A0A060XNI2_ONCMY Loading...

Tumor suppressor candidate 2

AlphaFold DB , UniProt , Accession A0A060XNI2, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene tusc2, Length 112 aa.

						>A0A060XNI2_ONCMY|A0A060XNI2|tusc2
MGGSGSKVKGAWPFAGSGAGGDSGSEGQEDQSLTRLKGTRKATPFIFTRRSSLYYDEDGDLAHEFYEETLVTKNGRKRSKLKRIQKNLIPQGIVKLNHPRIHVDFPVILCEV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.1	Low	50.3	Low	253 Å²	253	130.7 Å²	130.7	100%	1.246	86%	0.859	S	S	*	*				0	105.8	0	-76.7	147.7	81.3	0	0	107.9
2	G	48.4	Very low	50.3	Low	82 Å²	82	140.6 Å²	140.6	85%	0.845	87%	0.866	S	S	*	*			trans	-164.1	111.7	179.3	0	0	0	0	0	106.9
3	G	40.9	Very low	50.8	Low	76 Å²	76	139.7 Å²	139.7	78%	0.784	86%	0.864	S	S	*	*			trans	-103.9	-161.4	-159.7	0	0	0	0	0	115.4
4	S	44.7	Very low	50.2	Low	129 Å²	129	144.1 Å²	144.1	90%	0.902	87%	0.865	S	S	*	*			trans	75.5	107.3	166.7	-75.5	0	0	0	0	118.4
5	G	48.3	Very low	49.8	Very low	72 Å²	72	141.1 Å²	141.1	74%	0.742	86%	0.862	S	S	*	*			trans	-77.8	171.9	161.4	0	0	0	0	0	113.1
6	S	52.2	Low	49.5	Very low	123 Å²	123	136.6 Å²	136.6	86%	0.86	85%	0.852	S	S	*	*			trans	-152.8	104.6	163.8	-80.1	0	0	0	0	108.9
7	K	55.9	Low	49.1	Very low	209 Å²	209	136.3 Å²	136.3	91%	0.909	86%	0.856	S	S	*	*			trans	-97.8	100.1	159.2	-76.6	-174.3	174.3	175.6	0	106.3
8	V	53.5	Low	48.5	Very low	135 Å²	135	132.9 Å²	132.9	82%	0.818	85%	0.852	S	S	*	*			trans	-100.8	106.6	165.5	62.8	0	0	0	0	108
9	K	54.5	Low	48.2	Very low	196 Å²	196	131.9 Å²	131.9	85%	0.852	86%	0.857	S	S	*	*			trans	-79.3	111.9	164.6	-72.2	-179.4	173.1	-176.3	0	106.1	A11	K9-A11 PolarHBondContact O-N 3.45Å; K9-A11 VanDerWaalsContact O-N 3.16Å
10	G	46.2	Very low	47.4	Very low	69 Å²	69	129.6 Å²	129.6	71%	0.711	86%	0.858	S	S	*	*			trans	-64.8	110.3	176.6	0	0	0	0	0	110.7
11	A	54.2	Low	46.8	Very low	94 Å²	94	127.2 Å²	127.2	78%	0.777	86%	0.857	S	S	*	*			trans	-88	126.8	166.7	0	0	0	0	0	108.6	K9	K9-A11 PolarHBondContact O-N 3.45Å; K9-A11 VanDerWaalsContact O-N 3.16Å
12	W	50.7	Low	46.1	Very low	249 Å²	249	122.7 Å²	122.7	94%	0.943	84%	0.837	S	S	*	*			trans	-72.9	130.7	176.2	-76	48.8	0	0	0	110	F14	W12-F14 PolarHBondContact O-N 2.96Å
13	P	56.9	Low	45.6	Very low	129 Å²	129	124.2 Å²	124.2	84%	0.838	84%	0.835	S	S	*	*			trans	-93	83.6	-178.6	35.6	-31.1	0	0	0	110.3
14	F	42	Very low	45.3	Very low	201 Å²	201	123.8 Å²	123.8	88%	0.882	83%	0.831	S	S	*	*			trans	-132.3	71	154	-152	-90.6	0	0	0	109	W12	W12-F14 PolarHBondContact O-N 2.96Å
15	A	45.3	Very low	44.9	Very low	100 Å²	100	123.9 Å²	123.9	83%	0.826	83%	0.831	S	S	*	*			trans	-87.8	106.4	163.9	0	0	0	0	0	107.6
16	G	44.9	Very low	44.2	Very low	68 Å²	68	130 Å²	130	70%	0.701	84%	0.841	S	S	*	*			trans	-71.5	133.5	165.8	0	0	0	0	0	110.3
17	S	42.9	Very low	43.6	Very low	132 Å²	132	128 Å²	128	92%	0.923	84%	0.839	S	S	*	*			trans	-145	138.2	165	-115.1	0	0	0	0	109.2
18	G	37.8	Very low	42.6	Very low	76 Å²	76	126.8 Å²	126.8	78%	0.784	84%	0.836	S	S	*	*			trans	-104.4	-174.4	-162.8	0	0	0	0	0	117.4
19	A	41.7	Very low	42.3	Very low	113 Å²	113	128.6 Å²	128.6	93%	0.934	84%	0.836	S	S	*	*			trans	62.7	136.2	153.5	0	0	0	0	0	122.6
20	G	33.1	Very low	42	Very low	86 Å²	86	126.4 Å²	126.4	89%	0.887	83%	0.833	S	S	*	*			trans	108	133.7	165.3	0	0	0	0	0	112.9
21	G	34.6	Very low	42.2	Very low	80 Å²	80	132.2 Å²	132.2	83%	0.825	84%	0.842	S	S	*	*			cis	-179.9	160.1	4.5	0	0	0	0	0	107.7
22	D	39.2	Very low	41.5	Very low	157 Å²	157	132.1 Å²	132.1	84%	0.84	84%	0.836	S	S	*	*			trans	-67.4	149.4	-172.1	168.9	46.8	0	0	0	115.9
23	S	39.1	Very low	41.5	Very low	115 Å²	115	129.2 Å²	129.2	80%	0.804	84%	0.838	S	S	*	*			trans	-177.9	128.1	139.3	23.8	0	0	0	0	111.3
24	G	34.7	Very low	40.8	Very low	67 Å²	67	127.6 Å²	127.6	69%	0.691	83%	0.826	S	S	*	*			trans	-89.5	169	-169.3	0	0	0	0	0	117.6
25	S	34.8	Very low	41.4	Very low	130 Å²	130	129.7 Å²	129.7	91%	0.909	83%	0.828	S	S	*	*			trans	-165.5	146.5	144	-81.8	0	0	0	0	109.9
26	E	34	Very low	41.5	Very low	202 Å²	202	129.8 Å²	129.8	94%	0.944	81%	0.814	S	S	*	*			trans	-86.6	149.8	-160	-52.8	175	136.9	0	0	112.7
27	G	39.4	Very low	41.9	Very low	79 Å²	79	136.8 Å²	136.8	81%	0.814	83%	0.825	S	S	*	*			trans	111.6	76.9	159.6	0	0	0	0	0	116.4
