A0A060XGI7_ONCMY Loading...

Si:dkey-31g6.6

AlphaFold DB , UniProt , Accession A0A060XGI7, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene c13h17orf67, Length 87 aa.

						>A0A060XGI7_ONCMY|A0A060XGI7|c13h17orf67
MKKFVAFSLCLVLLTIYIADANPIIKESYAKQLLRTKRQKPGHPDEPMREHLLHMQVLDQRAQETNLEHWLNPHCYPRCDRNYGHPV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.3	Low	81.7	Confident	195 Å²	195	122.1 Å²	122.1	96%	0.961	62%	0.622	S	S	*	*				0	-69.6	0	-55.4	-56.6	-129.1	0	0	113	K3 F4 V5	M1-K3 PolarHBondContact O-N 2.78Å; M1-F4 PolarHBondContact O-N 2.93Å; M1-F4 VanDerWaalsContact O-N 3.12Å; M1-V5 PolarHBondContact O-N 2.96Å; M1-V5 VanDerWaalsContact O-N 3.16Å
2	K	73	Confident	82.2	Confident	189 Å²	189	118.8 Å²	118.8	82%	0.822	61%	0.611	S	S	*	*	H	α-helix	trans	-54.9	-40.1	-174.7	-83.5	177.3	173.8	177.2	0	115.8	V5 A6	K2-V5 PolarHBondContact O-N 3.5Å; K2-A6 PolarHBondContact O-N 3.16Å
3	K	78.8	Confident	82.5	Confident	181 Å²	181	118.3 Å²	118.3	79%	0.787	61%	0.61	S	S	*	*	H	α-helix	trans	-67.1	-36	179.2	-62.8	-166.1	179.7	-177.5	0	113.1	M1 A6 F7	M1-K3 PolarHBondContact O-N 2.78Å; K3-A6 PolarHBondContact O-N 3.12Å; K3-F7 VanDerWaalsContact O-CB 3.32Å; K3-F7 WeakPolarHBondContact O-CB 3.36Å; K3-F7 PolarHBondContact O-N 2.93Å
4	F	80.8	Confident	82.6	Confident	165 Å²	165	117.1 Å²	117.1	72%	0.724	60%	0.604	S	S	*	*	H	α-helix	trans	-70.9	-35.7	175.3	-72.4	-77.3	0	0	0	112.1	M1 F7 S8	M1-F4 PolarHBondContact O-N 2.93Å; M1-F4 VanDerWaalsContact O-N 3.12Å; F4-F7 PolarHBondContact O-N 3.44Å; F4-S8 WeakPolarHBondContact O-CB 3.45Å; F4-S8 PolarHBondContact O-N 3.5Å; F4-S8 PolarHBondContact O-OG 3.23Å
5	V	84.4	Confident	82.4	Confident	85 Å²	85	115.3 Å²	115.3	52%	0.515	60%	0.601	S	S	.	*	H	α-helix	trans	-66.4	-43.2	174	176.9	0	0	0	0	111	M1 K2 F7 S8 L9	M1-V5 PolarHBondContact O-N 2.96Å; M1-V5 VanDerWaalsContact O-N 3.16Å; K2-V5 PolarHBondContact O-N 3.5Å; V5-F7 PolarHBondContact O-N 3.34Å; V5-S8 WeakPolarHBondContact CA-OG 3.32Å; V5-S8 PolarHBondContact O-OG 3.26Å; V5-L9 HydrophobicContact CG1-CD1 4.26Å; V5-L9 WeakPolarHBondContact O-CB 3.43Å; V5-L9 PolarHBondContact O-N 3.44Å
6	A	86.1	Confident	82.2	Confident	54 Å²	54	114.1 Å²	114.1	45%	0.446	59%	0.594	S	S	.	*	H	α-helix	trans	-64.6	-40.1	175.2	0	0	0	0	0	112.1	K2 K3 L9 C10	K2-A6 PolarHBondContact O-N 3.16Å; K3-A6 PolarHBondContact O-N 3.12Å; A6-L9 PolarHBondContact O-N 3.49Å; A6-C10 PolarHBondContact O-N 3.42Å
7	F	86.9	Confident	81.8	Confident	142 Å²	142	118.9 Å²	118.9	62%	0.623	60%	0.604	S	S	*	*	H	α-helix	trans	-67.5	-41.3	179.3	-156.7	-93.2	0	0	0	112.4	K3 F4 V5 C10 L11	K3-F7 VanDerWaalsContact O-CB 3.32Å; K3-F7 WeakPolarHBondContact O-CB 3.36Å; K3-F7 PolarHBondContact O-N 2.93Å; F4-F7 PolarHBondContact O-N 3.44Å; V5-F7 PolarHBondContact O-N 3.34Å; F7-C10 PolarHBondContact O-N 2.96Å; F7-L11 HydrophobicContact CD1-CD1 3.76Å; F7-L11 HydrophobicContact CD1-CG 4.29Å; F7-L11 HydrophobicContact CE1-CD1 3.83Å; F7-L11 HydrophobicContact CE1-CG 4.27Å; F7-L11 WeakPolarHBondContact O-CG 3.44Å; F7-L11 PolarHBondContact O-N 3.03Å
8	S	85.3	Confident	81.1	Confident	61 Å²	61	118.3 Å²	118.3	43%	0.427	60%	0.602	S	S	.	*	H	α-helix	trans	-65.6	-40.2	174.4	46.3	0	0	0	0	112.3	F4 V5 L11 V12	F4-S8 WeakPolarHBondContact O-CB 3.45Å; F4-S8 PolarHBondContact O-N 3.5Å; F4-S8 PolarHBondContact O-OG 3.23Å; V5-S8 WeakPolarHBondContact CA-OG 3.32Å; V5-S8 PolarHBondContact O-OG 3.26Å; S8-L11 PolarHBondContact O-N 3.05Å; S8-V12 WeakPolarHBondContact O-CG2 3.29Å; S8-V12 PolarHBondContact O-N 3.31Å
9	L	87.6	Confident	80.3	Confident	102 Å²	102	115.6 Å²	115.6	53%	0.534	60%	0.599	S	S	.	*	H	α-helix	trans	-60.3	-45.5	172.2	-95.1	157.9	0	0	0	112.5	V5 A6 L11 V12 L13	V5-L9 HydrophobicContact CG1-CD1 4.26Å; V5-L9 WeakPolarHBondContact O-CB 3.43Å; V5-L9 PolarHBondContact O-N 3.44Å; A6-L9 PolarHBondContact O-N 3.49Å; L9-L11 VanDerWaalsContact C-N 3.32Å; L9-L11 PolarHBondContact O-N 3.32Å; L9-V12 PolarHBondContact O-N 3.43Å; L9-L13 WeakPolarHBondContact O-CG 3.36Å; L9-L13 PolarHBondContact O-N 3.39Å
10	C	88.1	Confident	79.3	Confident	76 Å²	76	116.6 Å²	116.6	51%	0.514	61%	0.605	S	S	.	*	H	α-helix	trans	-60.9	-40.6	176.2	-82.2	0	0	0	0	112.3	A6 F7 L13 L14	A6-C10 PolarHBondContact O-N 3.42Å; F7-C10 PolarHBondContact O-N 2.96Å; C10-L13 PolarHBondContact O-N 2.96Å; C10-L14 WeakPolarHBondContact O-CB 3.41Å; C10-L14 PolarHBondContact O-N 2.93Å
