A0A060XIR8_ONCMY Loading...

MICOS complex subunit MIC13

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

AlphaFold DB , UniProt , Accession A0A060XIR8, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110521421, Length 111 aa.

						>A0A060XIR8_ONCMY|A0A060XIR8|LOC110521421
MAAKLLPVLKLATKVTIAGGALYVTYDSGLLGGSAQGSEVLGKAKAAIPPAVDEWVKYFGFELPAFPKMGFSPVEAWNSGVQSSISALSSGPTALGGYTNQGLQYLKDLTK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.1	Low	73.6	Confident	214 Å²	214	119.4 Å²	119.4	100%	1.054	66%	0.655	S	S	*	*				0	-40.4	0	-84.7	-168.9	-85.1	0	113.9	A3 K4	M1-A3 VanDerWaalsContact C-N 3.34Å; M1-A3 PolarHBondContact O-N 3.38Å; M1-K4 PolarHBondContact O-N 3.17Å
2	A	56.8	Low	74.7	Confident	79 Å²	79	113.3 Å²	113.3	65%	0.653	63%	0.633	S	S	*	*	H	α-helix	trans	-57.9	-35.2	179.8	0	0	0	0	115.5	K4 L5 L6	A2-K4 VanDerWaalsContact C-N 3.26Å; A2-K4 PolarHBondContact O-N 2.71Å; A2-L5 PolarHBondContact O-N 3.04Å; A2-L5 VanDerWaalsContact O-N 3.11Å; A2-L6 PolarHBondContact O-N 3.42Å
3	A	58.8	Low	75.6	Confident	88 Å²	88	109.8 Å²	109.8	73%	0.727	62%	0.617	S	S	*	*	H	α-helix	trans	-66.1	-22.1	-179.4	0	0	0	0	114.6	M1 P7	M1-A3 VanDerWaalsContact C-N 3.34Å; M1-A3 PolarHBondContact O-N 3.38Å; A3-P7 WeakPolarHBondContact O-CD 3.32Å
4	K	62.6	Low	76.6	Confident	178 Å²	178	112.9 Å²	112.9	77%	0.774	62%	0.62	S	S	*	*	H	α-helix	trans	-87.7	-15.4	174.7	-70	-168.5	176.7	-172.2	113.2	M1 A2 V8	M1-K4 PolarHBondContact O-N 3.17Å; A2-K4 VanDerWaalsContact C-N 3.26Å; A2-K4 PolarHBondContact O-N 2.71Å; K4-V8 WeakPolarHBondContact O-CG2 3.39Å
5	L	72.7	Confident	77.5	Confident	120 Å²	120	111.5 Å²	111.5	63%	0.628	62%	0.616	S	S	*	*	H	α-helix	trans	-82.5	-34.7	179.3	-78.2	161.9	0	0	112.4	A2 V8 L9	A2-L5 PolarHBondContact O-N 3.04Å; A2-L5 VanDerWaalsContact O-N 3.11Å; L5-V8 PolarHBondContact O-N 3.12Å; L5-L9 WeakPolarHBondContact O-CB 3.37Å; L5-L9 PolarHBondContact O-N 3Å
6	L	79.3	Confident	78.2	Confident	105 Å²	105	110.9 Å²	110.9	55%	0.55	62%	0.617	S	S	.	*	H	α-helix	trans	-61.3	-43.4	-179.8	-171.2	76	0	0	113.6	A2 K10	A2-L6 PolarHBondContact O-N 3.42Å; L6-K10 WeakPolarHBondContact O-CB 3.43Å; L6-K10 WeakPolarHBondContact O-CG 3.39Å; L6-K10 PolarHBondContact O-N 3.3Å
7	P	80.1	Confident	78.8	Confident	77 Å²	77	111.4 Å²	111.4	50%	0.5	62%	0.616	S	S	.	*	H	α-helix	trans	-64.9	-39	175.4	-20.2	32.9	0	0	112.6	A3 K10 L11	A3-P7 WeakPolarHBondContact O-CD 3.32Å; P7-K10 PolarHBondContact O-N 3Å; P7-L11 WeakPolarHBondContact O-CB 3.42Å; P7-L11 PolarHBondContact O-N 2.87Å
8	V	84.4	Confident	79.2	Confident	94 Å²	94	108.1 Å²	108.1	57%	0.57	61%	0.606	S	S	*	*	H	α-helix	trans	-67.8	-43.6	179.2	175.9	0	0	0	110.8	K4 L5 L11 A12	K4-V8 WeakPolarHBondContact O-CG2 3.39Å; L5-V8 PolarHBondContact O-N 3.12Å; V8-L11 PolarHBondContact O-N 3.01Å; V8-A12 WeakPolarHBondContact O-CB 3.44Å; V8-A12 PolarHBondContact O-N 2.92Å
9	L	87.6	Confident	79.6	Confident	110 Å²	110	104.4 Å²	104.4	58%	0.576	59%	0.594	S	S	*	*	H	α-helix	trans	-61.8	-45.9	175.4	-176.9	63.2	0	0	111.1	L5 L11 A12 T13	L5-L9 WeakPolarHBondContact O-CB 3.37Å; L5-L9 PolarHBondContact O-N 3Å; L9-L11 VanDerWaalsContact C-N 3.28Å; L9-L11 PolarHBondContact O-N 3.43Å; L9-A12 PolarHBondContact O-N 3.38Å; L9-T13 PolarHBondContact O-N 2.93Å; L9-T13 PolarHBondContact O-OG1 2.91Å
10	K	85.3	Confident	79.9	Confident	135 Å²	135	100.9 Å²	100.9	59%	0.587	58%	0.582	S	S	*	*	H	α-helix	trans	-57.5	-41.5	174.8	-83.5	-175.7	168.2	-178	112.2	L6 P7 K14	L6-K10 WeakPolarHBondContact O-CB 3.43Å; L6-K10 WeakPolarHBondContact O-CG 3.39Å; L6-K10 PolarHBondContact O-N 3.3Å; P7-K10 PolarHBondContact O-N 3Å; K10-K14 WeakPolarHBondContact O-CG 3.43Å; K10-K14 PolarHBondContact O-N 3.02Å; K10-K14 VanDerWaalsContact O-N 3.15Å
11	L	87.8	Confident	80	Confident	113 Å²	113	98.7 Å²	98.7	59%	0.592	58%	0.576	S	S	*	*	H	α-helix	trans	-69.1	-45.6	179	-170.2	136.6	0	0	111.2	P7 V8 L9 T13 K14 V15	P7-L11 WeakPolarHBondContact O-CB 3.42Å; P7-L11 PolarHBondContact O-N 2.87Å; V8-L11 PolarHBondContact O-N 3.01Å; L9-L11 VanDerWaalsContact C-N 3.28Å; L9-L11 PolarHBondContact O-N 3.43Å; L11-T13 PolarHBondContact O-N 3.33Å; L11-K14 PolarHBondContact O-N 2.93Å; L11-V15 HydrophobicContact CD2-CG2 4.11Å; L11-V15 WeakPolarHBondContact O-CG2 3.4Å; L11-V15 PolarHBondContact O-N 3.3Å
12	A	87.5	Confident	81.3	Confident	47 Å²	47	93.8 Å²	93.8	39%	0.388	55%	0.554	S	S	.	*	H	α-helix	trans	-57.9	-46.6	176.2	0	0	0	0	111.4	V8 L9 K14 V15 T16	V8-A12 WeakPolarHBondContact O-CB 3.44Å; V8-A12 PolarHBondContact O-N 2.92Å; L9-A12 PolarHBondContact O-N 3.38Å; A12-K14 VanDerWaalsContact C-N 3.34Å; A12-K14 PolarHBondContact O-N 3.34Å; A12-V15 PolarHBondContact O-N 2.95Å; A12-T16 WeakPolarHBondContact O-CB 3.48Å; A12-T16 PolarHBondContact O-N 3.39Å; A12-T16 PolarHBondContact O-OG1 3.19Å
13	T	85.9	Confident	82.4	Confident	68 Å²	68	97.4 Å²	97.4	42%	0.417	55%	0.551	S	S	.	*	H	α-helix	trans	-59.3	-43.8	176.6	-54.1	0	0	0	112	L9 L11 T16 I17	L9-T13 PolarHBondContact O-N 2.93Å; L9-T13 PolarHBondContact O-OG1 2.91Å; L11-T13 PolarHBondContact O-N 3.33Å; T13-T16 PolarHBondContact O-N 3.41Å; T13-I17 HydrophobicContact CG2-CD1 3.89Å; T13-I17 VanDerWaalsContact O-CG1 3.27Å; T13-I17 WeakPolarHBondContact O-CG1 3.39Å; T13-I17 PolarHBondContact O-N 3.4Å
14	K	90	Very high	83.6	Confident	153 Å²	153	97.2 Å²	97.2	67%	0.665	54%	0.541	S	S	*	.	H	α-helix	trans	-63.5	-43.7	177.6	-75	179.7	175.7	-165.4	112.2	K10 L11 A12 T16 I17 A18	K10-K14 WeakPolarHBondContact O-CG 3.43Å; K10-K14 PolarHBondContact O-N 3.02Å; K10-K14 VanDerWaalsContact O-N 3.15Å; L11-K14 PolarHBondContact O-N 2.93Å; A12-K14 VanDerWaalsContact C-N 3.34Å; A12-K14 PolarHBondContact O-N 3.34Å; K14-T16 VanDerWaalsContact C-N 3.35Å; K14-I17 PolarHBondContact O-N 3.39Å; K14-A18 WeakPolarHBondContact O-CB 3.43Å; K14-A18 PolarHBondContact O-N 3.46Å
15	V	89.1	Confident	84.5	Confident	91 Å²	91	90.7 Å²	90.7	55%	0.552	52%	0.516	S	S	*	.	H	α-helix	trans	-64	-42	177.8	172.7	0	0	0	110.5	L11 A12 A18 G19	L11-V15 HydrophobicContact CD2-CG2 4.11Å; L11-V15 WeakPolarHBondContact O-CG2 3.4Å; L11-V15 PolarHBondContact O-N 3.3Å; A12-V15 PolarHBondContact O-N 2.95Å; V15-A18 PolarHBondContact O-N 2.97Å; V15-G19 PolarHBondContact O-N 2.99Å