28	Q	35.2	Very low	42.1	Very low	184 Å²	184	132.5 Å²	132.5	86%	0.86	80%	0.802	S	S	*	*			trans	-161.1	97.8	143.2	-158.1	163.5	-8.6	0	0	110.2
29	E	47.2	Very low	43	Very low	173 Å²	173	136.2 Å²	136.2	81%	0.808	81%	0.81	S	S	*	*			trans	-54.5	143.6	163.5	55.3	-150.4	141.4	0	0	111.2
30	D	47.3	Very low	43.7	Very low	150 Å²	150	138.9 Å²	138.9	80%	0.802	80%	0.795	S	S	*	*	S	Bend	trans	76.2	52.9	172.9	-52.2	-30.1	0	0	0	119.5
31	Q	52.3	Low	44.8	Very low	191 Å²	191	144.7 Å²	144.7	89%	0.893	80%	0.796	S	S	*	*			trans	-165.5	78.1	152.9	-116.8	166.6	83.8	0	0	114.4
32	S	38.1	Very low	46.1	Very low	93 Å²	93	142.7 Å²	142.7	65%	0.65	77%	0.772	S	S	*	*			trans	-152.8	82	162.8	67.7	0	0	0	0	112.2	T34	S32-T34 PolarHBondContact O-N 3.27Å
33	L	51.1	Low	47.5	Very low	188 Å²	188	139.6 Å²	139.6	98%	0.984	76%	0.759	S	S	*	*			trans	-69.5	75.4	148	-70	177.2	0	0	0	106.6	R35	L33-R35 PolarHBondContact O-N 3.22Å
34	T	42.8	Very low	49.3	Very low	95 Å²	95	136.2 Å²	136.2	58%	0.583	73%	0.734	S	S	*	*			trans	-49.5	125.1	178.5	42.3	0	0	0	0	108.8	S32 L36	S32-T34 PolarHBondContact O-N 3.27Å; T34-L36 VanDerWaalsContact C-N 3.27Å; T34-L36 PolarHBondContact O-N 3Å
35	R	53.9	Low	51.6	Low	244 Å²	244	138.1 Å²	138.1	92%	0.921	72%	0.724	S	S	*	*			trans	-53.4	88.8	170.6	-160.3	-178.3	-146.4	177.2	5.5	108.4	L33 K37	L33-R35 PolarHBondContact O-N 3.22Å; R35-K37 PolarHBondContact O-N 2.8Å
36	L	48.3	Very low	54	Low	103 Å²	103	134.4 Å²	134.4	54%	0.539	69%	0.693	S	S	.	*			trans	-71	80.9	177.3	-73.6	167	0	0	0	108.6	T34 G38	T34-L36 VanDerWaalsContact C-N 3.27Å; T34-L36 PolarHBondContact O-N 3Å; L36-G38 PolarHBondContact O-N 3.46Å
37	K	51.8	Low	56.5	Low	215 Å²	215	130.3 Å²	130.3	94%	0.935	67%	0.672	S	S	*	*			trans	-72.1	75.5	160.5	-168	173.7	-177.9	-175.9	0	107.1	R35	R35-K37 PolarHBondContact O-N 2.8Å
38	G	46.9	Very low	58.9	Low	42 Å²	42	129.8 Å²	129.8	43%	0.433	65%	0.653	S	S	.	*	S	Bend	trans	-139.3	129.5	169	0	0	0	0	0	106	L36 R40	L36-G38 PolarHBondContact O-N 3.46Å; G38-R40 PolarHBondContact O-N 3.28Å
39	T	57.7	Low	61.5	Low	154 Å²	154	126.6 Å²	126.6	95%	0.945	63%	0.633	S	S	*	*			trans	-60.6	71.8	162.2	43.3	0	0	0	0	107.7	K41	T39-K41 PolarHBondContact O-N 3.41Å
40	R	56	Low	63.4	Low	168 Å²	168	128.8 Å²	128.8	63%	0.634	63%	0.634	S	S	*	*			trans	-64.8	136.7	174.7	-73.3	-173.5	-81.4	174.4	-3.4	105.3	G38 A42	G38-R40 PolarHBondContact O-N 3.28Å; R40-A42 PolarHBondContact O-N 2.97Å
41	K	56.2	Low	65.4	Low	209 Å²	209	122.4 Å²	122.4	91%	0.909	60%	0.601	S	S	*	*			trans	-54	72.1	167.1	-61.5	171.6	178.2	179.5	0	109	T39 T43	T39-K41 PolarHBondContact O-N 3.41Å; K41-T43 PolarHBondContact O-N 2.81Å
42	A	62.3	Low	67.2	Low	38 Å²	38	116.5 Å²	116.5	31%	0.314	58%	0.581	S	S	.	*			trans	-73.3	121.8	-179.3	0	0	0	0	0	105.6	R40 F105	R40-A42 PolarHBondContact O-N 2.97Å; A42-F105 HydrophobicContact CB-CE2 3.67Å; A42-F105 HydrophobicContact CB-CZ 3.89Å; A42-F105 WeakPolarHBondContact O-CZ 2.82Å
43	T	68.4	Low	69.8	Low	91 Å²	91	113.7 Å²	113.7	56%	0.558	56%	0.559	S	S	*	*			trans	-62.3	137.1	171.7	49.6	0	0	0	0	107.5	K41 F45	K41-T43 PolarHBondContact O-N 2.81Å; T43-F45 PolarHBondContact O-N 3.29Å; T43-F45 PolarHBondContact OG1-O 3.12Å; T43-F45 VanDerWaalsContact OG1-O 3.06Å
44	P	77.6	Confident	71.8	Confident	45 Å²	45	109.1 Å²	109.1	29%	0.292	53%	0.529	S	S	.	.	S	Bend	trans	-58.6	-22.1	178.4	24	-33.5	0	0	0	111.2	I101 H102 F105	P44-I101 CarbonylContact O-C 3.44Å; P44-I101 VanDerWaalsContact O-CA 3.23Å; P44-I101 WeakPolarHBondContact O-CA 3.37Å; P44-H102 PolarHBondContact O-N 3.27Å; P44-F105 HydrophobicContact CB-CB 4.35Å; P44-F105 HydrophobicContact CB-CD1 4.39Å; P44-F105 HydrophobicContact CB-CG 4.25Å
45	F	82.1	Confident	74.3	Confident	107 Å²	107	108.8 Å²	108.8	47%	0.469	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	124	176.4	-56.9	-63.6	0	0	0	112.8	T43 F47 P99 R100	T43-F45 PolarHBondContact O-N 3.29Å; T43-F45 PolarHBondContact OG1-O 3.12Å; T43-F45 VanDerWaalsContact OG1-O 3.06Å; F45-F47 HydrophobicContact CB-CD2 4.43Å; F45-F47 HydrophobicContact CB-CE2 3.68Å; F45-F47 HydrophobicContact CB-CZ 3.96Å; F45-P99 HydrophobicContact CB-CB 3.89Å; F45-P99 HydrophobicContact CD1-CB 3.99Å; F45-P99 HydrophobicContact CD1-CG 4.37Å; F45-P99 HydrophobicContact CG-CB 4.24Å; F45-R100 CarbonylContact C-O 3.56Å; F45-R100 WeakPolarHBondContact CA-O 3.42Å