11	L	87.8	Confident	78.3	Confident	93 Å²	93	114.4 Å²	114.4	49%	0.487	60%	0.604	S	S	.	*	H	α-helix	trans	-64.4	-42.3	177.6	-76.6	169.7	0	0	0	112.2	F7 S8 L9 L14 T15	F7-L11 HydrophobicContact CD1-CD1 3.76Å; F7-L11 HydrophobicContact CD1-CG 4.29Å; F7-L11 HydrophobicContact CE1-CD1 3.83Å; F7-L11 HydrophobicContact CE1-CG 4.27Å; F7-L11 WeakPolarHBondContact O-CG 3.44Å; F7-L11 PolarHBondContact O-N 3.03Å; S8-L11 PolarHBondContact O-N 3.05Å; L9-L11 VanDerWaalsContact C-N 3.32Å; L9-L11 PolarHBondContact O-N 3.32Å; L11-L14 PolarHBondContact O-N 3.48Å; L11-T15 WeakPolarHBondContact O-CG2 3.45Å; L11-T15 PolarHBondContact O-N 3.28Å; L11-T15 VanDerWaalsContact O-N 3.09Å; L11-T15 PolarHBondContact O-OG1 3.41Å
12	V	87.9	Confident	78.2	Confident	82 Å²	82	111 Å²	111	50%	0.497	59%	0.59	S	S	.	*	H	α-helix	trans	-65.4	-39.7	177.6	174.8	0	0	0	0	111.4	S8 L9 L14 T15 I16	S8-V12 WeakPolarHBondContact O-CG2 3.29Å; S8-V12 PolarHBondContact O-N 3.31Å; L9-V12 PolarHBondContact O-N 3.43Å; V12-L14 VanDerWaalsContact C-N 3.34Å; V12-L14 PolarHBondContact O-N 3.02Å; V12-T15 PolarHBondContact O-N 3.42Å; V12-T15 PolarHBondContact O-OG1 3.16Å; V12-I16 HydrophobicContact CG1-CD1 3.94Å; V12-I16 WeakPolarHBondContact O-CD1 3.37Å; V12-I16 VanDerWaalsContact O-CG1 3.29Å; V12-I16 WeakPolarHBondContact O-CG1 3.2Å; V12-I16 PolarHBondContact O-N 3.02Å
13	L	85.1	Confident	77.7	Confident	113 Å²	113	106.7 Å²	106.7	59%	0.592	58%	0.581	S	S	*	*	H	α-helix	trans	-65.6	-38.7	176.9	-71.1	168.2	0	0	0	112	L9 C10 Y17	L9-L13 WeakPolarHBondContact O-CG 3.36Å; L9-L13 PolarHBondContact O-N 3.39Å; C10-L13 PolarHBondContact O-N 2.96Å; L13-Y17 PolarHBondContact O-N 3.34Å; L13-Y17 VanDerWaalsContact O-N 3.16Å
14	L	83.6	Confident	77.1	Confident	101 Å²	101	105.3 Å²	105.3	53%	0.529	58%	0.581	S	S	.	*	H	α-helix	trans	-64.1	-42	176.4	-103	146.5	0	0	0	112.6	C10 L11 V12 Y17 I18	C10-L14 WeakPolarHBondContact O-CB 3.41Å; C10-L14 PolarHBondContact O-N 2.93Å; L11-L14 PolarHBondContact O-N 3.48Å; V12-L14 VanDerWaalsContact C-N 3.34Å; V12-L14 PolarHBondContact O-N 3.02Å; L14-Y17 PolarHBondContact O-N 3.04Å; L14-I18 HydrophobicContact CD2-CD1 4Å; L14-I18 WeakPolarHBondContact O-CD1 3.36Å; L14-I18 WeakPolarHBondContact O-CG1 3.37Å; L14-I18 PolarHBondContact O-N 3.29Å
15	T	80.1	Confident	76.5	Confident	91 Å²	91	101.4 Å²	101.4	56%	0.558	57%	0.567	S	S	*	*	H	α-helix	trans	-67.7	-37.2	-179.9	55.1	0	0	0	0	112.5	L11 V12 A19	L11-T15 WeakPolarHBondContact O-CG2 3.45Å; L11-T15 PolarHBondContact O-N 3.28Å; L11-T15 VanDerWaalsContact O-N 3.09Å; L11-T15 PolarHBondContact O-OG1 3.41Å; V12-T15 PolarHBondContact O-N 3.42Å; V12-T15 PolarHBondContact O-OG1 3.16Å; T15-A19 WeakPolarHBondContact O-CB 3.46Å; T15-A19 PolarHBondContact O-N 3.44Å
16	I	78.9	Confident	76.2	Confident	96 Å²	96	105.1 Å²	105.1	49%	0.492	58%	0.576	S	S	.	*	H	α-helix	trans	-64.5	-45.7	175.9	-64.3	165.2	0	0	0	110.2	V12 I18 A19 D20	V12-I16 HydrophobicContact CG1-CD1 3.94Å; V12-I16 WeakPolarHBondContact O-CD1 3.37Å; V12-I16 VanDerWaalsContact O-CG1 3.29Å; V12-I16 WeakPolarHBondContact O-CG1 3.2Å; V12-I16 PolarHBondContact O-N 3.02Å; I16-I18 PolarHBondContact O-N 3.07Å; I16-A19 PolarHBondContact O-N 3.09Å; I16-D20 PolarHBondContact O-N 3.06Å
17	Y	75.3	Confident	75.8	Confident	195 Å²	195	108.8 Å²	108.8	77%	0.765	58%	0.584	S	S	*	*	H	α-helix	trans	-66.8	-35.8	-178.3	-147	-86.8	0	0	0	113.1	L13 L14 A21	L13-Y17 PolarHBondContact O-N 3.34Å; L13-Y17 VanDerWaalsContact O-N 3.16Å; L14-Y17 PolarHBondContact O-N 3.04Å; Y17-A21 PolarHBondContact O-N 3.09Å
18	I	69.9	Low	75.6	Confident	109 Å²	109	106 Å²	106	56%	0.559	58%	0.582	S	S	*	*	H	α-helix	trans	-74.1	-32	177.3	-64.6	164.5	0	0	0	111.3	L14 I16 A21	L14-I18 HydrophobicContact CD2-CD1 4Å; L14-I18 WeakPolarHBondContact O-CD1 3.36Å; L14-I18 WeakPolarHBondContact O-CG1 3.37Å; L14-I18 PolarHBondContact O-N 3.29Å; I16-I18 PolarHBondContact O-N 3.07Å; I18-A21 PolarHBondContact O-N 2.73Å
19	A	65.5	Low	75.6	Confident	67 Å²	67	109.8 Å²	109.8	55%	0.554	59%	0.588	S	S	*	*	H	α-helix	trans	-67.1	-36.9	177.6	0	0	0	0	0	112.6	T15 I16 A21	T15-A19 WeakPolarHBondContact O-CB 3.46Å; T15-A19 PolarHBondContact O-N 3.44Å; I16-A19 PolarHBondContact O-N 3.09Å; A19-A21 VanDerWaalsContact C-N 3.33Å
20	D	60.1	Low	75.4	Confident	135 Å²	135	106.6 Å²	106.6	72%	0.722	58%	0.576	S	S	*	*	H	α-helix	trans	-75.8	-20.5	175.7	-78.2	-23.9	0	0	0	113.2	I16 N22	I16-D20 PolarHBondContact O-N 3.06Å; D20-N22 VanDerWaalsContact C-N 3.31Å; D20-N22 PolarHBondContact O-N 3.32Å
21	A	59	Low	75.4	Confident	70 Å²	70	108.5 Å²	108.5	58%	0.579	58%	0.576	S	S	*	*	H	α-helix	trans	-74.2	-19.3	-179.5	0	0	0	0	0	113.7	Y17 I18 A19 P23	Y17-A21 PolarHBondContact O-N 3.09Å; I18-A21 PolarHBondContact O-N 2.73Å; A19-A21 VanDerWaalsContact C-N 3.33Å; A21-P23 WeakPolarHBondContact O-CD 3.15Å