16	T	88.7	Confident	84.6	Confident	103 Å²	103	93.2 Å²	93.2	63%	0.632	52%	0.519	S	S	*	.	H	α-helix	trans	-63.7	-44.1	176.5	-57.7	0	0	0	111.9	A12 T13 K14 G19 G20	A12-T16 WeakPolarHBondContact O-CB 3.48Å; A12-T16 PolarHBondContact O-N 3.39Å; A12-T16 PolarHBondContact O-OG1 3.19Å; T13-T16 PolarHBondContact O-N 3.41Å; K14-T16 VanDerWaalsContact C-N 3.35Å; T16-G19 PolarHBondContact O-N 3.05Å; T16-G20 PolarHBondContact O-N 3.41Å
17	I	89.8	Confident	84.7	Confident	118 Å²	118	93.8 Å²	93.8	61%	0.605	52%	0.522	S	S	*	.	H	α-helix	trans	-63.1	-46.2	177	-68	167.3	0	0	110.5	T13 K14 G20 A21	T13-I17 HydrophobicContact CG2-CD1 3.89Å; T13-I17 VanDerWaalsContact O-CG1 3.27Å; T13-I17 WeakPolarHBondContact O-CG1 3.39Å; T13-I17 PolarHBondContact O-N 3.4Å; K14-I17 PolarHBondContact O-N 3.39Å; I17-G20 PolarHBondContact O-N 3.05Å; I17-A21 WeakPolarHBondContact O-CB 3.08Å; I17-A21 PolarHBondContact O-N 3.25Å
18	A	85.1	Confident	84.3	Confident	53 Å²	53	92.9 Å²	92.9	44%	0.438	52%	0.518	S	S	.	.	H	α-helix	trans	-64	-43.5	178.7	0	0	0	0	112	K14 V15 A21 L22	K14-A18 WeakPolarHBondContact O-CB 3.43Å; K14-A18 PolarHBondContact O-N 3.46Å; V15-A18 PolarHBondContact O-N 2.97Å; A18-A21 PolarHBondContact O-N 3.27Å; A18-L22 WeakPolarHBondContact O-CB 3.35Å; A18-L22 WeakPolarHBondContact O-CG 3.5Å; A18-L22 PolarHBondContact O-N 3.29Å
19	G	86.5	Confident	83.8	Confident	37 Å²	37	88.8 Å²	88.8	38%	0.381	50%	0.495	S	S	.	.	H	α-helix	trans	-65.1	-41	176.7	0	0	0	0	112.6	V15 T16 L22 Y23	V15-G19 PolarHBondContact O-N 2.99Å; T16-G19 PolarHBondContact O-N 3.05Å; G19-L22 PolarHBondContact O-N 3.45Å; G19-Y23 WeakPolarHBondContact O-CB 3.38Å; G19-Y23 PolarHBondContact O-N 2.9Å
20	G	85.3	Confident	83.1	Confident	34 Å²	34	86.6 Å²	86.6	35%	0.351	48%	0.483	S	S	.	.	H	α-helix	trans	-64	-43.5	174.8	0	0	0	0	112.3	T16 I17 L22 Y23 V24	T16-G20 PolarHBondContact O-N 3.41Å; I17-G20 PolarHBondContact O-N 3.05Å; G20-L22 VanDerWaalsContact C-N 3.34Å; G20-L22 PolarHBondContact O-N 3.11Å; G20-Y23 PolarHBondContact O-N 3.38Å; G20-V24 WeakPolarHBondContact O-CG2 3.45Å; G20-V24 PolarHBondContact O-N 3.02Å
21	A	83.1	Confident	82.7	Confident	56 Å²	56	85.3 Å²	85.3	46%	0.463	48%	0.482	S	S	.	.	H	α-helix	trans	-62.3	-41.2	174.7	0	0	0	0	111.9	I17 A18 T25	I17-A21 WeakPolarHBondContact O-CB 3.08Å; I17-A21 PolarHBondContact O-N 3.25Å; A18-A21 PolarHBondContact O-N 3.27Å; A21-T25 WeakPolarHBondContact O-CB 3.45Å; A21-T25 VanDerWaalsContact O-CG2 3.28Å; A21-T25 WeakPolarHBondContact O-CG2 3.41Å; A21-T25 PolarHBondContact O-N 2.87Å; A21-T25 PolarHBondContact O-OG1 3.39Å
22	L	80.3	Confident	81.9	Confident	110 Å²	110	81.6 Å²	81.6	58%	0.576	47%	0.472	S	S	*	.	H	α-helix	trans	-63.2	-42.8	174	-79.3	167.4	0	0	112.2	A18 G19 G20 T25 Y26	A18-L22 WeakPolarHBondContact O-CB 3.35Å; A18-L22 WeakPolarHBondContact O-CG 3.5Å; A18-L22 PolarHBondContact O-N 3.29Å; G19-L22 PolarHBondContact O-N 3.45Å; G20-L22 VanDerWaalsContact C-N 3.34Å; G20-L22 PolarHBondContact O-N 3.11Å; L22-T25 WeakPolarHBondContact CA-OG1 3.49Å; L22-T25 PolarHBondContact O-N 3.25Å; L22-T25 PolarHBondContact O-OG1 2.92Å; L22-Y26 WeakPolarHBondContact O-CB 3.48Å; L22-Y26 PolarHBondContact O-N 3.19Å
23	Y	81.3	Confident	81.3	Confident	155 Å²	155	81.9 Å²	81.9	61%	0.608	48%	0.479	S	S	*	.	H	α-helix	trans	-62.5	-48.7	177.1	179.9	-92.1	0	0	111.7	G19 G20 T25 Y26 D27	G19-Y23 WeakPolarHBondContact O-CB 3.38Å; G19-Y23 PolarHBondContact O-N 2.9Å; G20-Y23 PolarHBondContact O-N 3.38Å; Y23-T25 VanDerWaalsContact C-N 3.33Å; Y23-T25 PolarHBondContact O-N 3.3Å; Y23-Y26 WeakPolarHBondContact O-CB 3.43Å; Y23-Y26 PolarHBondContact O-N 3.28Å; Y23-D27 HydrophobicContact CE1-CB 4.38Å; Y23-D27 WeakPolarHBondContact O-CB 3.31Å; Y23-D27 PolarHBondContact O-N 3.29Å
24	V	83.6	Confident	80.4	Confident	84 Å²	84	84 Å²	84	51%	0.509	50%	0.497	S	S	.	.	H	α-helix	trans	-62.7	-40.5	180	171.5	0	0	0	111.3	G20 S28	G20-V24 WeakPolarHBondContact O-CG2 3.45Å; G20-V24 PolarHBondContact O-N 3.02Å; V24-S28 WeakPolarHBondContact O-CB 3.2Å; V24-S28 PolarHBondContact O-N 2.85Å; V24-S28 PolarHBondContact O-OG 2.99Å
25	T	80.5	Confident	79.5	Confident	41 Å²	41	80.4 Å²	80.4	25%	0.252	50%	0.495	S	S	.	.	H	α-helix	trans	-70.3	-32	177.9	50.1	0	0	0	112.9	A21 L22 Y23 L30 L31	A21-T25 WeakPolarHBondContact O-CB 3.45Å; A21-T25 VanDerWaalsContact O-CG2 3.28Å; A21-T25 WeakPolarHBondContact O-CG2 3.41Å; A21-T25 PolarHBondContact O-N 2.87Å; A21-T25 PolarHBondContact O-OG1 3.39Å; L22-T25 WeakPolarHBondContact CA-OG1 3.49Å; L22-T25 PolarHBondContact O-N 3.25Å; L22-T25 PolarHBondContact O-OG1 2.92Å; Y23-T25 VanDerWaalsContact C-N 3.33Å; Y23-T25 PolarHBondContact O-N 3.3Å; T25-L30 HydrophobicContact CG2-CD2 3.88Å; T25-L30 VanDerWaalsContact O-CB 3.3Å; T25-L30 WeakPolarHBondContact O-CB 3.21Å; T25-L30 PolarHBondContact O-N 3.45Å; T25-L30 VanDerWaalsContact O-N 3.07Å; T25-L31 PolarHBondContact O-N 3Å
26	Y	76.3	Confident	78.7	Confident	173 Å²	173	81.6 Å²	81.6	68%	0.678	50%	0.495	S	S	*	.	H	α-helix	trans	-68.1	-51.3	171.4	-175.7	-95.2	0	0	111.8	L22 Y23 S28 G29	L22-Y26 WeakPolarHBondContact O-CB 3.48Å; L22-Y26 PolarHBondContact O-N 3.19Å; Y23-Y26 WeakPolarHBondContact O-CB 3.43Å; Y23-Y26 PolarHBondContact O-N 3.28Å; Y26-S28 VanDerWaalsContact C-N 3.33Å; Y26-S28 PolarHBondContact O-N 3.43Å; Y26-G29 PolarHBondContact O-N 2.95Å
27	D	81.4	Confident	77.9	Confident	117 Å²	117	77.2 Å²	77.2	63%	0.626	47%	0.47	S	S	*	.	H	α-helix	trans	-63.7	-37.8	-179.4	-172	58.7	0	0	112.3	Y23 G29	Y23-D27 HydrophobicContact CE1-CB 4.38Å; Y23-D27 WeakPolarHBondContact O-CB 3.31Å; Y23-D27 PolarHBondContact O-N 3.29Å; D27-G29 PolarHBondContact O-N 3.34Å; D27-G29 VanDerWaalsContact O-N 3.08Å