46	I	86.3	Confident	76.1	Confident	51 Å²	51	98.7 Å²	98.7	26%	0.262	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	118.7	169.8	-60.5	175	0	0	0	108.2	T48 L96 P99 R100 H102	I46-T48 WeakPolarHBondContact CG2-O 3.41Å; I46-L96 HydrophobicContact CG2-CD1 4.35Å; I46-P99 WeakPolarHBondContact O-CA 2.94Å; I46-R100 WeakPolarHBondContact CB-O 3.29Å; I46-R100 PolarHBondContact N-O 3.4Å; I46-R100 PolarHBondContact O-N 3.15Å; I46-H102 HydrophobicContact CD1-CB 3.85Å; I46-H102 HydrophobicContact CG1-CB 3.91Å
47	F	85.9	Confident	78	Confident	116 Å²	116	101 Å²	101	51%	0.509	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	-7.5	176	-63.9	-88.7	0	0	0	113	F45 K95 L96 P99	F45-F47 HydrophobicContact CB-CD2 4.43Å; F45-F47 HydrophobicContact CB-CE2 3.68Å; F45-F47 HydrophobicContact CB-CZ 3.96Å; F47-K95 WeakPolarHBondContact O-CA 3.23Å; F47-L96 PolarHBondContact O-N 2.79Å; F47-P99 HydrophobicContact CD1-CB 3.97Å; F47-P99 HydrophobicContact CE1-CB 3.65Å; F47-P99 HydrophobicContact CE1-CG 4.01Å; F47-P99 HydrophobicContact CZ-CB 3.96Å; F47-P99 HydrophobicContact CZ-CG 4.46Å
48	T	89.1	Confident	79.8	Confident	69 Å²	69	97.7 Å²	97.7	42%	0.423	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	136.7	-175.2	58.2	0	0	0	0	111.8	I46 I93 V94 K95	I46-T48 WeakPolarHBondContact CG2-O 3.41Å; T48-I93 HydrophobicContact CG2-CG2 4.01Å; T48-V94 CarbonylContact C-O 3.6Å; T48-V94 VanDerWaalsContact CA-O 3.3Å; T48-V94 WeakPolarHBondContact CA-O 3.47Å; T48-K95 HydrophobicContact CG2-CG 4.32Å
49	R	89.3	Confident	81.8	Confident	116 Å²	116	97.9 Å²	97.9	44%	0.438	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.8	143	174.7	-164.4	-169.8	92.3	-170.8	6.1	110.2	S51 V94 L96	R49-S51 PolarHBondContact O-N 2.85Å; R49-V94 PolarHBondContact N-O 2.97Å; R49-V94 PolarHBondContact O-N 2.63Å; R49-L96 HydrophobicContact CB-CD1 4.37Å; R49-L96 HydrophobicContact CB-CD2 4.01Å; R49-L96 HydrophobicContact CB-CG 4.32Å
50	R	88.4	Confident	83.5	Confident	220 Å²	220	95.6 Å²	95.6	83%	0.83	47%	0.466	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.9	123.2	164.4	-167.3	171.9	179.3	157.6	0.1	109
51	S	88.9	Confident	85.3	Confident	15 Å²	15	91 Å²	91	11%	0.105	45%	0.454	C	S	.	.			trans	-90.2	154.7	174.5	80.8	0	0	0	0	111	R49 Q91 G92	R49-S51 PolarHBondContact O-N 2.85Å; S51-Q91 WeakPolarHBondContact OG-CB 3.37Å; S51-Q91 PolarHBondContact OG-OE1 2.78Å; S51-G92 PolarHBondContact N-O 2.96Å; S51-G92 PolarHBondContact OG-O 3.01Å
52	S	89.6	Confident	87.1	Confident	67 Å²	67	82.5 Å²	82.5	47%	0.469	42%	0.422	S	S	.	.			trans	-105.3	18.1	171.1	50.5	0	0	0	0	111.2	H63	S52-H63 PolarHBondContact O-ND1 3.35Å; S52-H63 PolarHBondContact OG-CE1 2.87Å; S52-H63 PolarHBondContact OG-ND1 3.42Å; S52-H63 VanDerWaalsContact OG-ND1 3.11Å
53	L	93.1	Very high	88.6	Confident	35 Å²	35	85.5 Å²	85.5	18%	0.183	43%	0.43	C	S	.	.			trans	-95.9	151.5	-179.7	-66.9	164.4	0	0	0	109.7	L61 A62 H63 Q91	L53-L61 HydrophobicContact CB-CD1 3.58Å; L53-L61 HydrophobicContact CB-CG 3.95Å; L53-L61 HydrophobicContact CD1-CD1 4.48Å; L53-L61 HydrophobicContact CD1-CD2 3.88Å; L53-L61 HydrophobicContact CD1-CG 4.06Å; L53-L61 HydrophobicContact CD2-CG 4.37Å; L53-L61 HydrophobicContact CG-CD1 4.5Å; L53-L61 HydrophobicContact CG-CG 4.35Å; L53-A62 CarbonylContact C-O 3.59Å; L53-A62 WeakPolarHBondContact CA-O 3.25Å; L53-H63 WeakPolarHBondContact CD2-CE1 3.37Å; L53-H63 WeakPolarHBondContact CD2-ND1 3.26Å; L53-Q91 HydrophobicContact CB-CB 4.3Å; L53-Q91 WeakPolarHBondContact O-CB 3.48Å; L53-Q91 PolarHBondContact O-N 2.79Å
54	Y	94	Very high	89.6	Confident	92 Å²	92	85 Å²	85	36%	0.361	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	147.4	178.6	-63.2	-96.5	0	0	0	109.6	L61 A62 F65 L88 I89 P90	Y54-L61 WeakPolarHBondContact O-CA 3.41Å; Y54-A62 PolarHBondContact N-O 2.79Å; Y54-A62 PolarHBondContact O-N 2.88Å; Y54-F65 VanDerWaalsContact O-CE2 3.26Å; Y54-F65 WeakPolarHBondContact O-CE2 3.1Å; Y54-F65 WeakPolarHBondContact O-CZ 3.44Å; Y54-L88 HydrophobicContact CD1-CB 3.97Å; Y54-L88 HydrophobicContact CG-CB 4.27Å; Y54-I89 CarbonylContact C-O 3.54Å; Y54-I89 VanDerWaalsContact CA-O 3.28Å; Y54-I89 WeakPolarHBondContact CA-O 3Å; Y54-P90 HydrophobicContact CD1-CB 3.95Å; Y54-P90 HydrophobicContact CE1-CB 3.77Å