22	N	58.5	Low	75.4	Confident	125 Å²	125	110.1 Å²	110.1	67%	0.668	58%	0.581	S	S	*	*	S	Bend	trans	-101.8	93.5	167.9	-107.3	2.4	0	0	0	108	D20 I24	D20-N22 VanDerWaalsContact C-N 3.31Å; D20-N22 PolarHBondContact O-N 3.32Å; N22-I24 PolarHBondContact O-N 3.41Å
23	P	62.5	Low	75.2	Confident	98 Å²	98	109.7 Å²	109.7	64%	0.636	58%	0.575	S	S	*	*			trans	-68.1	89	162.9	30.8	-31.6	0	0	0	105.7	A21 I25	A21-P23 WeakPolarHBondContact O-CD 3.15Å; P23-I25 HydrophobicContact CB-CG1 4.34Å; P23-I25 PolarHBondContact O-N 2.58Å
24	I	66	Low	75	Confident	151 Å²	151	109.5 Å²	109.5	77%	0.774	58%	0.575	S	S	*	*			trans	-60.7	87	150.8	-75.7	171.3	0	0	0	103.3	N22 K26	N22-I24 PolarHBondContact O-N 3.41Å; I24-K26 PolarHBondContact O-N 3.41Å; I24-K26 VanDerWaalsContact O-N 3.09Å
25	I	68.3	Low	74.9	Confident	84 Å²	84	113.8 Å²	113.8	43%	0.431	58%	0.584	S	S	.	*			trans	-52.5	122.4	177.9	-74.2	172.1	0	0	0	105.2	P23 E27 Y29 A30	P23-I25 HydrophobicContact CB-CG1 4.34Å; P23-I25 PolarHBondContact O-N 2.58Å; I25-E27 PolarHBondContact O-N 3.21Å; I25-Y29 HydrophobicContact CG2-CD1 3.57Å; I25-Y29 HydrophobicContact CG2-CG 4.23Å; I25-A30 HydrophobicContact CG2-CB 3.85Å
26	K	77.3	Confident	74.8	Confident	162 Å²	162	114.4 Å²	114.4	70%	0.704	59%	0.587	S	S	*	*			trans	-51.6	134.5	175.8	-75.1	-175.4	178.2	178.7	0	108.5	I24 S28 Y29 A30	I24-K26 PolarHBondContact O-N 3.41Å; I24-K26 VanDerWaalsContact O-N 3.09Å; K26-S28 PolarHBondContact O-N 2.96Å; K26-Y29 WeakPolarHBondContact O-CA 3.33Å; K26-Y29 WeakPolarHBondContact O-CB 3.29Å; K26-Y29 PolarHBondContact O-N 3.48Å; K26-A30 PolarHBondContact O-N 2.9Å; K26-A30 VanDerWaalsContact O-N 3.07Å
27	E	78.6	Confident	74.4	Confident	131 Å²	131	118.1 Å²	118.1	61%	0.612	60%	0.6	S	S	*	*	H	α-helix	trans	-50.9	-35.3	-176.1	-169.4	-169.3	155.4	0	0	112.6	I25 A30 K31	I25-E27 PolarHBondContact O-N 3.21Å; E27-A30 PolarHBondContact O-N 3.45Å; E27-K31 HydrophobicContact CG-CD 4.19Å; E27-K31 WeakPolarHBondContact O-CB 3.42Å; E27-K31 VanDerWaalsContact O-CG 3.29Å; E27-K31 WeakPolarHBondContact O-CG 3.48Å; E27-K31 PolarHBondContact O-N 3.07Å; E27-K31 WeakPolarHBondContact OE1-CE 3.47Å; E27-K31 IonicContact OE1-NZ 2.58Å; E27-K31 PolarHBondContact OE1-NZ 3.27Å
28	S	82.7	Confident	74.1	Confident	84 Å²	84	117.9 Å²	117.9	59%	0.587	60%	0.598	S	S	*	*	H	α-helix	trans	-60.7	-43.7	174.7	53.9	0	0	0	0	113	K26 K31 Q32	K26-S28 PolarHBondContact O-N 2.96Å; S28-K31 PolarHBondContact O-N 2.93Å; S28-Q32 WeakPolarHBondContact O-CB 3.48Å; S28-Q32 PolarHBondContact O-N 2.72Å
29	Y	84.1	Confident	73.9	Confident	140 Å²	140	119.3 Å²	119.3	55%	0.549	60%	0.602	S	S	.	*	H	α-helix	trans	-72.2	-39.3	178.6	-171.4	-103.5	0	0	0	111.7	I25 K26 K31 Q32 L33	I25-Y29 HydrophobicContact CG2-CD1 3.57Å; I25-Y29 HydrophobicContact CG2-CG 4.23Å; K26-Y29 WeakPolarHBondContact O-CA 3.33Å; K26-Y29 WeakPolarHBondContact O-CB 3.29Å; K26-Y29 PolarHBondContact O-N 3.48Å; Y29-K31 PolarHBondContact O-N 2.83Å; Y29-Q32 WeakPolarHBondContact O-CB 3.16Å; Y29-Q32 PolarHBondContact O-N 3.45Å; Y29-L33 HydrophobicContact CD1-CD1 3.77Å; Y29-L33 HydrophobicContact CD1-CG 4.31Å; Y29-L33 HydrophobicContact CE1-CD1 3.49Å; Y29-L33 VanDerWaalsContact CE1-CD1 3.49Å; Y29-L33 HydrophobicContact CE1-CG 4.06Å; Y29-L33 WeakPolarHBondContact O-CG 3.48Å; Y29-L33 PolarHBondContact O-N 3.49Å
30	A	85	Confident	74.2	Confident	35 Å²	35	124.9 Å²	124.9	29%	0.289	61%	0.614	S	S	.	*	H	α-helix	trans	-60.1	-45.9	172.5	0	0	0	0	0	111.3	I25 K26 E27 Q32 L33 L34	I25-A30 HydrophobicContact CG2-CB 3.85Å; K26-A30 PolarHBondContact O-N 2.9Å; K26-A30 VanDerWaalsContact O-N 3.07Å; E27-A30 PolarHBondContact O-N 3.45Å; A30-Q32 VanDerWaalsContact C-N 3.3Å; A30-Q32 PolarHBondContact O-N 3.18Å; A30-L33 PolarHBondContact O-N 3.23Å; A30-L34 VanDerWaalsContact O-CG 3.28Å; A30-L34 WeakPolarHBondContact O-CG 3.39Å; A30-L34 PolarHBondContact O-N 3.46Å
31	K	87.4	Confident	74.5	Confident	116 Å²	116	125 Å²	125	50%	0.504	62%	0.622	S	S	.	*	H	α-helix	trans	-62.6	-36.3	175.7	-77.4	174	169.8	174.1	0	112.4	E27 S28 Y29 L34 R35	E27-K31 HydrophobicContact CG-CD 4.19Å; E27-K31 WeakPolarHBondContact O-CB 3.42Å; E27-K31 VanDerWaalsContact O-CG 3.29Å; E27-K31 WeakPolarHBondContact O-CG 3.48Å; E27-K31 PolarHBondContact O-N 3.07Å; E27-K31 WeakPolarHBondContact OE1-CE 3.47Å; E27-K31 IonicContact OE1-NZ 2.58Å; E27-K31 PolarHBondContact OE1-NZ 3.27Å; S28-K31 PolarHBondContact O-N 2.93Å; Y29-K31 PolarHBondContact O-N 2.83Å; K31-L34 PolarHBondContact O-N 3.01Å; K31-R35 PolarHBondContact O-N 3.49Å