28	S	70.5	Confident	77	Confident	59 Å²	59	75.3 Å²	75.3	41%	0.413	47%	0.467	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.3	-7.9	174.7	-57.9	0	0	0	113	V24 Y26 L30 V40	V24-S28 WeakPolarHBondContact O-CB 3.2Å; V24-S28 PolarHBondContact O-N 2.85Å; V24-S28 PolarHBondContact O-OG 2.99Å; Y26-S28 VanDerWaalsContact C-N 3.33Å; Y26-S28 PolarHBondContact O-N 3.43Å; S28-L30 PolarHBondContact O-N 3.23Å; S28-V40 VanDerWaalsContact O-CG1 3.31Å; S28-V40 WeakPolarHBondContact O-CG1 3.48Å; S28-V40 WeakPolarHBondContact O-CG2 3.32Å
29	G	74.4	Confident	76.5	Confident	8 Å²	8	78.3 Å²	78.3	8%	0.082	47%	0.472	C	S	.	.	T	Hydrogen-bonded Turn	trans	71.3	13.7	-176.1	0	0	0	0	113.7	Y26 D27 L31 G32	Y26-G29 PolarHBondContact O-N 2.95Å; D27-G29 PolarHBondContact O-N 3.34Å; D27-G29 VanDerWaalsContact O-N 3.08Å; G29-L31 PolarHBondContact O-N 2.87Å; G29-G32 PolarHBondContact O-N 2.96Å
30	L	72.8	Confident	76.1	Confident	63 Å²	63	78.2 Å²	78.2	33%	0.33	46%	0.464	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.7	-33.9	177.9	-164	86.1	0	0	111.1	T25 S28 G32 V40 L41	T25-L30 HydrophobicContact CG2-CD2 3.88Å; T25-L30 VanDerWaalsContact O-CB 3.3Å; T25-L30 WeakPolarHBondContact O-CB 3.21Å; T25-L30 PolarHBondContact O-N 3.45Å; T25-L30 VanDerWaalsContact O-N 3.07Å; S28-L30 PolarHBondContact O-N 3.23Å; L30-G32 VanDerWaalsContact C-N 3.27Å; L30-V40 HydrophobicContact CB-CG1 4.38Å; L30-V40 HydrophobicContact CD1-CB 4.41Å; L30-V40 HydrophobicContact CD1-CG1 3.85Å; L30-L41 HydrophobicContact CD1-CB 4.15Å; L30-L41 HydrophobicContact CD1-CD1 4.36Å
31	L	76.1	Confident	75.5	Confident	108 Å²	108	81.5 Å²	81.5	57%	0.565	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.2	7.9	174.1	-58.1	177.9	0	0	113	T25 G29	T25-L31 PolarHBondContact O-N 3Å; G29-L31 PolarHBondContact O-N 2.87Å
32	G	72.6	Confident	75.2	Confident	36 Å²	36	80.7 Å²	80.7	37%	0.371	47%	0.47	S	S	.	.	S	Bend	trans	-73.3	-174.8	177.2	0	0	0	0	113.2	G29 L30	G29-G32 PolarHBondContact O-N 2.96Å; L30-G32 VanDerWaalsContact C-N 3.27Å
33	G	74.3	Confident	75	Confident	52 Å²	52	81.6 Å²	81.6	54%	0.536	47%	0.469	S	S	.	.			trans	-58.1	159.8	176.7	0	0	0	0	112.8	A35 Q36 G37	G33-A35 PolarHBondContact O-N 3.29Å; G33-Q36 PolarHBondContact O-N 3.49Å; G33-G37 PolarHBondContact O-N 2.87Å
34	S	66.8	Low	74.7	Confident	114 Å²	114	76.2 Å²	76.2	80%	0.797	46%	0.457	S	S	*	.	H	α-helix	trans	-53.1	-35.3	-167.8	72.1	0	0	0	114.6	S38	S34-S38 WeakPolarHBondContact O-CB 3.27Å; S34-S38 PolarHBondContact O-N 3.27Å; S34-S38 VanDerWaalsContact O-N 3.11Å
35	A	71.3	Confident	74	Confident	77 Å²	77	79.6 Å²	79.6	64%	0.636	46%	0.464	S	S	*	.	H	α-helix	trans	-70	-49	177.2	0	0	0	0	112.6	G33 S38 E39	G33-A35 PolarHBondContact O-N 3.29Å; A35-S38 PolarHBondContact O-N 3.34Å; A35-E39 PolarHBondContact O-N 3.46Å
36	Q	71.6	Confident	73.7	Confident	116 Å²	116	80.7 Å²	80.7	54%	0.542	48%	0.478	S	S	.	.	H	α-helix	trans	-69.4	-42.8	-177.6	-170.6	177.3	-1.6	0	111.6	G33 E39 V40	G33-Q36 PolarHBondContact O-N 3.49Å; Q36-E39 PolarHBondContact O-N 3.41Å; Q36-V40 VanDerWaalsContact O-CG2 3.25Å; Q36-V40 WeakPolarHBondContact O-CG2 3.38Å; Q36-V40 PolarHBondContact O-N 3.43Å; Q36-V40 VanDerWaalsContact O-N 3.1Å
37	G	71.7	Confident	73.3	Confident	10 Å²	10	75.2 Å²	75.2	10%	0.103	47%	0.469	C	S	.	.	H	α-helix	trans	-64.6	-38.7	175.4	0	0	0	0	112.4	G33 L41	G33-G37 PolarHBondContact O-N 2.87Å; G37-L41 WeakPolarHBondContact O-CB 3.33Å; G37-L41 PolarHBondContact O-N 2.97Å
38	S	71.2	Confident	72.5	Confident	79 Å²	79	74.5 Å²	74.5	55%	0.552	46%	0.464	S	S	*	.	H	α-helix	trans	-68.4	-35.7	177.1	-174	0	0	0	112.7	S34 A35 G42	S34-S38 WeakPolarHBondContact O-CB 3.27Å; S34-S38 PolarHBondContact O-N 3.27Å; S34-S38 VanDerWaalsContact O-N 3.11Å; A35-S38 PolarHBondContact O-N 3.34Å; S38-G42 PolarHBondContact O-N 3.26Å
39	E	76.1	Confident	72.1	Confident	115 Å²	115	75 Å²	75	54%	0.537	47%	0.465	S	S	.	.	H	α-helix	trans	-68.9	-45.3	177.3	-166	-168.6	145.6	0	111.4	A35 Q36 G42 K43	A35-E39 PolarHBondContact O-N 3.46Å; Q36-E39 PolarHBondContact O-N 3.41Å; E39-G42 PolarHBondContact O-N 2.98Å; E39-K43 WeakPolarHBondContact O-CG 3.5Å; E39-K43 PolarHBondContact O-N 3.02Å; E39-K43 IonicContact OE1-NZ 2.67Å; E39-K43 PolarHBondContact OE1-NZ 2.83Å
40	V	77.8	Confident	71.6	Confident	35 Å²	35	77.7 Å²	77.7	21%	0.212	48%	0.482	C	S	.	.	H	α-helix	trans	-65.6	-41.8	176.9	175.2	0	0	0	110.6	S28 L30 Q36 G42 K43 A44	S28-V40 VanDerWaalsContact O-CG1 3.31Å; S28-V40 WeakPolarHBondContact O-CG1 3.48Å; S28-V40 WeakPolarHBondContact O-CG2 3.32Å; L30-V40 HydrophobicContact CB-CG1 4.38Å; L30-V40 HydrophobicContact CD1-CB 4.41Å; L30-V40 HydrophobicContact CD1-CG1 3.85Å; Q36-V40 VanDerWaalsContact O-CG2 3.25Å; Q36-V40 WeakPolarHBondContact O-CG2 3.38Å; Q36-V40 PolarHBondContact O-N 3.43Å; Q36-V40 VanDerWaalsContact O-N 3.1Å; V40-G42 VanDerWaalsContact C-N 3.3Å; V40-G42 PolarHBondContact O-N 3.34Å; V40-K43 PolarHBondContact O-N 3.1Å; V40-A44 WeakPolarHBondContact O-CB 3.32Å; V40-A44 PolarHBondContact O-N 3.49Å
41	L	73.1	Confident	71.3	Confident	103 Å²	103	76.8 Å²	76.8	54%	0.539	48%	0.483	S	S	.	.	H	α-helix	trans	-62.7	-38.1	174.2	-177.8	63.5	0	0	111.6	L30 G37 A44 K45	L30-L41 HydrophobicContact CD1-CB 4.15Å; L30-L41 HydrophobicContact CD1-CD1 4.36Å; G37-L41 WeakPolarHBondContact O-CB 3.33Å; G37-L41 PolarHBondContact O-N 2.97Å; L41-A44 PolarHBondContact O-N 3.42Å; L41-K45 WeakPolarHBondContact O-CB 3.42Å; L41-K45 PolarHBondContact O-N 3.4Å
42	G	75.4	Confident	70.8	Confident	39 Å²	39	74.2 Å²	74.2	40%	0.402	47%	0.472	S	S	.	.	H	α-helix	trans	-61.7	-45.3	173.6	0	0	0	0	112.3	S38 E39 V40 K45 A46	S38-G42 PolarHBondContact O-N 3.26Å; E39-G42 PolarHBondContact O-N 2.98Å; V40-G42 VanDerWaalsContact C-N 3.3Å; V40-G42 PolarHBondContact O-N 3.34Å; G42-K45 PolarHBondContact O-N 3.46Å; G42-A46 WeakPolarHBondContact O-CB 3.19Å; G42-A46 PolarHBondContact O-N 2.79Å
43	K	76.8	Confident	70.5	Confident	130 Å²	130	77.5 Å²	77.5	57%	0.565	48%	0.481	S	S	*	.	H	α-helix	trans	-64.8	-43.7	175.7	-73.2	168.8	172.4	165.4	112.2	E39 V40 A46 A47	E39-K43 WeakPolarHBondContact O-CG 3.5Å; E39-K43 PolarHBondContact O-N 3.02Å; E39-K43 IonicContact OE1-NZ 2.67Å; E39-K43 PolarHBondContact OE1-NZ 2.83Å; V40-K43 PolarHBondContact O-N 3.1Å; K43-A46 PolarHBondContact O-N 3.4Å; K43-A47 PolarHBondContact O-N 3.38Å