55	Y	93.8	Very high	90.3	Very high	88 Å²	88	83.9 Å²	83.9	35%	0.345	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	136.4	165.4	-64.7	-80.4	0	0	0	109.4	D60 L61 L88 I89 Q91	Y55-D60 VanDerWaalsContact CA-O 3.25Å; Y55-D60 WeakPolarHBondContact CA-O 3.32Å; Y55-L61 HydrophobicContact CD1-CB 4.29Å; Y55-L61 HydrophobicContact CD1-CD1 3.95Å; Y55-L61 HydrophobicContact CD2-CD1 4.12Å; Y55-L61 HydrophobicContact CE1-CB 4.07Å; Y55-L61 HydrophobicContact CE1-CD1 3.73Å; Y55-L61 HydrophobicContact CE1-CG 4.32Å; Y55-L61 HydrophobicContact CE2-CD1 3.9Å; Y55-L61 HydrophobicContact CG-CD1 4.15Å; Y55-L88 CarbonylContact O-C 3.51Å; Y55-L88 WeakPolarHBondContact O-CA 3.26Å; Y55-I89 PolarHBondContact N-O 2.73Å; Y55-I89 PolarHBondContact O-N 3.06Å; Y55-Q91 HydrophobicContact CD2-CB 4.35Å; Y55-Q91 HydrophobicContact CE2-CB 3.87Å; Y55-Q91 HydrophobicContact CE2-CG 3.95Å
56	D	91.7	Very high	90.8	Very high	32 Å²	32	84.4 Å²	84.4	17%	0.171	41%	0.411	C	S	.	.			trans	-90.8	-171.2	167	68.9	1.7	0	0	0	112	D58 G59 D60 F65 L88	D56-D58 PolarHBondContact O-N 2.85Å; D56-D58 PolarHBondContact OD1-N 3.19Å; D56-D58 VanDerWaalsContact OD1-N 3.12Å; D56-G59 PolarHBondContact O-N 2.85Å; D56-G59 PolarHBondContact OD1-N 3.47Å; D56-D60 PolarHBondContact N-O 2.85Å; D56-D60 PolarHBondContact OD1-N 2.83Å; D56-F65 HydrophobicContact CB-CD1 3.69Å; D56-F65 HydrophobicContact CB-CD2 4.44Å; D56-F65 HydrophobicContact CB-CE1 3.5Å; D56-F65 HydrophobicContact CB-CE2 4.26Å; D56-F65 HydrophobicContact CB-CG 4.17Å; D56-F65 HydrophobicContact CB-CZ 3.8Å; D56-F65 WeakPolarHBondContact OD2-CD1 3.26Å; D56-F65 WeakPolarHBondContact OD2-CE1 3.38Å; D56-L88 HydrophobicContact CB-CD2 3.85Å
57	E	88.4	Confident	90.9	Very high	151 Å²	151	87.5 Å²	87.5	71%	0.706	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.9	-26	-178.8	-62.5	-176.4	177.9	0	0	112.4	N87	E57-N87 HydrophobicContact CG-CB 4.39Å; E57-N87 WeakPolarHBondContact OE1-CB 3.44Å; E57-N87 PolarHBondContact OE1-ND2 3.04Å
58	D	89.5	Confident	91	Very high	146 Å²	146	87.6 Å²	87.6	78%	0.781	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.1	-8.7	179.8	-64.4	-42.5	0	0	0	112.4	D56	D56-D58 PolarHBondContact O-N 2.85Å; D56-D58 PolarHBondContact OD1-N 3.19Å; D56-D58 VanDerWaalsContact OD1-N 3.12Å
59	G	90.3	Very high	90.7	Very high	45 Å²	45	85.5 Å²	85.5	46%	0.464	41%	0.414	S	S	.	.			trans	87.8	11.5	179.3	0	0	0	0	0	113.9	D56	D56-G59 PolarHBondContact O-N 2.85Å; D56-G59 PolarHBondContact OD1-N 3.47Å
60	D	92.9	Very high	90.3	Very high	106 Å²	106	85.9 Å²	85.9	57%	0.567	42%	0.424	S	S	*	.			trans	-71.2	145	173.9	-79.3	-15.7	0	0	0	110.2	Y55 D56 F65	Y55-D60 VanDerWaalsContact CA-O 3.25Å; Y55-D60 WeakPolarHBondContact CA-O 3.32Å; D56-D60 PolarHBondContact N-O 2.85Å; D56-D60 PolarHBondContact OD1-N 2.83Å; D60-F65 HydrophobicContact CB-CE1 4.03Å; D60-F65 VanDerWaalsContact O-CZ 3.26Å; D60-F65 WeakPolarHBondContact O-CZ 3.28Å
61	L	93.1	Very high	89.7	Confident	73 Å²	73	77.5 Å²	77.5	38%	0.382	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	109.7	-176.5	-174.1	68.8	0	0	0	110.7	L53 Y54 Y55 Q91	L53-L61 HydrophobicContact CB-CD1 3.58Å; L53-L61 HydrophobicContact CB-CG 3.95Å; L53-L61 HydrophobicContact CD1-CD1 4.48Å; L53-L61 HydrophobicContact CD1-CD2 3.88Å; L53-L61 HydrophobicContact CD1-CG 4.06Å; L53-L61 HydrophobicContact CD2-CG 4.37Å; L53-L61 HydrophobicContact CG-CD1 4.5Å; L53-L61 HydrophobicContact CG-CG 4.35Å; Y54-L61 WeakPolarHBondContact O-CA 3.41Å; Y55-L61 HydrophobicContact CD1-CB 4.29Å; Y55-L61 HydrophobicContact CD1-CD1 3.95Å; Y55-L61 HydrophobicContact CD2-CD1 4.12Å; Y55-L61 HydrophobicContact CE1-CB 4.07Å; Y55-L61 HydrophobicContact CE1-CD1 3.73Å; Y55-L61 HydrophobicContact CE1-CG 4.32Å; Y55-L61 HydrophobicContact CE2-CD1 3.9Å; Y55-L61 HydrophobicContact CG-CD1 4.15Å; L61-Q91 HydrophobicContact CD1-CB 4.07Å; L61-Q91 HydrophobicContact CD1-CG 4.39Å