32	Q	86.8	Confident	74.9	Confident	128 Å²	128	124.1 Å²	124.1	60%	0.598	62%	0.62	S	S	*	*	H	α-helix	trans	-66	-45.8	175.8	-170.6	127.2	-16.9	0	0	111.8	S28 Y29 A30 L34 R35 T36	S28-Q32 WeakPolarHBondContact O-CB 3.48Å; S28-Q32 PolarHBondContact O-N 2.72Å; Y29-Q32 WeakPolarHBondContact O-CB 3.16Å; Y29-Q32 PolarHBondContact O-N 3.45Å; A30-Q32 VanDerWaalsContact C-N 3.3Å; A30-Q32 PolarHBondContact O-N 3.18Å; Q32-L34 VanDerWaalsContact C-N 3.34Å; Q32-L34 PolarHBondContact O-N 3.38Å; Q32-R35 PolarHBondContact O-N 2.95Å; Q32-T36 PolarHBondContact O-N 3.2Å
33	L	84.1	Confident	75.7	Confident	72 Å²	72	123.9 Å²	123.9	38%	0.377	61%	0.614	S	S	.	*	H	α-helix	trans	-61.4	-40.9	175	-75	172.1	0	0	0	112.3	Y29 A30 R35 T36 K37	Y29-L33 HydrophobicContact CD1-CD1 3.77Å; Y29-L33 HydrophobicContact CD1-CG 4.31Å; Y29-L33 HydrophobicContact CE1-CD1 3.49Å; Y29-L33 VanDerWaalsContact CE1-CD1 3.49Å; Y29-L33 HydrophobicContact CE1-CG 4.06Å; Y29-L33 WeakPolarHBondContact O-CG 3.48Å; Y29-L33 PolarHBondContact O-N 3.49Å; A30-L33 PolarHBondContact O-N 3.23Å; L33-R35 VanDerWaalsContact C-N 3.32Å; L33-R35 PolarHBondContact O-N 3.32Å; L33-T36 PolarHBondContact O-N 3.47Å; L33-T36 PolarHBondContact O-OG1 3.11Å; L33-K37 WeakPolarHBondContact O-CG 3.28Å; L33-K37 PolarHBondContact O-N 3.03Å
34	L	82.4	Confident	76.2	Confident	110 Å²	110	122.7 Å²	122.7	58%	0.576	61%	0.607	S	S	*	*	H	α-helix	trans	-67.5	-32.8	177.2	-68.8	171.8	0	0	0	112.2	A30 K31 Q32 K37 R38	A30-L34 VanDerWaalsContact O-CG 3.28Å; A30-L34 WeakPolarHBondContact O-CG 3.39Å; A30-L34 PolarHBondContact O-N 3.46Å; K31-L34 PolarHBondContact O-N 3.01Å; Q32-L34 VanDerWaalsContact C-N 3.34Å; Q32-L34 PolarHBondContact O-N 3.38Å; L34-K37 PolarHBondContact O-N 3.47Å; L34-R38 WeakPolarHBondContact O-CG 3.43Å; L34-R38 PolarHBondContact O-N 3.49Å; L34-R38 VanDerWaalsContact O-N 3.11Å
35	R	80.4	Confident	76.7	Confident	191 Å²	191	120.2 Å²	120.2	72%	0.721	60%	0.595	S	S	*	*	H	α-helix	trans	-66.4	-39.8	174.2	-90	-178.1	174.4	154.3	-2.5	112.8	K31 Q32 L33 K37	K31-R35 PolarHBondContact O-N 3.49Å; Q32-R35 PolarHBondContact O-N 2.95Å; L33-R35 VanDerWaalsContact C-N 3.32Å; L33-R35 PolarHBondContact O-N 3.32Å; R35-K37 VanDerWaalsContact C-N 3.28Å; R35-K37 PolarHBondContact O-N 2.93Å
36	T	78.1	Confident	77.2	Confident	104 Å²	104	119.3 Å²	119.3	64%	0.638	59%	0.589	S	S	*	*	H	α-helix	trans	-73	-23.8	179	58.6	0	0	0	0	112.7	Q32 L33	Q32-T36 PolarHBondContact O-N 3.2Å; L33-T36 PolarHBondContact O-N 3.47Å; L33-T36 PolarHBondContact O-OG1 3.11Å
37	K	71.6	Confident	77.3	Confident	174 Å²	174	115.9 Å²	115.9	76%	0.757	58%	0.583	S	S	*	*	H	α-helix	trans	-92	-10	177.5	-66.8	-66.4	-172.2	-179.5	0	114.5	L33 L34 R35 Q39	L33-K37 WeakPolarHBondContact O-CG 3.28Å; L33-K37 PolarHBondContact O-N 3.03Å; L34-K37 PolarHBondContact O-N 3.47Å; R35-K37 VanDerWaalsContact C-N 3.28Å; R35-K37 PolarHBondContact O-N 2.93Å; K37-Q39 PolarHBondContact O-N 3.28Å
38	R	68.4	Low	77.6	Confident	189 Å²	189	115.1 Å²	115.1	71%	0.713	58%	0.581	S	S	*	*	S	Bend	trans	-67	122.6	173.4	-86.7	177.2	-169.6	179.1	1.7	109.3	L34 K40	L34-R38 WeakPolarHBondContact O-CG 3.43Å; L34-R38 PolarHBondContact O-N 3.49Å; L34-R38 VanDerWaalsContact O-N 3.11Å; R38-K40 PolarHBondContact O-N 3.48Å
39	Q	66.1	Low	77.7	Confident	139 Å²	139	118.2 Å²	118.2	65%	0.65	58%	0.58	S	S	*	*	P	Polyproline II helix	trans	-58.4	135.9	162.6	-158.6	162.1	11.5	0	0	107.7	K37	K37-Q39 PolarHBondContact O-N 3.28Å
40	K	70.9	Confident	77.8	Confident	184 Å²	184	117.6 Å²	117.6	80%	0.8	58%	0.582	S	S	*	*	P	Polyproline II helix	trans	-54.8	142.1	176.4	-72.6	-178.5	179.3	177.8	0	108.5	R38 G42	R38-K40 PolarHBondContact O-N 3.48Å; K40-G42 PolarHBondContact O-N 2.81Å
41	P	66	Low	78	Confident	138 Å²	138	120.7 Å²	120.7	90%	0.896	59%	0.59	S	S	*	*	S	Bend	trans	-56.4	126.6	172.8	23.8	-31.8	0	0	0	109
42	G	68.7	Low	78.3	Confident	52 Å²	52	120.1 Å²	120.1	54%	0.536	59%	0.592	S	S	.	*	S	Bend	trans	148.4	165.8	-171.9	0	0	0	0	0	110.8	K40	K40-G42 PolarHBondContact O-N 2.81Å
43	H	73.4	Confident	78.6	Confident	119 Å²	119	118.2 Å²	118.2	55%	0.551	59%	0.586	S	S	*	*			trans	-66.4	142.2	172.5	-163.7	55.7	0	0	0	109.4	D45 E46	H43-D45 IonicContact NE2-OD2 3.67Å; H43-D45 PolarHBondContact O-N 3.22Å; H43-E46 HydrophobicContact CB-CB 4.36Å; H43-E46 WeakPolarHBondContact CB-OE2 3.39Å; H43-E46 PolarHBondContact N-OE2 3Å; H43-E46 VanDerWaalsContact O-CB 3.24Å; H43-E46 WeakPolarHBondContact O-CB 3.46Å; H43-E46 PolarHBondContact O-N 2.98Å
44	P	73.1	Confident	78.9	Confident	74 Å²	74	120 Å²	120	48%	0.481	59%	0.592	S	S	.	*	T	Hydrogen-bonded Turn	trans	-52.6	-32.3	178.2	-26.4	35.1	0	0	0	112.9
45	D	76.9	Confident	79.4	Confident	99 Å²	99	118.5 Å²	118.5	53%	0.529	58%	0.583	S	S	.	*	T	Hydrogen-bonded Turn	trans	-94.7	-0.2	-176.8	-53.5	-31	0	0	0	113.6	H43 P47 M48 R49	H43-D45 IonicContact NE2-OD2 3.67Å; H43-D45 PolarHBondContact O-N 3.22Å; D45-P47 VanDerWaalsContact C-CD 3.46Å; D45-M48 PolarHBondContact O-N 3.04Å; D45-M48 VanDerWaalsContact O-N 3.08Å; D45-R49 WeakPolarHBondContact O-CB 3.42Å; D45-R49 PolarHBondContact O-N 3.06Å