44	A	73.9	Confident	70.4	Confident	41 Å²	41	81.6 Å²	81.6	34%	0.339	49%	0.486	S	S	.	.	H	α-helix	trans	-62.2	-45.9	174.8	0	0	0	0	111.1	V40 L41 A46 A47 I48	V40-A44 WeakPolarHBondContact O-CB 3.32Å; V40-A44 PolarHBondContact O-N 3.49Å; L41-A44 PolarHBondContact O-N 3.42Å; A44-A46 VanDerWaalsContact C-N 3.25Å; A44-A46 PolarHBondContact O-N 2.92Å; A44-A47 PolarHBondContact O-N 2.9Å; A44-A47 VanDerWaalsContact O-N 3.13Å; A44-I48 WeakPolarHBondContact O-CD1 3.3Å; A44-I48 WeakPolarHBondContact O-CG1 3.37Å; A44-I48 PolarHBondContact O-N 2.95Å
45	K	69.3	Low	70.5	Confident	155 Å²	155	84.4 Å²	84.4	67%	0.674	48%	0.479	S	S	*	.	H	α-helix	trans	-62.2	-30.6	175.1	-175	178.2	178.2	-176	112.7	L41 G42 P49	L41-K45 WeakPolarHBondContact O-CB 3.42Å; L41-K45 PolarHBondContact O-N 3.4Å; G42-K45 PolarHBondContact O-N 3.46Å; K45-P49 WeakPolarHBondContact O-CD 3.34Å; K45-P49 WeakPolarHBondContact O-CG 3.42Å
46	A	73.8	Confident	70.6	Confident	64 Å²	64	82.5 Å²	82.5	53%	0.529	46%	0.459	S	S	.	.	H	α-helix	trans	-76.8	-28.7	175.4	0	0	0	0	112.8	G42 K43 A44 P50	G42-A46 WeakPolarHBondContact O-CB 3.19Å; G42-A46 PolarHBondContact O-N 2.79Å; K43-A46 PolarHBondContact O-N 3.4Å; A44-A46 VanDerWaalsContact C-N 3.25Å; A44-A46 PolarHBondContact O-N 2.92Å; A46-P50 WeakPolarHBondContact O-CD 3.28Å; A46-P50 WeakPolarHBondContact O-CG 3.41Å
47	A	69.3	Low	70.5	Confident	59 Å²	59	85.7 Å²	85.7	49%	0.488	47%	0.472	S	S	.	.	H	α-helix	trans	-85.4	-23.6	178.1	0	0	0	0	113.9	K43 A44 P50 A51	K43-A47 PolarHBondContact O-N 3.38Å; A44-A47 PolarHBondContact O-N 2.9Å; A44-A47 VanDerWaalsContact O-N 3.13Å; A47-P50 WeakPolarHBondContact O-CD 3.39Å; A47-A51 WeakPolarHBondContact O-CB 3.45Å; A47-A51 PolarHBondContact O-N 3.15Å; A47-A51 VanDerWaalsContact O-N 3.15Å
48	I	64.5	Low	70.3	Confident	102 Å²	102	94.3 Å²	94.3	52%	0.523	50%	0.502	S	S	.	.	H	α-helix	trans	-62.6	-49.2	177.9	-72.6	161.8	0	0	112.5	A44 A51 V52	A44-I48 WeakPolarHBondContact O-CD1 3.3Å; A44-I48 WeakPolarHBondContact O-CG1 3.37Å; A44-I48 PolarHBondContact O-N 2.95Å; I48-A51 PolarHBondContact O-N 3.08Å; I48-V52 HydrophobicContact CG2-CG2 3.92Å; I48-V52 WeakPolarHBondContact O-CB 3.27Å; I48-V52 WeakPolarHBondContact O-CG2 3.41Å; I48-V52 PolarHBondContact O-N 3Å
49	P	61.6	Low	70.4	Confident	68 Å²	68	96.7 Å²	96.7	44%	0.442	50%	0.503	S	S	.	.	H	α-helix	trans	-59.2	-47.8	-179.6	-14.4	21.1	0	0	113	K45 V52 D53	K45-P49 WeakPolarHBondContact O-CD 3.34Å; K45-P49 WeakPolarHBondContact O-CG 3.42Å; P49-V52 PolarHBondContact O-N 2.86Å; P49-D53 PolarHBondContact O-N 3.22Å
50	P	64.6	Low	69.9	Low	66 Å²	66	94.6 Å²	94.6	43%	0.429	51%	0.513	S	S	.	.	H	α-helix	trans	-60.7	-46.3	175.5	-22.9	32	0	0	113.5	A46 A47 V52 D53 E54	A46-P50 WeakPolarHBondContact O-CD 3.28Å; A46-P50 WeakPolarHBondContact O-CG 3.41Å; A47-P50 WeakPolarHBondContact O-CD 3.39Å; P50-V52 VanDerWaalsContact C-N 3.3Å; P50-V52 PolarHBondContact O-N 2.69Å; P50-D53 PolarHBondContact O-N 3.43Å; P50-E54 WeakPolarHBondContact O-CB 3.31Å; P50-E54 VanDerWaalsContact O-CG 3.32Å; P50-E54 WeakPolarHBondContact O-CG 3.44Å; P50-E54 PolarHBondContact O-N 3.41Å
51	A	65.1	Low	69.4	Low	44 Å²	44	99 Å²	99	36%	0.364	53%	0.529	S	S	.	.	H	α-helix	trans	-67.2	-34.1	-178.2	0	0	0	0	112.1	A47 I48 W55	A47-A51 WeakPolarHBondContact O-CB 3.45Å; A47-A51 PolarHBondContact O-N 3.15Å; A47-A51 VanDerWaalsContact O-N 3.15Å; I48-A51 PolarHBondContact O-N 3.08Å; A51-W55 WeakPolarHBondContact O-CB 3.17Å; A51-W55 VanDerWaalsContact O-CD1 3.23Å; A51-W55 PolarHBondContact O-N 2.88Å
52	V	65.9	Low	69	Low	53 Å²	53	102.6 Å²	102.6	32%	0.321	54%	0.543	S	S	.	.	H	α-helix	trans	-69.9	-45.1	176.3	168.2	0	0	0	110.8	I48 P49 P50 E54 W55 V56 L63	I48-V52 HydrophobicContact CG2-CG2 3.92Å; I48-V52 WeakPolarHBondContact O-CB 3.27Å; I48-V52 WeakPolarHBondContact O-CG2 3.41Å; I48-V52 PolarHBondContact O-N 3Å; P49-V52 PolarHBondContact O-N 2.86Å; P50-V52 VanDerWaalsContact C-N 3.3Å; P50-V52 PolarHBondContact O-N 2.69Å; V52-E54 VanDerWaalsContact C-N 3.32Å; V52-E54 PolarHBondContact O-N 2.96Å; V52-W55 PolarHBondContact O-N 2.97Å; V52-V56 HydrophobicContact CG1-CG2 4.22Å; V52-V56 VanDerWaalsContact O-CB 3.25Å; V52-V56 WeakPolarHBondContact O-CB 3.11Å; V52-V56 WeakPolarHBondContact O-CG2 3.12Å; V52-V56 PolarHBondContact O-N 3.47Å; V52-L63 HydrophobicContact CG1-CD1 3.27Å
53	D	66.9	Low	68.4	Low	105 Å²	105	105.8 Å²	105.8	56%	0.561	55%	0.55	S	S	*	*	H	α-helix	trans	-63.2	-39.4	176.8	-73.5	-28.8	0	0	111.7	P49 P50 K57	P49-D53 PolarHBondContact O-N 3.22Å; P50-D53 PolarHBondContact O-N 3.43Å; D53-K57 VanDerWaalsContact O-CB 3.23Å; D53-K57 WeakPolarHBondContact O-CB 3.38Å; D53-K57 PolarHBondContact O-N 3Å
54	E	71.3	Confident	67.8	Low	138 Å²	138	104.1 Å²	104.1	65%	0.645	55%	0.553	S	S	*	*	H	α-helix	trans	-64.6	-43.4	174.3	-75	176.4	-177.6	0	112.3	P50 V52 K57 Y58	P50-E54 WeakPolarHBondContact O-CB 3.31Å; P50-E54 VanDerWaalsContact O-CG 3.32Å; P50-E54 WeakPolarHBondContact O-CG 3.44Å; P50-E54 PolarHBondContact O-N 3.41Å; V52-E54 VanDerWaalsContact C-N 3.32Å; V52-E54 PolarHBondContact O-N 2.96Å; E54-K57 PolarHBondContact O-N 2.82Å; E54-Y58 VanDerWaalsContact O-CB 3.28Å; E54-Y58 WeakPolarHBondContact O-CB 3.3Å; E54-Y58 PolarHBondContact O-N 2.93Å
55	W	70	Confident	67.3	Low	173 Å²	173	106.6 Å²	106.6	66%	0.655	57%	0.573	S	S	*	*	H	α-helix	trans	-66.3	-44.3	175.9	-93.7	62.4	0	0	112.4	A51 V52 K57 Y58 F59	A51-W55 WeakPolarHBondContact O-CB 3.17Å; A51-W55 VanDerWaalsContact O-CD1 3.23Å; A51-W55 PolarHBondContact O-N 2.88Å; V52-W55 PolarHBondContact O-N 2.97Å; W55-K57 VanDerWaalsContact C-N 3.3Å; W55-K57 PolarHBondContact O-N 3.37Å; W55-Y58 PolarHBondContact O-N 3.42Å; W55-F59 HydrophobicContact CD2-CD2 4.23Å; W55-F59 AromaticContact CD2-CE2 3.9Å; W55-F59 HydrophobicContact CD2-CE2 3.9Å; W55-F59 AromaticContact CE3-CD2 3.7Å; W55-F59 HydrophobicContact CE3-CD2 3.7Å; W55-F59 AromaticContact CE3-CE2 3.39Å; W55-F59 HydrophobicContact CE3-CE2 3.39Å; W55-F59 HydrophobicContact CE3-CZ 4.41Å; W55-F59 HydrophobicContact CH2-CE2 4.16Å; W55-F59 HydrophobicContact CZ3-CD2 4.22Å; W55-F59 AromaticContact CZ3-CE2 3.54Å; W55-F59 HydrophobicContact CZ3-CE2 3.54Å; W55-F59 HydrophobicContact CZ3-CZ 4.15Å; W55-F59 WeakPolarHBondContact O-CB 3.39Å; W55-F59 WeakPolarHBondContact O-CD2 3.29Å; W55-F59 PolarHBondContact O-N 2.79Å