62	A	94.1	Very high	89.1	Confident	29 Å²	29	81.4 Å²	81.4	24%	0.24	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	164.8	-179	0	0	0	0	0	112.8	L53 Y54 E64 F65	L53-A62 CarbonylContact C-O 3.59Å; L53-A62 WeakPolarHBondContact CA-O 3.25Å; Y54-A62 PolarHBondContact N-O 2.79Å; Y54-A62 PolarHBondContact O-N 2.88Å; A62-E64 VanDerWaalsContact C-N 3.35Å; A62-F65 HydrophobicContact CB-CD2 4.44Å; A62-F65 HydrophobicContact CB-CE1 3.94Å; A62-F65 HydrophobicContact CB-CE2 3.84Å; A62-F65 HydrophobicContact CB-CZ 3.56Å
63	H	93.2	Very high	88.4	Confident	101 Å²	101	85.4 Å²	85.4	47%	0.468	43%	0.43	S	S	.	.	S	Bend	trans	-73.9	-31.5	172.2	-74.4	-49.2	0	0	0	111.9	S52 L53	S52-H63 PolarHBondContact O-ND1 3.35Å; S52-H63 PolarHBondContact OG-CE1 2.87Å; S52-H63 PolarHBondContact OG-ND1 3.42Å; S52-H63 VanDerWaalsContact OG-ND1 3.11Å; L53-H63 WeakPolarHBondContact CD2-CE1 3.37Å; L53-H63 WeakPolarHBondContact CD2-ND1 3.26Å
64	E	91.1	Very high	87.3	Confident	80 Å²	80	91.9 Å²	91.9	37%	0.374	46%	0.464	S	S	.	.			trans	-150.1	138.9	-174.4	-51.1	-168	156.2	0	0	109.8	A62 Y66 R83	A62-E64 VanDerWaalsContact C-N 3.35Å; E64-Y66 HydrophobicContact CB-CE2 3.79Å; E64-Y66 PolarHBondContact OE2-OH 2.83Å; E64-R83 VanDerWaalsContact CD-NH1 3.28Å; E64-R83 VanDerWaalsContact CD-NH2 3.29Å; E64-R83 IonicContact OE1-CZ 3.11Å; E64-R83 IonicContact OE1-NH1 2.8Å; E64-R83 PolarHBondContact OE1-NH1 2.81Å; E64-R83 IonicContact OE1-NH2 2.87Å; E64-R83 PolarHBondContact OE1-NH2 3.39Å; E64-R83 IonicContact OE2-CZ 3.74Å; E64-R83 IonicContact OE2-NH1 3.46Å; E64-R83 PolarHBondContact OE2-NH1 3.49Å
65	F	92.6	Very high	86.6	Confident	23 Å²	23	91.3 Å²	91.3	10%	0.101	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	142.8	176.2	-68.4	-90.4	0	0	0	110.3	Y54 D56 D60 A62 R83 I84 L88	Y54-F65 VanDerWaalsContact O-CE2 3.26Å; Y54-F65 WeakPolarHBondContact O-CE2 3.1Å; Y54-F65 WeakPolarHBondContact O-CZ 3.44Å; D56-F65 HydrophobicContact CB-CD1 3.69Å; D56-F65 HydrophobicContact CB-CD2 4.44Å; D56-F65 HydrophobicContact CB-CE1 3.5Å; D56-F65 HydrophobicContact CB-CE2 4.26Å; D56-F65 HydrophobicContact CB-CG 4.17Å; D56-F65 HydrophobicContact CB-CZ 3.8Å; D56-F65 WeakPolarHBondContact OD2-CD1 3.26Å; D56-F65 WeakPolarHBondContact OD2-CE1 3.38Å; D60-F65 HydrophobicContact CB-CE1 4.03Å; D60-F65 VanDerWaalsContact O-CZ 3.26Å; D60-F65 WeakPolarHBondContact O-CZ 3.28Å; A62-F65 HydrophobicContact CB-CD2 4.44Å; A62-F65 HydrophobicContact CB-CE1 3.94Å; A62-F65 HydrophobicContact CB-CE2 3.84Å; A62-F65 HydrophobicContact CB-CZ 3.56Å; F65-R83 WeakPolarHBondContact O-CA 3.43Å; F65-I84 PolarHBondContact O-N 2.92Å; F65-L88 HydrophobicContact CB-CD1 4.42Å; F65-L88 HydrophobicContact CB-CD2 4.18Å; F65-L88 HydrophobicContact CD2-CD1 3.71Å; F65-L88 HydrophobicContact CD2-CD2 3.35Å; F65-L88 HydrophobicContact CD2-CG 4.17Å; F65-L88 HydrophobicContact CE2-CD2 3.85Å; F65-L88 HydrophobicContact CG-CD1 4.47Å; F65-L88 HydrophobicContact CG-CD2 3.82Å
66	Y	92.1	Very high	85.7	Confident	118 Å²	118	95.8 Å²	95.8	46%	0.463	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.7	131.6	178.9	-67.6	-96.1	0	0	0	109.3	E64 L81 K82 R83	E64-Y66 HydrophobicContact CB-CE2 3.79Å; E64-Y66 PolarHBondContact OE2-OH 2.83Å; Y66-L81 HydrophobicContact CD1-CB 4.39Å; Y66-K82 CarbonylContact C-O 3.53Å; Y66-K82 VanDerWaalsContact CA-O 3.26Å; Y66-K82 WeakPolarHBondContact CA-O 3.33Å; Y66-R83 HydrophobicContact CD1-CB 3.96Å; Y66-R83 HydrophobicContact CE1-CB 3.62Å; Y66-R83 HydrophobicContact CE1-CG 4.17Å
67	E	87.8	Confident	85.3	Confident	115 Å²	115	102.2 Å²	102.2	54%	0.537	53%	0.529	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	139.5	173	170.5	-175.8	-156	0	0	110.1	T69 L81 K82 I84	E67-T69 PolarHBondContact O-N 3.29Å; E67-L81 CarbonylContact O-C 3.6Å; E67-L81 WeakPolarHBondContact O-CA 3.41Å; E67-K82 PolarHBondContact N-O 3.03Å; E67-K82 PolarHBondContact O-N 2.68Å; E67-I84 HydrophobicContact CB-CD1 3.27Å; E67-I84 HydrophobicContact CB-CG1 3.94Å; E67-I84 HydrophobicContact CG-CD1 4.34Å
68	E	88.1	Confident	84.9	Confident	118 Å²	118	102.7 Å²	102.7	55%	0.551	53%	0.525	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.9	115.8	173.8	-171.1	177.4	177	0	0	110.1	S79 L81	E68-S79 WeakPolarHBondContact OE1-CB 3.49Å; E68-L81 HydrophobicContact CB-CD2 4.06Å