46	E	78.4	Confident	80	Confident	65 Å²	65	115.4 Å²	115.4	30%	0.304	58%	0.576	S	S	.	*	H	α-helix	trans	-49.4	-47.7	177.7	-149.2	102.3	-130	0	0	113.4	H43 M48 R49 E50	H43-E46 HydrophobicContact CB-CB 4.36Å; H43-E46 WeakPolarHBondContact CB-OE2 3.39Å; H43-E46 PolarHBondContact N-OE2 3Å; H43-E46 VanDerWaalsContact O-CB 3.24Å; H43-E46 WeakPolarHBondContact O-CB 3.46Å; H43-E46 PolarHBondContact O-N 2.98Å; E46-M48 VanDerWaalsContact C-N 3.32Å; E46-M48 PolarHBondContact O-N 3.16Å; E46-R49 PolarHBondContact O-N 3.22Å; E46-R49 IonicContact OE1-NH1 3.71Å; E46-E50 WeakPolarHBondContact O-CG 3.49Å; E46-E50 PolarHBondContact O-N 2.99Å
47	P	80.1	Confident	80.7	Confident	90 Å²	90	113.4 Å²	113.4	58%	0.584	56%	0.564	S	S	*	*	H	α-helix	trans	-66.7	-34.2	179.6	25.6	-34.2	0	0	0	112.8	D45 H51	D45-P47 VanDerWaalsContact C-CD 3.46Å; P47-H51 WeakPolarHBondContact O-CB 3.24Å; P47-H51 PolarHBondContact O-N 2.88Å; P47-H51 VanDerWaalsContact O-N 3.16Å
48	M	84.3	Confident	81.3	Confident	115 Å²	115	108.5 Å²	108.5	57%	0.567	55%	0.546	S	S	*	.	H	α-helix	trans	-70.3	-42.6	176.3	-175.1	61.8	78.8	0	0	110.4	D45 E46 H51 L52	D45-M48 PolarHBondContact O-N 3.04Å; D45-M48 VanDerWaalsContact O-N 3.08Å; E46-M48 VanDerWaalsContact C-N 3.32Å; E46-M48 PolarHBondContact O-N 3.16Å; M48-H51 PolarHBondContact O-N 3.36Å; M48-L52 HydrophobicContact CG-CD1 4.11Å; M48-L52 HydrophobicContact CG-CG 4.48Å; M48-L52 VanDerWaalsContact O-CG 3.3Å; M48-L52 WeakPolarHBondContact O-CG 3.22Å; M48-L52 PolarHBondContact O-N 3.27Å
49	R	86.1	Confident	82.3	Confident	149 Å²	149	104.2 Å²	104.2	56%	0.562	54%	0.537	S	S	*	.	H	α-helix	trans	-60.8	-46.7	177.6	-177.7	-177.2	176.3	-139.1	-0.6	111.7	D45 E46 H51 L52 L53	D45-R49 WeakPolarHBondContact O-CB 3.42Å; D45-R49 PolarHBondContact O-N 3.06Å; E46-R49 PolarHBondContact O-N 3.22Å; E46-R49 IonicContact OE1-NH1 3.71Å; R49-H51 VanDerWaalsContact C-N 3.33Å; R49-H51 PolarHBondContact O-N 3.41Å; R49-L52 PolarHBondContact O-N 2.93Å; R49-L53 HydrophobicContact CG-CD1 4.29Å; R49-L53 WeakPolarHBondContact O-CG 3.3Å; R49-L53 PolarHBondContact O-N 3.48Å
50	E	85.6	Confident	83.2	Confident	127 Å²	127	102.6 Å²	102.6	59%	0.593	53%	0.53	S	S	*	.	H	α-helix	trans	-61.2	-42	176.5	-73	178.2	176	0	0	111.8	E46 L53 H54	E46-E50 WeakPolarHBondContact O-CG 3.49Å; E46-E50 PolarHBondContact O-N 2.99Å; E50-L53 PolarHBondContact O-N 2.82Å; E50-H54 PolarHBondContact O-N 3.31Å
51	H	90	Very high	83.7	Confident	100 Å²	100	101 Å²	101	46%	0.463	52%	0.519	S	S	.	.	H	α-helix	trans	-62.6	-46.1	176.2	-178.7	63.9	0	0	0	112.2	P47 M48 R49 L53 H54 M55	P47-H51 WeakPolarHBondContact O-CB 3.24Å; P47-H51 PolarHBondContact O-N 2.88Å; P47-H51 VanDerWaalsContact O-N 3.16Å; M48-H51 PolarHBondContact O-N 3.36Å; R49-H51 VanDerWaalsContact C-N 3.33Å; R49-H51 PolarHBondContact O-N 3.41Å; H51-L53 PolarHBondContact O-N 3.39Å; H51-H54 WeakPolarHBondContact O-CB 3.37Å; H51-H54 PolarHBondContact O-N 3.02Å; H51-M55 WeakPolarHBondContact O-CG 3.32Å; H51-M55 PolarHBondContact O-N 3.39Å
52	L	91.9	Very high	84.4	Confident	104 Å²	104	97 Å²	97	55%	0.545	50%	0.497	S	S	.	.	H	α-helix	trans	-62.7	-41.8	178.4	-71.5	171.1	0	0	0	112.1	M48 R49 H54 M55 Q56	M48-L52 HydrophobicContact CG-CD1 4.11Å; M48-L52 HydrophobicContact CG-CG 4.48Å; M48-L52 VanDerWaalsContact O-CG 3.3Å; M48-L52 WeakPolarHBondContact O-CG 3.22Å; M48-L52 PolarHBondContact O-N 3.27Å; R49-L52 PolarHBondContact O-N 2.93Å; L52-H54 VanDerWaalsContact C-N 3.3Å; L52-H54 PolarHBondContact O-N 2.91Å; L52-M55 PolarHBondContact O-N 2.94Å; L52-Q56 WeakPolarHBondContact O-CB 3.38Å; L52-Q56 PolarHBondContact O-N 3.19Å
53	L	93.6	Very high	85	Confident	88 Å²	88	100.7 Å²	100.7	46%	0.461	50%	0.5	S	S	.	.	H	α-helix	trans	-61.3	-40.1	174.7	-72.7	170.3	0	0	0	111.6	R49 E50 H51 Q56 V57	R49-L53 HydrophobicContact CG-CD1 4.29Å; R49-L53 WeakPolarHBondContact O-CG 3.3Å; R49-L53 PolarHBondContact O-N 3.48Å; E50-L53 PolarHBondContact O-N 2.82Å; H51-L53 PolarHBondContact O-N 3.39Å; L53-Q56 PolarHBondContact O-N 3.08Å; L53-V57 WeakPolarHBondContact O-CG2 3.3Å; L53-V57 PolarHBondContact O-N 3.31Å
54	H	91.6	Very high	85.2	Confident	110 Å²	110	99.3 Å²	99.3	51%	0.509	49%	0.494	S	S	.	.	H	α-helix	trans	-64	-46	175.5	-177.4	61.5	0	0	0	112	E50 H51 L52 Q56 V57 L58	E50-H54 PolarHBondContact O-N 3.31Å; H51-H54 WeakPolarHBondContact O-CB 3.37Å; H51-H54 PolarHBondContact O-N 3.02Å; L52-H54 VanDerWaalsContact C-N 3.3Å; L52-H54 PolarHBondContact O-N 2.91Å; H54-Q56 VanDerWaalsContact C-N 3.28Å; H54-Q56 PolarHBondContact O-N 2.94Å; H54-V57 PolarHBondContact O-N 3.16Å; H54-L58 PolarHBondContact O-N 3.23Å; H54-L58 VanDerWaalsContact O-N 3.16Å