56	V	72.1	Confident	66.8	Low	37 Å²	37	107.5 Å²	107.5	22%	0.224	58%	0.577	C	S	.	*	H	α-helix	trans	-58.4	-44.4	176.3	157	0	0	0	110.6	V52 G60 F61 L63	V52-V56 HydrophobicContact CG1-CG2 4.22Å; V52-V56 VanDerWaalsContact O-CB 3.25Å; V52-V56 WeakPolarHBondContact O-CB 3.11Å; V52-V56 WeakPolarHBondContact O-CG2 3.12Å; V52-V56 PolarHBondContact O-N 3.47Å; V56-G60 WeakPolarHBondContact O-CA 3.45Å; V56-G60 PolarHBondContact O-N 2.94Å; V56-F61 WeakPolarHBondContact CG1-O 3.25Å; V56-F61 PolarHBondContact O-N 3.47Å; V56-F61 VanDerWaalsContact O-N 3.11Å; V56-L63 HydrophobicContact CG2-CD1 3.77Å; V56-L63 HydrophobicContact CG2-CG 3.65Å
57	K	70.2	Confident	66.2	Low	184 Å²	184	108.9 Å²	108.9	80%	0.8	58%	0.581	S	S	*	*	H	α-helix	trans	-67.5	-38.6	176.4	-172.4	175.8	-180	177.5	112.5	D53 E54 W55	D53-K57 VanDerWaalsContact O-CB 3.23Å; D53-K57 WeakPolarHBondContact O-CB 3.38Å; D53-K57 PolarHBondContact O-N 3Å; E54-K57 PolarHBondContact O-N 2.82Å; W55-K57 VanDerWaalsContact C-N 3.3Å; W55-K57 PolarHBondContact O-N 3.37Å
58	Y	68.6	Low	66	Low	191 Å²	191	116.2 Å²	116.2	75%	0.749	60%	0.602	S	S	*	*	H	α-helix	trans	-70.8	-39.5	179.3	-170.8	-94.6	0	0	112.7	E54 W55	E54-Y58 VanDerWaalsContact O-CB 3.28Å; E54-Y58 WeakPolarHBondContact O-CB 3.3Å; E54-Y58 PolarHBondContact O-N 2.93Å; W55-Y58 PolarHBondContact O-N 3.42Å
59	F	72.1	Confident	66	Low	128 Å²	128	115.2 Å²	115.2	56%	0.561	60%	0.596	S	S	*	*	H	α-helix	trans	-92.8	-1.7	-179.5	-73.8	-77.8	0	0	113.9	W55 F61	W55-F59 HydrophobicContact CD2-CD2 4.23Å; W55-F59 AromaticContact CD2-CE2 3.9Å; W55-F59 HydrophobicContact CD2-CE2 3.9Å; W55-F59 AromaticContact CE3-CD2 3.7Å; W55-F59 HydrophobicContact CE3-CD2 3.7Å; W55-F59 AromaticContact CE3-CE2 3.39Å; W55-F59 HydrophobicContact CE3-CE2 3.39Å; W55-F59 HydrophobicContact CE3-CZ 4.41Å; W55-F59 HydrophobicContact CH2-CE2 4.16Å; W55-F59 HydrophobicContact CZ3-CD2 4.22Å; W55-F59 AromaticContact CZ3-CE2 3.54Å; W55-F59 HydrophobicContact CZ3-CE2 3.54Å; W55-F59 HydrophobicContact CZ3-CZ 4.15Å; W55-F59 WeakPolarHBondContact O-CB 3.39Å; W55-F59 WeakPolarHBondContact O-CD2 3.29Å; W55-F59 PolarHBondContact O-N 2.79Å; F59-F61 PolarHBondContact O-N 2.96Å
60	G	66.8	Low	66.8	Low	72 Å²	72	116.3 Å²	116.3	74%	0.742	62%	0.619	S	S	*	*	T	Hydrogen-bonded Turn	trans	62.5	24.9	179	0	0	0	0	113.9	V56	V56-G60 WeakPolarHBondContact O-CA 3.45Å; V56-G60 PolarHBondContact O-N 2.94Å
61	F	65.8	Low	67.3	Low	127 Å²	127	119 Å²	119	56%	0.557	62%	0.624	S	S	*	*			trans	-107.1	105.9	-171.1	-170.8	-94.5	0	0	110.4	V56 F59 L63	V56-F61 WeakPolarHBondContact CG1-O 3.25Å; V56-F61 PolarHBondContact O-N 3.47Å; V56-F61 VanDerWaalsContact O-N 3.11Å; F59-F61 PolarHBondContact O-N 2.96Å; F61-L63 PolarHBondContact O-N 3.4Å
62	E	65.4	Low	68	Low	179 Å²	179	119 Å²	119	84%	0.836	62%	0.622	S	S	*	*	P	Polyproline II helix	trans	-64	121.5	170.8	-70.9	-171	149.1	0	109.6	P64	E62-P64 WeakPolarHBondContact O-CD 3.31Å
63	L	62.8	Low	68.7	Low	105 Å²	105	119.6 Å²	119.6	55%	0.55	63%	0.627	S	S	.	*	P	Polyproline II helix	trans	-62.6	122	174.6	-85	170	0	0	108.9	V52 V56 F61 A65	V52-L63 HydrophobicContact CG1-CD1 3.27Å; V56-L63 HydrophobicContact CG2-CD1 3.77Å; V56-L63 HydrophobicContact CG2-CG 3.65Å; F61-L63 PolarHBondContact O-N 3.4Å; L63-A65 PolarHBondContact O-N 2.91Å
64	P	63.8	Low	69.4	Low	96 Å²	96	119 Å²	119	62%	0.623	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-58.1	136.9	173.8	23.7	-31.5	0	0	108.6	E62 F66	E62-P64 WeakPolarHBondContact O-CD 3.31Å; P64-F66 PolarHBondContact O-N 2.68Å
65	A	63.4	Low	70	Confident	93 Å²	93	119 Å²	119	77%	0.769	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-49.2	133.7	176.7	0	0	0	0	109.4	L63	L63-A65 PolarHBondContact O-N 2.91Å
66	F	58.3	Low	70.7	Confident	173 Å²	173	113.1 Å²	113.1	76%	0.759	62%	0.616	S	S	*	*	P	Polyproline II helix	trans	-48.3	119	-176.5	-151.6	-102.7	0	0	108.6	P64 K68 M69	P64-F66 PolarHBondContact O-N 2.68Å; F66-K68 PolarHBondContact O-N 3.28Å; F66-M69 HydrophobicContact CD1-CE 4.38Å; F66-M69 HydrophobicContact CE1-CE 3.49Å; F66-M69 VanDerWaalsContact CE1-CE 3.49Å; F66-M69 HydrophobicContact CZ-CE 4.14Å
67	P	62.4	Low	71.2	Confident	93 Å²	93	120.3 Å²	120.3	60%	0.604	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-59.3	134.5	-172.7	22.2	-31.6	0	0	107.8	M69	P67-M69 PolarHBondContact O-N 3.49Å
68	K	64.7	Low	72.2	Confident	213 Å²	213	116 Å²	116	93%	0.926	62%	0.624	S	S	*	*			trans	-62.3	91.8	171.7	-72.5	-177.3	179.4	177	107.5	F66 G70	F66-K68 PolarHBondContact O-N 3.28Å; K68-G70 PolarHBondContact O-N 3.5Å
69	M	65	Low	73.2	Confident	82 Å²	82	110.4 Å²	110.4	40%	0.404	61%	0.613	S	S	.	*			trans	-66.2	120	175.8	-71.9	-168	-79.9	0	107.3	F66 P67 F71 P73	F66-M69 HydrophobicContact CD1-CE 4.38Å; F66-M69 HydrophobicContact CE1-CE 3.49Å; F66-M69 VanDerWaalsContact CE1-CE 3.49Å; F66-M69 HydrophobicContact CZ-CE 4.14Å; P67-M69 PolarHBondContact O-N 3.49Å; M69-F71 HydrophobicContact CB-CD1 4.45Å; M69-F71 HydrophobicContact CB-CE1 4.35Å; M69-F71 HydrophobicContact CG-CE1 4.48Å; M69-F71 PolarHBondContact O-N 2.95Å; M69-F71 VanDerWaalsContact O-N 3.12Å; M69-F71 HydrophobicContact SD-CE1 4.34Å; M69-F71 HydrophobicContact SD-CE2 4.45Å; M69-F71 HydrophobicContact SD-CZ 3.92Å; M69-P73 HydrophobicContact CE-CG 3.56Å; M69-P73 HydrophobicContact SD-CG 4.18Å
70	G	76.7	Confident	74	Confident	90 Å²	90	106 Å²	106	93%	0.928	60%	0.604	S	S	*	*	S	Bend	trans	-72.7	8	177.4	0	0	0	0	113.9	K68	K68-G70 PolarHBondContact O-N 3.5Å
71	F	76.3	Confident	75.1	Confident	122 Å²	122	105.4 Å²	105.4	54%	0.535	59%	0.586	S	S	.	*	S	Bend	trans	-134.7	148.1	176.9	66.4	-88.9	0	0	109.3	M69 P73 A76	M69-F71 HydrophobicContact CB-CD1 4.45Å; M69-F71 HydrophobicContact CB-CE1 4.35Å; M69-F71 HydrophobicContact CG-CE1 4.48Å; M69-F71 PolarHBondContact O-N 2.95Å; M69-F71 VanDerWaalsContact O-N 3.12Å; M69-F71 HydrophobicContact SD-CE1 4.34Å; M69-F71 HydrophobicContact SD-CE2 4.45Å; M69-F71 HydrophobicContact SD-CZ 3.92Å; F71-P73 HydrophobicContact CE2-CG 4.42Å; F71-P73 VanDerWaalsContact O-CD 3.27Å; F71-P73 WeakPolarHBondContact O-CD 3.48Å; F71-A76 HydrophobicContact CD2-CB 4.01Å; F71-A76 HydrophobicContact CE2-CB 4.36Å