69	T	83.1	Confident	84.6	Confident	26 Å²	26	99.5 Å²	99.5	16%	0.16	51%	0.513	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	127	171.7	60.4	0	0	0	0	110.1	E67 V71 K80 K82	E67-T69 PolarHBondContact O-N 3.29Å; T69-V71 PolarHBondContact O-N 2.85Å; T69-K80 PolarHBondContact N-O 2.8Å; T69-K80 PolarHBondContact O-N 2.95Å; T69-K80 PolarHBondContact OG1-O 2.84Å; T69-K82 HydrophobicContact CG2-CB 4.34Å; T69-K82 HydrophobicContact CG2-CD 3.75Å; T69-K82 HydrophobicContact CG2-CG 4.09Å; T69-K82 VanDerWaalsContact OG1-CE 3.29Å; T69-K82 WeakPolarHBondContact OG1-CE 3.3Å
70	L	81.1	Confident	84.5	Confident	124 Å²	124	103.4 Å²	103.4	65%	0.649	52%	0.518	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.4	108.8	171.6	-62.7	179.6	0	0	0	108.7
71	V	76.3	Confident	84.4	Confident	43 Å²	43	103.8 Å²	103.8	26%	0.261	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	113.5	176.4	-173.6	0	0	0	0	108.2	T69 K73 R78 K80	T69-V71 PolarHBondContact O-N 2.85Å; V71-K73 HydrophobicContact CG1-CG 4.04Å; V71-K73 PolarHBondContact O-N 2.87Å; V71-R78 PolarHBondContact N-O 2.9Å; V71-R78 PolarHBondContact O-N 2.8Å; V71-R78 VanDerWaalsContact O-O 3.13Å; V71-K80 HydrophobicContact CG2-CB 4.09Å
72	T	75.5	Confident	84.3	Confident	98 Å²	98	105.6 Å²	105.6	60%	0.601	52%	0.524	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.9	111.1	170	51.8	0	0	0	0	109	K77	T72-K77 HydrophobicContact CG2-CG 3.98Å
73	K	74.1	Confident	84.2	Confident	151 Å²	151	109.9 Å²	109.9	66%	0.657	53%	0.534	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119.4	125.4	166	-72.5	-167.8	175.2	-169.1	0	108.4	V71 G75 R76	V71-K73 HydrophobicContact CG1-CG 4.04Å; V71-K73 PolarHBondContact O-N 2.87Å; K73-G75 PolarHBondContact O-N 2.95Å; K73-R76 PolarHBondContact N-O 3.46Å; K73-R76 PolarHBondContact O-N 3.11Å
74	N	71.2	Confident	84	Confident	170 Å²	170	107.4 Å²	107.4	91%	0.909	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.8	46.5	178.1	-55.5	-6.1	0	0	0	113.5	R76	N74-R76 PolarHBondContact O-N 2.85Å
75	G	77.8	Confident	83.8	Confident	81 Å²	81	110.8 Å²	110.8	84%	0.835	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.1	-7.4	179.5	0	0	0	0	0	115.4	K73	K73-G75 PolarHBondContact O-N 2.95Å
76	R	76.3	Confident	83.6	Confident	182 Å²	182	117.7 Å²	117.7	69%	0.687	57%	0.57	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-97.2	119.4	176.7	-157.1	166.6	-177.6	176.8	0.3	109.4	K73 N74 R78	K73-R76 PolarHBondContact N-O 3.46Å; K73-R76 PolarHBondContact O-N 3.11Å; N74-R76 PolarHBondContact O-N 2.85Å; R76-R78 PolarHBondContact O-N 3.4Å
77	K	82.1	Confident	83.3	Confident	166 Å²	166	117.7 Å²	117.7	72%	0.722	58%	0.577	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-68.8	124	172.4	-67.5	179.6	-179.2	-177.8	0	108.3	T72	T72-K77 HydrophobicContact CG2-CG 3.98Å
78	R	79.8	Confident	83.4	Confident	162 Å²	162	113.7 Å²	113.7	61%	0.611	56%	0.56	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-123.3	130.8	169.8	-67.3	-172.8	178.3	-175.3	-0.2	108.1	V71 R76	V71-R78 PolarHBondContact N-O 2.9Å; V71-R78 PolarHBondContact O-N 2.8Å; V71-R78 VanDerWaalsContact O-O 3.13Å; R76-R78 PolarHBondContact O-N 3.4Å
79	S	83.6	Confident	83.6	Confident	78 Å²	78	113.3 Å²	113.3	55%	0.545	56%	0.56	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-75.3	137.2	166.8	47	0	0	0	0	109.6	E68	E68-S79 WeakPolarHBondContact OE1-CB 3.49Å
80	K	88.5	Confident	84	Confident	128 Å²	128	116 Å²	116	56%	0.557	58%	0.578	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-136.8	125.4	173.4	-176	177.1	-178.8	-179.1	0	109	T69 V71	T69-K80 PolarHBondContact N-O 2.8Å; T69-K80 PolarHBondContact O-N 2.95Å; T69-K80 PolarHBondContact OG1-O 2.84Å; V71-K80 HydrophobicContact CG2-CB 4.09Å
81	L	91.1	Very high	84.5	Confident	114 Å²	114	112.4 Å²	112.4	60%	0.597	56%	0.558	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-71.8	129.5	169.9	-63.9	176.1	0	0	0	110	Y66 E67 E68	Y66-L81 HydrophobicContact CD1-CB 4.39Å; E67-L81 CarbonylContact O-C 3.6Å; E67-L81 WeakPolarHBondContact O-CA 3.41Å; E68-L81 HydrophobicContact CB-CD2 4.06Å