55	M	91.6	Very high	85	Confident	77 Å²	77	98.5 Å²	98.5	38%	0.379	49%	0.488	S	S	.	.	H	α-helix	trans	-59.1	-41	176.5	-68.9	-55.9	-61.6	0	0	111.6	H51 L52 V57 L58 D59	H51-M55 WeakPolarHBondContact O-CG 3.32Å; H51-M55 PolarHBondContact O-N 3.39Å; L52-M55 PolarHBondContact O-N 2.94Å; M55-V57 VanDerWaalsContact C-N 3.34Å; M55-V57 PolarHBondContact O-N 3.44Å; M55-L58 WeakPolarHBondContact O-CB 3.44Å; M55-L58 PolarHBondContact O-N 3.47Å; M55-L58 VanDerWaalsContact O-N 3.14Å; M55-L58 HydrophobicContact SD-CD1 4.27Å; M55-D59 PolarHBondContact O-N 3.29Å
56	Q	93.9	Very high	84.9	Confident	126 Å²	126	98 Å²	98	59%	0.589	49%	0.485	S	S	*	.	H	α-helix	trans	-61.3	-40	178.1	-171.4	176.9	0.7	0	0	112.7	L52 L53 H54 L58 D59 Q60	L52-Q56 WeakPolarHBondContact O-CB 3.38Å; L52-Q56 PolarHBondContact O-N 3.19Å; L53-Q56 PolarHBondContact O-N 3.08Å; H54-Q56 VanDerWaalsContact C-N 3.28Å; H54-Q56 PolarHBondContact O-N 2.94Å; Q56-L58 VanDerWaalsContact C-N 3.34Å; Q56-D59 PolarHBondContact O-N 3.03Å; Q56-Q60 PolarHBondContact O-N 3.45Å
57	V	91.3	Very high	84.5	Confident	63 Å²	63	100 Å²	100	38%	0.382	50%	0.498	S	S	.	.	H	α-helix	trans	-65.7	-38.5	175.6	172.1	0	0	0	0	111.3	L53 H54 M55 Q60 R61	L53-V57 WeakPolarHBondContact O-CG2 3.3Å; L53-V57 PolarHBondContact O-N 3.31Å; H54-V57 PolarHBondContact O-N 3.16Å; M55-V57 VanDerWaalsContact C-N 3.34Å; M55-V57 PolarHBondContact O-N 3.44Å; V57-Q60 PolarHBondContact O-N 2.91Å; V57-R61 WeakPolarHBondContact O-CG 3.41Å; V57-R61 PolarHBondContact O-N 3.17Å; V57-R61 VanDerWaalsContact O-N 3.07Å
58	L	85.8	Confident	83.9	Confident	71 Å²	71	98.6 Å²	98.6	37%	0.372	48%	0.483	S	S	.	.	H	α-helix	trans	-66	-42.9	176.8	-66.8	177.1	0	0	0	111.7	H54 M55 Q56 Q60 R61 A62	H54-L58 PolarHBondContact O-N 3.23Å; H54-L58 VanDerWaalsContact O-N 3.16Å; M55-L58 WeakPolarHBondContact O-CB 3.44Å; M55-L58 PolarHBondContact O-N 3.47Å; M55-L58 VanDerWaalsContact O-N 3.14Å; M55-L58 HydrophobicContact SD-CD1 4.27Å; Q56-L58 VanDerWaalsContact C-N 3.34Å; L58-Q60 VanDerWaalsContact C-N 3.35Å; L58-R61 PolarHBondContact O-N 3.07Å; L58-A62 WeakPolarHBondContact O-CB 3.48Å; L58-A62 PolarHBondContact O-N 3.49Å
59	D	87.9	Confident	83	Confident	99 Å²	99	97.1 Å²	97.1	53%	0.529	48%	0.475	S	S	.	.	H	α-helix	trans	-62.1	-43.1	176.4	-81.8	-11.8	0	0	0	111.5	M55 Q56 R61 A62 Q63	M55-D59 PolarHBondContact O-N 3.29Å; Q56-D59 PolarHBondContact O-N 3.03Å; D59-R61 PolarHBondContact O-N 3.47Å; D59-A62 PolarHBondContact O-N 3.01Å; D59-Q63 WeakPolarHBondContact O-CG 3.33Å; D59-Q63 PolarHBondContact O-N 3.14Å
60	Q	86.2	Confident	81.9	Confident	105 Å²	105	99.4 Å²	99.4	49%	0.491	48%	0.483	S	S	.	.	H	α-helix	trans	-59.7	-46.8	175.8	-175.6	179.5	-14.5	0	0	111.2	Q56 V57 L58 A62 Q63 E64	Q56-Q60 PolarHBondContact O-N 3.45Å; V57-Q60 PolarHBondContact O-N 2.91Å; L58-Q60 VanDerWaalsContact C-N 3.35Å; Q60-A62 VanDerWaalsContact C-N 3.31Å; Q60-A62 PolarHBondContact O-N 3.29Å; Q60-Q63 PolarHBondContact O-N 2.71Å; Q60-E64 WeakPolarHBondContact CG-OE1 3.48Å; Q60-E64 PolarHBondContact NE2-OE1 3.41Å; Q60-E64 WeakPolarHBondContact O-CG 3.33Å; Q60-E64 PolarHBondContact O-N 3.39Å
61	R	82.1	Confident	80.9	Confident	151 Å²	151	100.7 Å²	100.7	57%	0.57	49%	0.493	S	S	*	.	H	α-helix	trans	-61.9	-38.7	176.5	-72	-178	-161.9	-174.3	4.3	112.3	V57 L58 D59 Q63 E64 T65	V57-R61 WeakPolarHBondContact O-CG 3.41Å; V57-R61 PolarHBondContact O-N 3.17Å; V57-R61 VanDerWaalsContact O-N 3.07Å; L58-R61 PolarHBondContact O-N 3.07Å; D59-R61 PolarHBondContact O-N 3.47Å; R61-Q63 VanDerWaalsContact C-N 3.32Å; R61-E64 PolarHBondContact O-N 3.44Å; R61-T65 WeakPolarHBondContact O-CG2 3.32Å; R61-T65 PolarHBondContact O-N 3.29Å; R61-T65 PolarHBondContact O-OG1 3.36Å
62	A	80.2	Confident	79.5	Confident	53 Å²	53	99.2 Å²	99.2	44%	0.438	49%	0.489	S	S	.	.	H	α-helix	trans	-65.8	-35.8	177.3	0	0	0	0	0	112.1	L58 D59 Q60 T65 N66	L58-A62 WeakPolarHBondContact O-CB 3.48Å; L58-A62 PolarHBondContact O-N 3.49Å; D59-A62 PolarHBondContact O-N 3.01Å; Q60-A62 VanDerWaalsContact C-N 3.31Å; Q60-A62 PolarHBondContact O-N 3.29Å; A62-T65 PolarHBondContact O-OG1 2.95Å; A62-T65 VanDerWaalsContact O-OG1 3.1Å; A62-N66 WeakPolarHBondContact O-CB 3.37Å; A62-N66 PolarHBondContact O-N 3.15Å
63	Q	81.6	Confident	78.1	Confident	129 Å²	129	99 Å²	99	60%	0.603	49%	0.494	S	S	*	.	H	α-helix	trans	-68.2	-43.6	173.6	-71.3	178.2	0.9	0	0	111.8	D59 Q60 R61 N66 L67	D59-Q63 WeakPolarHBondContact O-CG 3.33Å; D59-Q63 PolarHBondContact O-N 3.14Å; Q60-Q63 PolarHBondContact O-N 2.71Å; R61-Q63 VanDerWaalsContact C-N 3.32Å; Q63-N66 PolarHBondContact O-N 3.1Å; Q63-L67 WeakPolarHBondContact O-CB 3.48Å; Q63-L67 VanDerWaalsContact O-CG 3.3Å; Q63-L67 WeakPolarHBondContact O-CG 3.48Å; Q63-L67 PolarHBondContact O-N 3.22Å