72	S	80.2	Confident	76.2	Confident	45 Å²	45	105.9 Å²	105.9	32%	0.315	59%	0.59	S	S	.	*			trans	-75.2	116.9	170.6	172.9	0	0	0	109	V74 E75 A76	S72-V74 PolarHBondContact O-N 2.98Å; S72-E75 WeakPolarHBondContact CB-OE2 3.46Å; S72-E75 PolarHBondContact O-N 3.31Å; S72-E75 PolarHBondContact OG-N 2.98Å; S72-A76 PolarHBondContact O-N 3.02Å
73	P	79.7	Confident	77.3	Confident	65 Å²	65	101 Å²	101	42%	0.422	58%	0.576	S	S	.	*	H	α-helix	trans	-59.9	-31.9	178.8	-24.7	35.8	0	0	112.6	M69 F71 W77	M69-P73 HydrophobicContact CE-CG 3.56Å; M69-P73 HydrophobicContact SD-CG 4.18Å; F71-P73 HydrophobicContact CE2-CG 4.42Å; F71-P73 VanDerWaalsContact O-CD 3.27Å; F71-P73 WeakPolarHBondContact O-CD 3.48Å; P73-W77 VanDerWaalsContact O-CB 3.3Å; P73-W77 WeakPolarHBondContact O-CB 3.18Å; P73-W77 PolarHBondContact O-N 3.01Å
74	V	82.2	Confident	78.4	Confident	94 Å²	94	99.3 Å²	99.3	57%	0.57	57%	0.572	S	S	*	*	H	α-helix	trans	-69.2	-44.7	179.1	178.6	0	0	0	110.9	S72 W77 N78	S72-V74 PolarHBondContact O-N 2.98Å; V74-W77 PolarHBondContact O-N 2.92Å; V74-N78 WeakPolarHBondContact O-CB 3.42Å; V74-N78 VanDerWaalsContact O-CG 3.26Å; V74-N78 PolarHBondContact O-N 3.41Å; V74-N78 PolarHBondContact O-ND2 3.07Å
75	E	83.1	Confident	79.6	Confident	137 Å²	137	99.9 Å²	99.9	64%	0.64	57%	0.569	S	S	*	*	H	α-helix	trans	-66.9	-42.4	178.4	-67.4	173.5	174.1	0	111.3	S72 W77 N78 S79	S72-E75 WeakPolarHBondContact CB-OE2 3.46Å; S72-E75 PolarHBondContact O-N 3.31Å; S72-E75 PolarHBondContact OG-N 2.98Å; E75-W77 VanDerWaalsContact C-N 3.32Å; E75-W77 PolarHBondContact O-N 3.33Å; E75-N78 PolarHBondContact O-N 3.48Å; E75-S79 VanDerWaalsContact O-CB 3.31Å; E75-S79 WeakPolarHBondContact O-CB 3.19Å; E75-S79 PolarHBondContact O-N 3Å
76	A	85.1	Confident	80.5	Confident	50 Å²	50	98.6 Å²	98.6	41%	0.413	56%	0.555	S	S	.	*	H	α-helix	trans	-60.4	-43.1	175.9	0	0	0	0	111.6	F71 S72 G80	F71-A76 HydrophobicContact CD2-CB 4.01Å; F71-A76 HydrophobicContact CE2-CB 4.36Å; S72-A76 PolarHBondContact O-N 3.02Å; A76-G80 PolarHBondContact O-N 3.39Å
77	W	83.3	Confident	81.7	Confident	188 Å²	188	93.3 Å²	93.3	71%	0.712	54%	0.543	S	S	*	.	H	α-helix	trans	-61.9	-50.8	175.6	-179.9	-97.3	0	0	112.1	P73 V74 E75 S79 G80 V81	P73-W77 VanDerWaalsContact O-CB 3.3Å; P73-W77 WeakPolarHBondContact O-CB 3.18Å; P73-W77 PolarHBondContact O-N 3.01Å; V74-W77 PolarHBondContact O-N 2.92Å; E75-W77 VanDerWaalsContact C-N 3.32Å; E75-W77 PolarHBondContact O-N 3.33Å; W77-S79 VanDerWaalsContact C-N 3.34Å; W77-S79 PolarHBondContact O-N 2.97Å; W77-G80 PolarHBondContact O-N 3.44Å; W77-V81 HydrophobicContact CZ2-CG2 4.38Å; W77-V81 WeakPolarHBondContact O-CG2 3.11Å; W77-V81 PolarHBondContact O-N 2.79Å
78	N	89.8	Confident	82.6	Confident	92 Å²	92	95.4 Å²	95.4	49%	0.492	55%	0.548	S	S	.	.	H	α-helix	trans	-61	-43.2	-179.2	-72.3	-16.9	0	0	111.9	V74 E75 G80 V81 Q82	V74-N78 WeakPolarHBondContact O-CB 3.42Å; V74-N78 VanDerWaalsContact O-CG 3.26Å; V74-N78 PolarHBondContact O-N 3.41Å; V74-N78 PolarHBondContact O-ND2 3.07Å; E75-N78 PolarHBondContact O-N 3.48Å; N78-G80 PolarHBondContact O-N 3.42Å; N78-V81 PolarHBondContact O-N 3.5Å; N78-Q82 WeakPolarHBondContact O-CB 3.39Å; N78-Q82 PolarHBondContact O-N 3.01Å
79	S	90.2	Very high	83.7	Confident	75 Å²	75	89.4 Å²	89.4	52%	0.524	53%	0.533	S	S	.	.	H	α-helix	trans	-61.1	-43.6	175.4	-179.2	0	0	0	111.9	E75 W77 Q82 S83	E75-S79 VanDerWaalsContact O-CB 3.31Å; E75-S79 WeakPolarHBondContact O-CB 3.19Å; E75-S79 PolarHBondContact O-N 3Å; W77-S79 VanDerWaalsContact C-N 3.34Å; W77-S79 PolarHBondContact O-N 2.97Å; S79-Q82 PolarHBondContact O-N 2.89Å; S79-S83 VanDerWaalsContact O-CB 3.29Å; S79-S83 WeakPolarHBondContact O-CB 3.22Å; S79-S83 PolarHBondContact O-N 2.67Å
80	G	88.3	Confident	84.4	Confident	35 Å²	35	88.7 Å²	88.7	36%	0.361	54%	0.536	S	S	.	.	H	α-helix	trans	-62.3	-44.5	177.4	0	0	0	0	113.2	A76 W77 N78 S84	A76-G80 PolarHBondContact O-N 3.39Å; W77-G80 PolarHBondContact O-N 3.44Å; N78-G80 PolarHBondContact O-N 3.42Å; G80-S84 WeakPolarHBondContact O-CB 3.34Å; G80-S84 PolarHBondContact O-N 3.07Å; G80-S84 PolarHBondContact O-OG 2.97Å
81	V	91.4	Very high	84.5	Confident	60 Å²	60	85.6 Å²	85.6	36%	0.364	50%	0.504	S	S	.	.	H	α-helix	trans	-62.3	-48.6	176	172.3	0	0	0	110.5	W77 N78 S83 S84 I85	W77-V81 HydrophobicContact CZ2-CG2 4.38Å; W77-V81 WeakPolarHBondContact O-CG2 3.11Å; W77-V81 PolarHBondContact O-N 2.79Å; N78-V81 PolarHBondContact O-N 3.5Å; V81-S83 PolarHBondContact O-N 3.18Å; V81-S84 PolarHBondContact O-N 3.43Å; V81-I85 HydrophobicContact CG1-CD1 3.83Å; V81-I85 HydrophobicContact CG1-CG1 4.47Å; V81-I85 WeakPolarHBondContact O-CG1 3.27Å; V81-I85 PolarHBondContact O-N 3.11Å
82	Q	89.1	Confident	84.6	Confident	136 Å²	136	84.1 Å²	84.1	64%	0.636	51%	0.507	S	S	*	.	H	α-helix	trans	-61.2	-44.2	-179.7	-172.2	177.1	5.9	0	111.8	N78 S79 S86	N78-Q82 WeakPolarHBondContact O-CB 3.39Å; N78-Q82 PolarHBondContact O-N 3.01Å; S79-Q82 PolarHBondContact O-N 2.89Å; Q82-S86 VanDerWaalsContact O-CB 3.27Å; Q82-S86 WeakPolarHBondContact O-CB 3.28Å; Q82-S86 PolarHBondContact O-N 2.82Å; Q82-S86 PolarHBondContact O-OG 2.92Å
83	S	87.6	Confident	84.5	Confident	78 Å²	78	87.3 Å²	87.3	55%	0.545	53%	0.525	S	S	.	.	H	α-helix	trans	-61.2	-47.2	177	-178.3	0	0	0	111.7	S79 V81 I85 S86 A87	S79-S83 VanDerWaalsContact O-CB 3.29Å; S79-S83 WeakPolarHBondContact O-CB 3.22Å; S79-S83 PolarHBondContact O-N 2.67Å; V81-S83 PolarHBondContact O-N 3.18Å; S83-I85 PolarHBondContact O-N 2.86Å; S83-S86 PolarHBondContact O-N 3.42Å; S83-A87 WeakPolarHBondContact O-CB 3.32Å; S83-A87 PolarHBondContact O-N 3.36Å
