 PolarHBondContact O-N 2.71Å; K138-M142 WeakPolarHBondContact O-CG 3.05Å; K138-M142 PolarHBondContact O-N 2.89Å
139	I	78.6	Confident	80.5	Confident	98 Å²	98	110.1 Å²	110.1	50%	0.503	55%	0.551	S	S	.	*	H	α-helix	trans	-64.2	-47.1	-179.7	-68.9	165.8	0	0	0	111.2	Y135 F136 Y137 M142 M143	Y135-I139 WeakPolarHBondContact O-CB 3.23Å; Y135-I139 WeakPolarHBondContact O-CD1 3.46Å; Y135-I139 VanDerWaalsContact O-CG1 3.22Å; Y135-I139 WeakPolarHBondContact O-CG1 3.33Å; Y135-I139 PolarHBondContact O-N 3.33Å; F136-I139 PolarHBondContact O-N 2.68Å; Y137-I139 PolarHBondContact O-N 3.34Å; I139-M142 PolarHBondContact O-N 3.12Å; I139-M143 HydrophobicContact CG2-CE 3.95Å; I139-M143 WeakPolarHBondContact O-CG 3.29Å; I139-M143 PolarHBondContact O-N 3.25Å
140	V	77.9	Confident	79.7	Confident	54 Å²	54	110.1 Å²	110.1	33%	0.327	55%	0.554	S	S	.	*	H	α-helix	trans	-64.4	-42.5	178.1	174.1	0	0	0	0	111.1	F136 Y137 M142 M143 V144	F136-V140 HydrophobicContact CD1-CG2 4.13Å; F136-V140 HydrophobicContact CE1-CG2 3.81Å; F136-V140 HydrophobicContact CE2-CG2 4.36Å; F136-V140 HydrophobicContact CZ-CG2 3.93Å; F136-V140 WeakPolarHBondContact O-CG2 3.17Å; F136-V140 PolarHBondContact O-N 3.48Å; Y137-V140 PolarHBondContact O-N 3.31Å; V140-M142 VanDerWaalsContact C-N 3.31Å; V140-M142 PolarHBondContact O-N 2.87Å; V140-M143 HydrophobicContact CG2-CE 4.3Å; V140-M143 PolarHBondContact O-N 3.48Å; V140-M143 VanDerWaalsContact O-N 3.14Å; V140-V144 HydrophobicContact CG1-CG2 4.26Å; V140-V144 WeakPolarHBondContact O-CG2 3.4Å; V140-V144 PolarHBondContact O-N 3.43Å; V140-V144 VanDerWaalsContact O-N 3.12Å
141	S	75.3	Confident	79	Confident	54 Å²	54	114.8 Å²	114.8	38%	0.378	57%	0.566	S	S	.	*	H	α-helix	trans	-60.4	-40.3	178.1	-175.2	0	0	0	0	112.1	Y137 K138 V144 T145	Y137-S141 VanDerWaalsContact O-CB 3.23Å; Y137-S141 WeakPolarHBondContact O-CB 3.37Å; Y137-S141 PolarHBondContact O-N 3.4Å; K138-S141 PolarHBondContact O-N 2.71Å; S141-V144 PolarHBondContact O-N 3.35Å; S141-T145 PolarHBondContact O-N 3.01Å; S141-T145 PolarHBondContact O-OG1 3.16Å
142	M	76.4	Confident	78.1	Confident	128 Å²	128	116.8 Å²	116.8	63%	0.631	57%	0.574	S	S	*	*	H	α-helix	trans	-66	-34.6	175.6	-72.9	175.6	68.5	0	0	112.9	K138 I139 V140 H146	K138-M142 WeakPolarHBondContact O-CG 3.05Å; K138-M142 PolarHBondContact O-N 2.89Å; I139-M142 PolarHBondContact O-N 3.12Å; V140-M142 VanDerWaalsContact C-N 3.31Å; V140-M142 PolarHBondContact O-N 2.87Å; M142-H146 PolarHBondContact O-CD2 2.8Å
143	M	76.2	Confident	77.2	Confident	126 Å²	126	117.5 Å²	117.5	62%	0.621	58%	0.575	S	S	*	*	H	α-helix	trans	-76.2	-24.1	179.1	-69.9	-172.7	-60.6	0	0	113.8	I139 V140	I139-M143 HydrophobicContact CG2-CE 3.95Å; I139-M143 WeakPolarHBondContact O-CG 3.29Å; I139-M143 PolarHBondContact O-N 3.25Å; V140-M143 HydrophobicContact CG2-CE 4.3Å; V140-M143 PolarHBondContact O-N 3.48Å; V140-M143 VanDerWaalsContact O-N 3.14Å
144	V	78.9	Confident	76.4	Confident	111 Å²	111	118.7 Å²	118.7	67%	0.673	58%	0.578	S	S	*	*	H	α-helix	trans	-93.3	-16.6	-177	176.1	0	0	0	0	112.7	V140 S141	V140-V144 HydrophobicContact CG1-CG2 4.26Å; V140-V144 WeakPolarHBondContact O-CG2 3.4Å; V140-V144 PolarHBondContact O-N 3.43Å; V140-V144 VanDerWaalsContact O-N 3.12Å; S141-V144 PolarHBondContact O-N 3.35Å
145	T	72.1	Confident	75.6	Confident	109 Å²	109	120.6 Å²	120.6	67%	0.669	59%	0.589	S	S	*	*			trans	-92.4	7.1	179.5	33.5	0	0	0	0	114.6	S141	S141-T145 PolarHBondContact O-N 3.01Å; S141-T145 PolarHBondContact O-OG1 3.16Å
146	H	53.1	Low	74.8	Confident	221 Å²	221	119.4 Å²	119.4	100%	1.023	60%	0.595	S	S	*	*			trans	-119.6	0	171.7	-70.1	-53.6	0	0	0	110.2	M142	M142-H146 PolarHBondContact O-CD2 2.8Å

Retrieved 146 of 146 residues in 33.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).