64	E	77.7	Confident	76.7	Confident	90 Å²	90	102.5 Å²	102.5	42%	0.421	51%	0.508	S	S	.	.	H	α-helix	trans	-59.9	-49.4	176.8	-71.6	168.8	-176.7	0	0	111	Q60 R61 N66 L67 E68	Q60-E64 WeakPolarHBondContact CG-OE1 3.48Å; Q60-E64 PolarHBondContact NE2-OE1 3.41Å; Q60-E64 WeakPolarHBondContact O-CG 3.33Å; Q60-E64 PolarHBondContact O-N 3.39Å; R61-E64 PolarHBondContact O-N 3.44Å; E64-N66 VanDerWaalsContact C-N 3.34Å; E64-N66 PolarHBondContact O-N 2.94Å; E64-L67 PolarHBondContact O-N 2.94Å; E64-E68 VanDerWaalsContact O-CG 3.32Å; E64-E68 WeakPolarHBondContact O-CG 3.45Å; E64-E68 PolarHBondContact O-N 3.32Å
65	T	68.8	Low	75.2	Confident	58 Å²	58	98.7 Å²	98.7	36%	0.356	49%	0.493	S	S	.	.	H	α-helix	trans	-66	-35.6	178.5	57.5	0	0	0	0	112.9	R61 A62 H69	R61-T65 WeakPolarHBondContact O-CG2 3.32Å; R61-T65 PolarHBondContact O-N 3.29Å; R61-T65 PolarHBondContact O-OG1 3.36Å; A62-T65 PolarHBondContact O-OG1 2.95Å; A62-T65 VanDerWaalsContact O-OG1 3.1Å; T65-H69 WeakPolarHBondContact O-CB 3.45Å; T65-H69 PolarHBondContact O-N 3.3Å
66	N	73.4	Confident	73.6	Confident	87 Å²	87	104 Å²	104	47%	0.465	51%	0.51	S	S	.	.	H	α-helix	trans	-64.4	-48.8	174.8	-168.7	-6.2	0	0	0	110.4	A62 Q63 E64 E68 H69 W70	A62-N66 WeakPolarHBondContact O-CB 3.37Å; A62-N66 PolarHBondContact O-N 3.15Å; Q63-N66 PolarHBondContact O-N 3.1Å; E64-N66 VanDerWaalsContact C-N 3.34Å; E64-N66 PolarHBondContact O-N 2.94Å; N66-E68 VanDerWaalsContact C-N 3.33Å; N66-E68 PolarHBondContact O-N 3.4Å; N66-H69 WeakPolarHBondContact O-CB 3.44Å; N66-H69 PolarHBondContact O-N 3.42Å; N66-H69 VanDerWaalsContact O-N 3.15Å; N66-W70 PolarHBondContact O-N 2.95Å; N66-W70 PolarHBondContact OD1-NE1 2.92Å
67	L	70.4	Confident	71.8	Confident	109 Å²	109	102.7 Å²	102.7	57%	0.571	51%	0.512	S	S	*	.	H	α-helix	trans	-59.9	-41	176.6	-73.2	169	0	0	0	112.4	Q63 E64 H69 W70 L71	Q63-L67 WeakPolarHBondContact O-CB 3.48Å; Q63-L67 VanDerWaalsContact O-CG 3.3Å; Q63-L67 WeakPolarHBondContact O-CG 3.48Å; Q63-L67 PolarHBondContact O-N 3.22Å; E64-L67 PolarHBondContact O-N 2.94Å; L67-H69 VanDerWaalsContact C-N 3.34Å; L67-H69 PolarHBondContact O-N 2.93Å; L67-W70 PolarHBondContact O-N 3.38Å; L67-L71 WeakPolarHBondContact O-CB 3.18Å; L67-L71 WeakPolarHBondContact O-CG 3.3Å; L67-L71 PolarHBondContact O-N 2.96Å
68	E	67.8	Low	70.1	Confident	60 Å²	60	110.8 Å²	110.8	28%	0.28	54%	0.536	S	S	.	.	H	α-helix	trans	-62.6	-39.4	175.3	-73.4	179.4	159.8	0	0	112.3	E64 N66 L71 N72	E64-E68 VanDerWaalsContact O-CG 3.32Å; E64-E68 WeakPolarHBondContact O-CG 3.45Å; E64-E68 PolarHBondContact O-N 3.32Å; N66-E68 VanDerWaalsContact C-N 3.33Å; N66-E68 PolarHBondContact O-N 3.4Å; E68-L71 PolarHBondContact O-N 2.84Å; E68-N72 PolarHBondContact O-N 2.93Å
69	H	65	Low	68.6	Low	84 Å²	84	109.6 Å²	109.6	39%	0.389	53%	0.533	S	S	.	.	H	α-helix	trans	-65.8	-39.8	174.1	-178.2	69.6	0	0	0	112.5	T65 N66 L67 N72 C75	T65-H69 WeakPolarHBondContact O-CB 3.45Å; T65-H69 PolarHBondContact O-N 3.3Å; N66-H69 WeakPolarHBondContact O-CB 3.44Å; N66-H69 PolarHBondContact O-N 3.42Å; N66-H69 VanDerWaalsContact O-N 3.15Å; L67-H69 VanDerWaalsContact C-N 3.34Å; L67-H69 PolarHBondContact O-N 2.93Å; H69-N72 CarbonylContact O-C 3.21Å; H69-N72 PolarHBondContact O-N 3.2Å; H69-N72 VanDerWaalsContact O-O 3.13Å; H69-C75 PolarHBondContact ND1-O 3.01Å
70	W	62.7	Low	67	Low	197 Å²	197	108.3 Å²	108.3	75%	0.746	53%	0.526	S	S	*	.	H	α-helix	trans	-65.1	-38.5	175.4	-83.2	98.7	0	0	0	112.8	N66 L67	N66-W70 PolarHBondContact O-N 2.95Å; N66-W70 PolarHBondContact OD1-NE1 2.92Å; L67-W70 PolarHBondContact O-N 3.38Å
71	L	65.8	Low	65.3	Low	153 Å²	153	113.3 Å²	113.3	80%	0.801	54%	0.541	S	S	*	.	H	α-helix	trans	-79.2	-19.6	-178.7	-69.9	167.5	0	0	0	113	L67 E68	L67-L71 WeakPolarHBondContact O-CB 3.18Å; L67-L71 WeakPolarHBondContact O-CG 3.3Å; L67-L71 PolarHBondContact O-N 2.96Å; E68-L71 PolarHBondContact O-N 2.84Å
72	N	59.3	Low	63.9	Low	69 Å²	69	112.7 Å²	112.7	37%	0.369	55%	0.549	S	S	.	.			trans	-143.3	98.5	173.5	-175.4	3.6	0	0	0	110.8	E68 H69 H74 C75	E68-N72 PolarHBondContact O-N 2.93Å; H69-N72 CarbonylContact O-C 3.21Å; H69-N72 PolarHBondContact O-N 3.2Å; H69-N72 VanDerWaalsContact O-O 3.13Å; N72-H74 PolarHBondContact O-N 3.2Å; N72-H74 PolarHBondContact OD1-N 3.39Å; N72-C75 HydrophobicContact CB-CB 4.24Å; N72-C75 PolarHBondContact ND2-SG 3.49Å; N72-C75 VanDerWaalsContact ND2-SG 3.36Å; N72-C75 WeakPolarHBondContact O-CB 3.43Å; N72-C75 PolarHBondContact O-N 3.15Å