84	S	86.8	Confident	84.4	Confident	68 Å²	68	86.6 Å²	86.6	48%	0.476	52%	0.524	S	S	.	.	H	α-helix	trans	-63.1	-46.1	-179.2	-57.4	0	0	0	112.1	G80 V81 S86 A87 L88	G80-S84 WeakPolarHBondContact O-CB 3.34Å; G80-S84 PolarHBondContact O-N 3.07Å; G80-S84 PolarHBondContact O-OG 2.97Å; V81-S84 PolarHBondContact O-N 3.43Å; S84-S86 VanDerWaalsContact C-N 3.34Å; S84-S86 PolarHBondContact O-N 3.41Å; S84-A87 PolarHBondContact O-N 2.95Å; S84-L88 WeakPolarHBondContact O-CB 3.07Å; S84-L88 VanDerWaalsContact O-CG 3.31Å; S84-L88 WeakPolarHBondContact O-CG 3.42Å; S84-L88 PolarHBondContact O-N 3.25Å
85	I	88.1	Confident	84.3	Confident	108 Å²	108	87.7 Å²	87.7	55%	0.554	53%	0.526	S	S	*	.	H	α-helix	trans	-66.3	-38	178	-67	178.2	0	0	110.8	V81 S83 L88 S89	V81-I85 HydrophobicContact CG1-CD1 3.83Å; V81-I85 HydrophobicContact CG1-CG1 4.47Å; V81-I85 WeakPolarHBondContact O-CG1 3.27Å; V81-I85 PolarHBondContact O-N 3.11Å; S83-I85 PolarHBondContact O-N 2.86Å; I85-L88 PolarHBondContact O-N 3.1Å; I85-S89 WeakPolarHBondContact O-CB 2.86Å; I85-S89 PolarHBondContact O-N 3.38Å
86	S	83.1	Confident	84.2	Confident	67 Å²	67	82.8 Å²	82.8	47%	0.469	51%	0.512	S	S	.	.	H	α-helix	trans	-65.2	-42.1	177	-58.5	0	0	0	112	Q82 S83 S84 S89 S90	Q82-S86 VanDerWaalsContact O-CB 3.27Å; Q82-S86 WeakPolarHBondContact O-CB 3.28Å; Q82-S86 PolarHBondContact O-N 2.82Å; Q82-S86 PolarHBondContact O-OG 2.92Å; S83-S86 PolarHBondContact O-N 3.42Å; S84-S86 VanDerWaalsContact C-N 3.34Å; S84-S86 PolarHBondContact O-N 3.41Å; S86-S89 PolarHBondContact O-N 2.91Å; S86-S90 PolarHBondContact O-N 3.13Å; S86-S90 VanDerWaalsContact O-N 3.1Å; S86-S90 PolarHBondContact O-OG 3.03Å
87	A	82.3	Confident	84.2	Confident	61 Å²	61	82 Å²	82	50%	0.504	51%	0.509	S	S	.	.	H	α-helix	trans	-62.7	-45.8	174.4	0	0	0	0	111.6	S83 S84 S89 S90 G91	S83-A87 WeakPolarHBondContact O-CB 3.32Å; S83-A87 PolarHBondContact O-N 3.36Å; S84-A87 PolarHBondContact O-N 2.95Å; A87-S89 VanDerWaalsContact C-N 3.34Å; A87-S89 PolarHBondContact O-N 3.45Å; A87-S90 PolarHBondContact O-N 3.45Å; A87-S90 PolarHBondContact O-OG 3.4Å; A87-G91 PolarHBondContact O-N 2.99Å
88	L	82.9	Confident	84.1	Confident	138 Å²	138	81.1 Å²	81.1	72%	0.723	51%	0.507	S	S	*	.	H	α-helix	trans	-66.4	-35.7	177.8	-70.9	170	0	0	112.5	S84 I85 S90 G91 P92	S84-L88 WeakPolarHBondContact O-CB 3.07Å; S84-L88 VanDerWaalsContact O-CG 3.31Å; S84-L88 WeakPolarHBondContact O-CG 3.42Å; S84-L88 PolarHBondContact O-N 3.25Å; I85-L88 PolarHBondContact O-N 3.1Å; L88-S90 VanDerWaalsContact C-N 3.33Å; L88-S90 PolarHBondContact O-N 2.96Å; L88-G91 PolarHBondContact O-N 3.23Å; L88-P92 WeakPolarHBondContact O-CD 3.42Å
89	S	86.2	Confident	83.8	Confident	87 Å²	87	80.8 Å²	80.8	61%	0.608	51%	0.508	S	S	*	.	H	α-helix	trans	-67.8	-31.5	177.1	173.4	0	0	0	113.1	I85 S86 A87	I85-S89 WeakPolarHBondContact O-CB 2.86Å; I85-S89 PolarHBondContact O-N 3.38Å; S86-S89 PolarHBondContact O-N 2.91Å; A87-S89 VanDerWaalsContact C-N 3.34Å; A87-S89 PolarHBondContact O-N 3.45Å
90	S	81.2	Confident	83.6	Confident	66 Å²	66	82.2 Å²	82.2	46%	0.462	51%	0.51	S	S	.	.	H	α-helix	trans	-85.6	-15.3	-179.9	54	0	0	0	113.2	S86 A87 L88 T93 A94	S86-S90 PolarHBondContact O-N 3.13Å; S86-S90 VanDerWaalsContact O-N 3.1Å; S86-S90 PolarHBondContact O-OG 3.03Å; A87-S90 PolarHBondContact O-N 3.45Å; A87-S90 PolarHBondContact O-OG 3.4Å; L88-S90 VanDerWaalsContact C-N 3.33Å; L88-S90 PolarHBondContact O-N 2.96Å; S90-T93 PolarHBondContact O-N 3.21Å; S90-A94 PolarHBondContact O-N 2.95Å
91	G	78.9	Confident	83.7	Confident	25 Å²	25	86.4 Å²	86.4	26%	0.258	52%	0.52	S	S	.	.	H	α-helix	trans	-53	-50.7	179.3	0	0	0	0	114.8	A87 L88 T93 A94 L95	A87-G91 PolarHBondContact O-N 2.99Å; L88-G91 PolarHBondContact O-N 3.23Å; G91-T93 VanDerWaalsContact C-N 3.34Å; G91-T93 PolarHBondContact O-N 2.92Å; G91-A94 PolarHBondContact O-N 3.32Å; G91-L95 WeakPolarHBondContact O-CB 3.38Å; G91-L95 WeakPolarHBondContact O-CG 3.32Å; G91-L95 PolarHBondContact O-N 3.47Å
92	P	77.6	Confident	83.4	Confident	91 Å²	91	85.2 Å²	85.2	59%	0.591	52%	0.52	S	S	*	.	H	α-helix	trans	-59.9	-40.8	179.7	-25.7	34.8	0	0	113.3	L88 G96	L88-P92 WeakPolarHBondContact O-CD 3.42Å; P92-G96 PolarHBondContact O-N 2.89Å
93	T	78.4	Confident	83.4	Confident	113 Å²	113	83.6 Å²	83.6	69%	0.693	52%	0.516	S	S	*	.	H	α-helix	trans	-67.6	-42.6	178.2	-51.6	0	0	0	111.3	S90 G91 G96 G97	S90-T93 PolarHBondContact O-N 3.21Å; G91-T93 VanDerWaalsContact C-N 3.34Å; G91-T93 PolarHBondContact O-N 2.92Å; T93-G96 PolarHBondContact O-N 3.37Å; T93-G97 PolarHBondContact O-N 3.42Å
94	A	77.8	Confident	83.5	Confident	49 Å²	49	86.1 Å²	86.1	41%	0.405	52%	0.519	S	S	.	.	H	α-helix	trans	-63.2	-45.1	176.1	0	0	0	0	111.8	S90 G91 G96 G97 Y98	S90-A94 PolarHBondContact O-N 2.95Å; G91-A94 PolarHBondContact O-N 3.32Å; A94-G96 VanDerWaalsContact C-N 3.35Å; A94-G96 PolarHBondContact O-N 3.15Å; A94-G97 PolarHBondContact O-N 3.23Å; A94-Y98 WeakPolarHBondContact O-CD2 3.44Å; A94-Y98 PolarHBondContact O-N 2.98Å
95	L	78.6	Confident	83.7	Confident	117 Å²	117	90 Å²	90	61%	0.613	52%	0.524	S	S	*	.	H	α-helix	trans	-61.7	-39.8	176.1	-77.2	168	0	0	112.7	G91 G97 Y98 T99	G91-L95 WeakPolarHBondContact O-CB 3.38Å; G91-L95 WeakPolarHBondContact O-CG 3.32Å; G91-L95 PolarHBondContact O-N 3.47Å; L95-G97 VanDerWaalsContact C-N 3.35Å; L95-Y98 PolarHBondContact O-N 3.41Å; L95-T99 WeakPolarHBondContact O-CB 3.23Å; L95-T99 PolarHBondContact O-N 2.81Å; L95-T99 PolarHBondContact O-OG1 2.97Å
96	G	81.8	Confident	83.8	Confident	35 Å²	35	89.8 Å²	89.8	36%	0.361	52%	0.523	S	S	.	.	H	α-helix	trans	-62.4	-40.6	173.6	0	0	0	0	112.6	P92 T93 A94 T99 N100	P92-G96 PolarHBondContact O-N 2.89Å; T93-G96 PolarHBondContact O-N 3.37Å; A94-G96 VanDerWaalsContact C-N 3.35Å; A94-G96 PolarHBondContact O-N 3.15Å; G96-T99 PolarHBondContact O-N 3.23Å; G96-N100 PolarHBondContact O-N 3.46Å
97	G	84.6	Confident	84	Confident	34 Å²	34	94.3 Å²	94.3	35%	0.351	53%	0.534	S	S	.	.	H	α-helix	trans	-60.1	-49.8	174	0	0	0	0	112.9	T93 A94 L95 T99 N100 Q101	T93-G97 PolarHBondContact O-N 3.42Å; A94-G97 PolarHBondContact O-N 3.23Å; L95-G97 VanDerWaalsContact C-N 3.35Å; G97-T99 VanDerWaalsContact C-N 3.32Å; G97-T99 PolarHBondContact O-N 3.39Å; G97-N100 PolarHBondContact O-N 3.37Å; G97-Q101 PolarHBondContact O-N 2.98Å