82	K	90.2	Very high	85.1	Confident	110 Å²	110	111.6 Å²	111.6	48%	0.478	56%	0.559	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-117.5	134	171.5	-71.9	-172.3	-171.3	168.9	0	108.9	Y66 E67 T69 I84	Y66-K82 CarbonylContact C-O 3.53Å; Y66-K82 VanDerWaalsContact CA-O 3.26Å; Y66-K82 WeakPolarHBondContact CA-O 3.33Å; E67-K82 PolarHBondContact N-O 3.03Å; E67-K82 PolarHBondContact O-N 2.68Å; T69-K82 HydrophobicContact CG2-CB 4.34Å; T69-K82 HydrophobicContact CG2-CD 3.75Å; T69-K82 HydrophobicContact CG2-CG 4.09Å; T69-K82 VanDerWaalsContact OG1-CE 3.29Å; T69-K82 WeakPolarHBondContact OG1-CE 3.3Å; K82-I84 PolarHBondContact O-N 2.85Å
83	R	91.8	Very high	85.8	Confident	119 Å²	119	113 Å²	113	45%	0.449	56%	0.561	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-66.8	131.1	174.5	-174.2	178	176	150.6	7	109.9	E64 F65 Y66	E64-R83 VanDerWaalsContact CD-NH1 3.28Å; E64-R83 VanDerWaalsContact CD-NH2 3.29Å; E64-R83 IonicContact OE1-CZ 3.11Å; E64-R83 IonicContact OE1-NH1 2.8Å; E64-R83 PolarHBondContact OE1-NH1 2.81Å; E64-R83 IonicContact OE1-NH2 2.87Å; E64-R83 PolarHBondContact OE1-NH2 3.39Å; E64-R83 IonicContact OE2-CZ 3.74Å; E64-R83 IonicContact OE2-NH1 3.46Å; E64-R83 PolarHBondContact OE2-NH1 3.49Å; F65-R83 WeakPolarHBondContact O-CA 3.43Å; Y66-R83 HydrophobicContact CD1-CB 3.96Å; Y66-R83 HydrophobicContact CE1-CB 3.62Å; Y66-R83 HydrophobicContact CE1-CG 4.17Å
84	I	89.1	Confident	86.5	Confident	50 Å²	50	108 Å²	108	26%	0.256	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	139.4	171.7	-61.1	166.1	0	0	0	109	F65 E67 K82 K86	F65-I84 PolarHBondContact O-N 2.92Å; E67-I84 HydrophobicContact CB-CD1 3.27Å; E67-I84 HydrophobicContact CB-CG1 3.94Å; E67-I84 HydrophobicContact CG-CD1 4.34Å; K82-I84 PolarHBondContact O-N 2.85Å; I84-K86 VanDerWaalsContact CG2-O 3.23Å; I84-K86 WeakPolarHBondContact CG2-O 3.37Å
85	Q	87.5	Confident	87.4	Confident	151 Å²	151	108.3 Å²	108.3	71%	0.706	54%	0.536	S	S	*	.			trans	-128.9	-1.5	169.8	-65.1	-177.3	-15.2	0	0	112.1
86	K	88.4	Confident	87.9	Confident	168 Å²	168	106.4 Å²	106.4	73%	0.73	51%	0.507	S	S	*	.	S	Bend	trans	-94.6	152.7	179.8	-61.5	-176.7	178.9	-176.6	0	109.1	I84 L88	I84-K86 VanDerWaalsContact CG2-O 3.23Å; I84-K86 WeakPolarHBondContact CG2-O 3.37Å; K86-L88 PolarHBondContact O-N 3.18Å
87	N	86	Confident	88.4	Confident	117 Å²	117	105.3 Å²	105.3	63%	0.626	51%	0.514	S	S	*	.	S	Bend	trans	59	14.4	176.6	-52.7	-8.5	0	0	0	115.3	E57	E57-N87 HydrophobicContact CG-CB 4.39Å; E57-N87 WeakPolarHBondContact OE1-CB 3.44Å; E57-N87 PolarHBondContact OE1-ND2 3.04Å
88	L	90.3	Very high	88.6	Confident	32 Å²	32	104.5 Å²	104.5	17%	0.168	51%	0.513	C	S	.	.	P	Polyproline II helix	trans	-90.1	128.2	176.2	-65	-177.3	0	0	0	110.3	Y54 Y55 D56 F65 K86	Y54-L88 HydrophobicContact CD1-CB 3.97Å; Y54-L88 HydrophobicContact CG-CB 4.27Å; Y55-L88 CarbonylContact O-C 3.51Å; Y55-L88 WeakPolarHBondContact O-CA 3.26Å; D56-L88 HydrophobicContact CB-CD2 3.85Å; F65-L88 HydrophobicContact CB-CD1 4.42Å; F65-L88 HydrophobicContact CB-CD2 4.18Å; F65-L88 HydrophobicContact CD2-CD1 3.71Å; F65-L88 HydrophobicContact CD2-CD2 3.35Å; F65-L88 HydrophobicContact CD2-CG 4.17Å; F65-L88 HydrophobicContact CE2-CD2 3.85Å; F65-L88 HydrophobicContact CG-CD1 4.47Å; F65-L88 HydrophobicContact CG-CD2 3.82Å; K86-L88 PolarHBondContact O-N 3.18Å
89	I	91.4	Very high	89	Confident	110 Å²	110	99.7 Å²	99.7	56%	0.564	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.8	118.1	178.8	-58.5	171.6	0	0	0	108.3	Y54 Y55 Q91	Y54-I89 CarbonylContact C-O 3.54Å; Y54-I89 VanDerWaalsContact CA-O 3.28Å; Y54-I89 WeakPolarHBondContact CA-O 3Å; Y55-I89 PolarHBondContact N-O 2.73Å; Y55-I89 PolarHBondContact O-N 3.06Å; I89-Q91 PolarHBondContact O-N 2.78Å
90	P	92.8	Very high	89	Confident	81 Å²	81	103.3 Å²	103.3	53%	0.526	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.7	133.9	178.3	27.4	-33.3	0	0	0	110.5	Y54 G92	Y54-P90 HydrophobicContact CD1-CB 3.95Å; Y54-P90 HydrophobicContact CE1-CB 3.77Å; P90-G92 PolarHBondContact O-N 3.34Å