73	P	63	Low	62.3	Low	101 Å²	101	119.8 Å²	119.8	66%	0.656	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.3	-16.1	-179.6	-23.8	33.2	0	0	0	114.8
74	H	64.8	Low	60.5	Low	161 Å²	161	116.2 Å²	116.2	75%	0.745	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	-7.2	174.9	-63.5	-67.3	0	0	0	113.4	N72 Y76	N72-H74 PolarHBondContact O-N 3.2Å; N72-H74 PolarHBondContact OD1-N 3.39Å; H74-Y76 PolarHBondContact O-N 3.45Å
75	C	59	Low	58.5	Low	29 Å²	29	120.4 Å²	120.4	20%	0.196	58%	0.583	C	S	.	*	S	Bend	trans	-78.9	112.5	171.1	-86.4	0	0	0	0	109.8	H69 N72 C79	H69-C75 PolarHBondContact ND1-O 3.01Å; N72-C75 HydrophobicContact CB-CB 4.24Å; N72-C75 PolarHBondContact ND2-SG 3.49Å; N72-C75 VanDerWaalsContact ND2-SG 3.36Å; N72-C75 WeakPolarHBondContact O-CB 3.43Å; N72-C75 PolarHBondContact O-N 3.15Å; C75-C79 VanDerWaalsContact CA-SG 3.51Å; C75-C79 HydrophobicContact CB-CB 3.69Å; C75-C79 VanDerWaalsContact SG-CB 3.55Å
76	Y	59	Low	57.2	Low	190 Å²	190	123.5 Å²	123.5	75%	0.745	60%	0.604	S	S	*	*			trans	-62.7	157	168.9	-77.2	-80.6	0	0	0	110.6	H74 R78 C79	H74-Y76 PolarHBondContact O-N 3.45Å; Y76-R78 PolarHBondContact O-N 3.06Å; Y76-C79 PolarHBondContact N-SG 2.95Å; Y76-C79 WeakPolarHBondContact O-CB 3.4Å; Y76-C79 PolarHBondContact O-N 3.39Å; Y76-C79 PolarHBondContact O-SG 2.9Å; Y76-C79 VanDerWaalsContact O-SG 3.41Å
77	P	56.3	Low	55.8	Low	98 Å²	98	129.4 Å²	129.4	64%	0.636	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.9	8.9	-170.8	22.2	-33.5	0	0	0	116.5
78	R	55.2	Low	55.1	Low	232 Å²	232	130.5 Å²	130.5	88%	0.875	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-134.1	30.5	173	-63.6	-162	-65.8	-113.7	1.3	112.6	Y76 D80	Y76-R78 PolarHBondContact O-N 3.06Å; R78-D80 VanDerWaalsContact C-N 3.25Å; R78-D80 PolarHBondContact O-N 3.37Å
79	C	53.6	Low	54.4	Low	47 Å²	47	134.2 Å²	134.2	32%	0.318	67%	0.666	S	S	.	*			trans	-74.3	83	172.8	-79.8	0	0	0	0	109.4	C75 Y76 R81	C75-C79 VanDerWaalsContact CA-SG 3.51Å; C75-C79 HydrophobicContact CB-CB 3.69Å; C75-C79 VanDerWaalsContact SG-CB 3.55Å; Y76-C79 PolarHBondContact N-SG 2.95Å; Y76-C79 WeakPolarHBondContact O-CB 3.4Å; Y76-C79 PolarHBondContact O-N 3.39Å; Y76-C79 PolarHBondContact O-SG 2.9Å; Y76-C79 VanDerWaalsContact O-SG 3.41Å; C79-R81 PolarHBondContact O-N 3.03Å; C79-R81 VanDerWaalsContact O-N 3.17Å
80	D	54.6	Low	53.8	Low	71 Å²	71	136.9 Å²	136.9	38%	0.38	68%	0.681	S	S	.	*			trans	-62.6	116.3	167.1	-173.8	-19.2	0	0	0	108.2	R78 N82 Y83 G84	R78-D80 VanDerWaalsContact C-N 3.25Å; R78-D80 PolarHBondContact O-N 3.37Å; D80-N82 PolarHBondContact O-N 2.94Å; D80-N82 VanDerWaalsContact OD1-CB 3.3Å; D80-N82 WeakPolarHBondContact OD1-CB 3.49Å; D80-N82 PolarHBondContact OD1-N 2.87Å; D80-N82 PolarHBondContact OD1-ND2 3Å; D80-Y83 HydrophobicContact CB-CD2 4.27Å; D80-Y83 PolarHBondContact O-N 2.95Å; D80-Y83 VanDerWaalsContact OD2-CD2 3.22Å; D80-Y83 WeakPolarHBondContact OD2-CD2 3.34Å; D80-G84 PolarHBondContact O-N 3.47Å
81	R	50.2	Low	53.3	Low	211 Å²	211	133.4 Å²	133.4	80%	0.796	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55	-18.4	176.3	-164.2	172.8	113.2	-178.6	3.3	113.1	C79	C79-R81 PolarHBondContact O-N 3.03Å; C79-R81 VanDerWaalsContact O-N 3.17Å
82	N	52.9	Low	52.5	Low	138 Å²	138	132.2 Å²	132.2	74%	0.738	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.2	-11.6	176.2	-52.7	-65.9	0	0	0	114.5	D80	D80-N82 PolarHBondContact O-N 2.94Å; D80-N82 VanDerWaalsContact OD1-CB 3.3Å; D80-N82 WeakPolarHBondContact OD1-CB 3.49Å; D80-N82 PolarHBondContact OD1-N 2.87Å; D80-N82 PolarHBondContact OD1-ND2 3Å
83	Y	47.6	Very low	52.1	Low	201 Å²	201	136.4 Å²	136.4	79%	0.788	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.6	-2.2	-179.8	-76.7	-95.2	0	0	0	114.3	D80 H85	D80-Y83 HydrophobicContact CB-CD2 4.27Å; D80-Y83 PolarHBondContact O-N 2.95Å; D80-Y83 VanDerWaalsContact OD2-CD2 3.22Å; D80-Y83 WeakPolarHBondContact OD2-CD2 3.34Å; Y83-H85 PolarHBondContact O-N 3Å
84	G	44.5	Very low	51.3	Low	55 Å²	55	138.9 Å²	138.9	57%	0.567	69%	0.692	S	S	*	*			trans	-71.3	113.5	171.2	0	0	0	0	0	111.1	D80	D80-G84 PolarHBondContact O-N 3.47Å
85	H	35.8	Very low	50.3	Low	177 Å²	177	137.2 Å²	137.2	82%	0.819	69%	0.688	S	S	*	*			trans	-53.2	131.5	167.6	-101.4	-58.1	0	0	0	109.5	Y83 V87	Y83-H85 PolarHBondContact O-N 3Å; H85-V87 PolarHBondContact O-N 3.28Å
86	P	40.8	Very low	49.5	Very low	123 Å²	123	146.3 Å²	146.3	80%	0.799	73%	0.729	S	S	*	*			trans	-65.1	127.1	173.3	27.8	-31.8	0	0	0	108.3
87	V	44	Very low	48.7	Very low	212 Å²	212	142.3 Å²	142.3	100%	1.285	73%	0.727	S	S	*	*			trans	-103.4	0	163.4	-162.4	0	0	0	0	107.4	H85	H85-V87 PolarHBondContact O-N 3.28Å

Retrieved 87 of 87 residues in 17.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).