98	Y	81.9	Confident	84.4	Confident	168 Å²	168	96.6 Å²	96.6	66%	0.659	54%	0.538	S	S	*	.	H	α-helix	trans	-63.1	-37.1	177.6	-72.7	-62	0	0	112.8	A94 L95 Q101 G102	A94-Y98 WeakPolarHBondContact O-CD2 3.44Å; A94-Y98 PolarHBondContact O-N 2.98Å; L95-Y98 PolarHBondContact O-N 3.41Å; Y98-Q101 PolarHBondContact O-N 3.21Å; Y98-G102 PolarHBondContact O-N 2.9Å
99	T	83.6	Confident	84.7	Confident	85 Å²	85	95.3 Å²	95.3	52%	0.521	53%	0.532	S	S	.	.	H	α-helix	trans	-66.8	-43.1	177.9	-60.8	0	0	0	111.3	L95 G96 G97 G102 L103	L95-T99 WeakPolarHBondContact O-CB 3.23Å; L95-T99 PolarHBondContact O-N 2.81Å; L95-T99 PolarHBondContact O-OG1 2.97Å; G96-T99 PolarHBondContact O-N 3.23Å; G97-T99 VanDerWaalsContact C-N 3.32Å; G97-T99 PolarHBondContact O-N 3.39Å; T99-G102 PolarHBondContact O-N 3.41Å; T99-L103 HydrophobicContact CG2-CD1 4.33Å; T99-L103 WeakPolarHBondContact O-CG 3.12Å; T99-L103 PolarHBondContact O-N 3.04Å
100	N	86.3	Confident	84.6	Confident	105 Å²	105	97.1 Å²	97.1	56%	0.561	54%	0.539	S	S	*	.	H	α-helix	trans	-63.7	-40.1	175.2	-84.8	-21.1	0	0	112.3	G96 G97 L103 Q104	G96-N100 PolarHBondContact O-N 3.46Å; G97-N100 PolarHBondContact O-N 3.37Å; N100-L103 PolarHBondContact O-N 3.48Å; N100-Q104 WeakPolarHBondContact O-CG 3.34Å; N100-Q104 PolarHBondContact O-N 2.95Å
101	Q	89.1	Confident	83.5	Confident	123 Å²	123	105.2 Å²	105.2	58%	0.575	57%	0.566	S	S	*	*	H	α-helix	trans	-63.3	-42.1	174	-77	179	-37.9	0	112.1	G97 Y98 Q104 Y105	G97-Q101 PolarHBondContact O-N 2.98Å; Y98-Q101 PolarHBondContact O-N 3.21Å; Q101-Q104 PolarHBondContact O-N 2.81Å; Q101-Y105 WeakPolarHBondContact O-CB 3.43Å; Q101-Y105 PolarHBondContact O-N 2.85Å
102	G	86.6	Confident	83.7	Confident	35 Å²	35	109.2 Å²	109.2	36%	0.361	58%	0.581	S	S	.	*	H	α-helix	trans	-62.7	-41.9	175.3	0	0	0	0	112.7	Y98 T99 Y105 L106	Y98-G102 PolarHBondContact O-N 2.9Å; T99-G102 PolarHBondContact O-N 3.41Å; G102-Y105 PolarHBondContact O-N 3.43Å; G102-L106 WeakPolarHBondContact O-CG 3.25Å; G102-L106 PolarHBondContact O-N 3.28Å
103	L	88.6	Confident	84.1	Confident	103 Å²	103	110.2 Å²	110.2	54%	0.539	58%	0.581	S	S	.	*	H	α-helix	trans	-64.6	-40.5	175.3	-75.6	171.8	0	0	112.3	T99 N100 K107	T99-L103 HydrophobicContact CG2-CD1 4.33Å; T99-L103 WeakPolarHBondContact O-CG 3.12Å; T99-L103 PolarHBondContact O-N 3.04Å; N100-L103 PolarHBondContact O-N 3.48Å; L103-K107 WeakPolarHBondContact O-CB 3.19Å; L103-K107 PolarHBondContact O-N 3.27Å
104	Q	89.9	Confident	84.4	Confident	130 Å²	130	110 Å²	110	61%	0.607	58%	0.575	S	S	*	*	H	α-helix	trans	-64.2	-44.8	174.2	-76.9	-166.4	-2.5	0	111.8	N100 Q101 L106 K107 D108	N100-Q104 WeakPolarHBondContact O-CG 3.34Å; N100-Q104 PolarHBondContact O-N 2.95Å; Q101-Q104 PolarHBondContact O-N 2.81Å; Q104-L106 PolarHBondContact O-N 2.73Å; Q104-K107 WeakPolarHBondContact O-CB 3.41Å; Q104-K107 PolarHBondContact O-N 3.11Å; Q104-K107 VanDerWaalsContact O-N 3.12Å; Q104-D108 PolarHBondContact O-N 3.24Å
105	Y	89.9	Confident	84.8	Confident	150 Å²	150	113.6 Å²	113.6	59%	0.588	59%	0.585	S	S	*	*	H	α-helix	trans	-58.6	-46.4	177.3	177.1	-105	0	0	112.6	Q101 G102 K107 D108 L109	Q101-Y105 WeakPolarHBondContact O-CB 3.43Å; Q101-Y105 PolarHBondContact O-N 2.85Å; G102-Y105 PolarHBondContact O-N 3.43Å; Y105-K107 VanDerWaalsContact C-N 3.29Å; Y105-K107 PolarHBondContact O-N 2.92Å; Y105-D108 PolarHBondContact O-N 3.34Å; Y105-L109 HydrophobicContact CD1-CD1 4.1Å; Y105-L109 HydrophobicContact CD2-CD1 4.03Å; Y105-L109 HydrophobicContact CE1-CD1 3.53Å; Y105-L109 HydrophobicContact CE2-CD1 3.45Å; Y105-L109 VanDerWaalsContact CE2-CD1 3.45Å; Y105-L109 HydrophobicContact CG-CD1 4.34Å; Y105-L109 PolarHBondContact O-N 3.28Å; Y105-L109 WeakPolarHBondContact OH-CD1 3.39Å
106	L	90.3	Very high	85.1	Confident	104 Å²	104	113.4 Å²	113.4	55%	0.545	58%	0.583	S	S	.	*	H	α-helix	trans	-62	-39.2	175.7	-71.2	174.5	0	0	111.9	G102 Q104 D108 L109 T110	G102-L106 WeakPolarHBondContact O-CG 3.25Å; G102-L106 PolarHBondContact O-N 3.28Å; Q104-L106 PolarHBondContact O-N 2.73Å; L106-D108 VanDerWaalsContact C-N 3.35Å; L106-L109 PolarHBondContact O-N 3.25Å; L106-T110 PolarHBondContact O-N 3.12Å; L106-T110 VanDerWaalsContact O-N 3.17Å; L106-T110 PolarHBondContact O-OG1 3.27Å
107	K	87.7	Confident	85.4	Confident	161 Å²	161	118.6 Å²	118.6	70%	0.7	60%	0.598	S	S	*	*	H	α-helix	trans	-65.1	-38.8	178.1	-165.9	177.4	-175.2	177.7	112	L103 Q104 Y105	L103-K107 WeakPolarHBondContact O-CB 3.19Å; L103-K107 PolarHBondContact O-N 3.27Å; Q104-K107 WeakPolarHBondContact O-CB 3.41Å; Q104-K107 PolarHBondContact O-N 3.11Å; Q104-K107 VanDerWaalsContact O-N 3.12Å; Y105-K107 VanDerWaalsContact C-N 3.29Å; Y105-K107 PolarHBondContact O-N 2.92Å
108	D	90.8	Very high	85.4	Confident	110 Å²	110	124.6 Å²	124.6	59%	0.588	62%	0.615	S	S	*	*	H	α-helix	trans	-73.2	-31.5	177.3	-70.8	-21.2	0	0	112.5	Q104 Y105 L106 T110	Q104-D108 PolarHBondContact O-N 3.24Å; Y105-D108 PolarHBondContact O-N 3.34Å; L106-D108 VanDerWaalsContact C-N 3.35Å; D108-T110 VanDerWaalsContact C-N 3.35Å
109	L	88.3	Confident	85.7	Confident	110 Å²	110	121.3 Å²	121.3	58%	0.576	61%	0.612	S	S	*	*	H	α-helix	trans	-72.6	-25.5	175	-115.6	104.8	0	0	114.3	Y105 L106	Y105-L109 HydrophobicContact CD1-CD1 4.1Å; Y105-L109 HydrophobicContact CD2-CD1 4.03Å; Y105-L109 HydrophobicContact CE1-CD1 3.53Å; Y105-L109 HydrophobicContact CE2-CD1 3.45Å; Y105-L109 VanDerWaalsContact CE2-CD1 3.45Å; Y105-L109 HydrophobicContact CG-CD1 4.34Å; Y105-L109 PolarHBondContact O-N 3.28Å; Y105-L109 WeakPolarHBondContact OH-CD1 3.39Å; L106-L109 PolarHBondContact O-N 3.25Å
110	T	84.3	Confident	85.9	Confident	126 Å²	126	124.3 Å²	124.3	77%	0.773	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89	5.2	-177	-44.3	0	0	0	111.8	L106 D108	L106-T110 PolarHBondContact O-N 3.12Å; L106-T110 VanDerWaalsContact O-N 3.17Å; L106-T110 PolarHBondContact O-OG1 3.27Å; D108-T110 VanDerWaalsContact C-N 3.35Å
111	K	58.6	Low	85.8	Confident	235 Å²	235	126.1 Å²	126.1	100%	1.022	63%	0.625	S	S	*	*			trans	-105.3	0	-176.7	-151.3	-177.3	-172.1	-175.3	110.6

Retrieved 111 of 111 residues in 21.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).