91	Q	90	Very high	88.9	Confident	49 Å²	49	100.7 Å²	100.7	23%	0.229	50%	0.495	C	S	.	.			trans	-65.1	-26.3	174.6	179.1	-167.5	39.4	0	0	111.8	S51 L53 Y55 L61 I89 V94	S51-Q91 WeakPolarHBondContact OG-CB 3.37Å; S51-Q91 PolarHBondContact OG-OE1 2.78Å; L53-Q91 HydrophobicContact CB-CB 4.3Å; L53-Q91 WeakPolarHBondContact O-CB 3.48Å; L53-Q91 PolarHBondContact O-N 2.79Å; Y55-Q91 HydrophobicContact CD2-CB 4.35Å; Y55-Q91 HydrophobicContact CE2-CB 3.87Å; Y55-Q91 HydrophobicContact CE2-CG 3.95Å; L61-Q91 HydrophobicContact CD1-CB 4.07Å; L61-Q91 HydrophobicContact CD1-CG 4.39Å; I89-Q91 PolarHBondContact O-N 2.78Å; Q91-V94 VanDerWaalsContact CD-CG2 3.44Å; Q91-V94 HydrophobicContact CG-CG2 3.73Å
92	G	89.7	Confident	88.5	Confident	27 Å²	27	97.8 Å²	97.8	28%	0.278	48%	0.479	S	S	.	.			trans	77.4	-130.4	168.1	0	0	0	0	0	114.2	S51 P90	S51-G92 PolarHBondContact N-O 2.96Å; S51-G92 PolarHBondContact OG-O 3.01Å; P90-G92 PolarHBondContact O-N 3.34Å
93	I	90.5	Very high	88	Confident	128 Å²	128	99.2 Å²	99.2	66%	0.656	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.9	114.7	-177.4	-59.8	174.4	0	0	0	108.9	T48	T48-I93 HydrophobicContact CG2-CG2 4.01Å
94	V	88.8	Confident	87.5	Confident	44 Å²	44	99.6 Å²	99.6	27%	0.267	51%	0.507	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	130.3	-178.5	-178.9	0	0	0	0	109.8	T48 R49 Q91	T48-V94 CarbonylContact C-O 3.6Å; T48-V94 VanDerWaalsContact CA-O 3.3Å; T48-V94 WeakPolarHBondContact CA-O 3.47Å; R49-V94 PolarHBondContact N-O 2.97Å; R49-V94 PolarHBondContact O-N 2.63Å; Q91-V94 VanDerWaalsContact CD-CG2 3.44Å; Q91-V94 HydrophobicContact CG-CG2 3.73Å
95	K	90.6	Very high	87	Confident	178 Å²	178	100.9 Å²	100.9	77%	0.774	51%	0.511	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-71.1	133.1	171.6	-68.2	-178.8	-179.5	176.9	0	109.7	F47 T48	F47-K95 WeakPolarHBondContact O-CA 3.23Å; T48-K95 HydrophobicContact CG2-CG 4.32Å
96	L	86.8	Confident	86.5	Confident	41 Å²	41	100 Å²	100	22%	0.215	52%	0.518	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88	136.6	177.4	-61.7	172.3	0	0	0	109.2	I46 F47 R49 H98 R100	I46-L96 HydrophobicContact CG2-CD1 4.35Å; F47-L96 PolarHBondContact O-N 2.79Å; R49-L96 HydrophobicContact CB-CD1 4.37Å; R49-L96 HydrophobicContact CB-CD2 4.01Å; R49-L96 HydrophobicContact CB-CG 4.32Å; L96-H98 WeakPolarHBondContact CB-O 3.23Å; L96-H98 PolarHBondContact O-N 3.36Å; L96-R100 HydrophobicContact CD1-CB 4.35Å; L96-R100 HydrophobicContact CD1-CG 3.96Å
97	N	88	Confident	85.7	Confident	158 Å²	158	95.4 Å²	95.4	85%	0.845	51%	0.505	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-61.8	-36.1	174.8	-66.1	-17.9	0	0	0	111.7
98	H	86.3	Confident	85.1	Confident	150 Å²	150	97.2 Å²	97.2	69%	0.694	51%	0.512	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.1	136.5	177.7	-56.5	95.6	0	0	0	109.7	L96	L96-H98 WeakPolarHBondContact CB-O 3.23Å; L96-H98 PolarHBondContact O-N 3.36Å
99	P	86.9	Confident	84.5	Confident	61 Å²	61	102.4 Å²	102.4	40%	0.396	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.2	141.2	175.9	24.1	-31.1	0	0	0	111	F45 I46 F47	F45-P99 HydrophobicContact CB-CB 3.89Å; F45-P99 HydrophobicContact CD1-CB 3.99Å; F45-P99 HydrophobicContact CD1-CG 4.37Å; F45-P99 HydrophobicContact CG-CB 4.24Å; I46-P99 WeakPolarHBondContact O-CA 2.94Å; F47-P99 HydrophobicContact CD1-CB 3.97Å; F47-P99 HydrophobicContact CE1-CB 3.65Å; F47-P99 HydrophobicContact CE1-CG 4.01Å; F47-P99 HydrophobicContact CZ-CB 3.96Å; F47-P99 HydrophobicContact CZ-CG 4.46Å
100	R	84.8	Confident	83.5	Confident	154 Å²	154	102.5 Å²	102.5	58%	0.581	55%	0.549	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.5	151.4	175.2	-64.9	-174.9	77.3	174.5	4.5	110.8	F45 I46 L96	F45-R100 CarbonylContact C-O 3.56Å; F45-R100 WeakPolarHBondContact CA-O 3.42Å; I46-R100 WeakPolarHBondContact CB-O 3.29Å; I46-R100 PolarHBondContact N-O 3.4Å; I46-R100 PolarHBondContact O-N 3.15Å; L96-R100 HydrophobicContact CD1-CB 4.35Å; L96-R100 HydrophobicContact CD1-CG 3.96Å
101	I	85.8	Confident	82.9	Confident	72 Å²	72	108 Å²	108	37%	0.369	57%	0.567	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-75.5	136.2	178.3	-57.9	173.6	0	0	0	109.8	P44 V107 L109	P44-I101 CarbonylContact O-C 3.44Å; P44-I101 VanDerWaalsContact O-CA 3.23Å; P44-I101 WeakPolarHBondContact O-CA 3.37Å; I101-V107 HydrophobicContact CD1-CB 4.31Å; I101-V107 HydrophobicContact CD1-CG1 4.46Å; I101-V107 HydrophobicContact CG2-CB 4.43Å; I101-V107 HydrophobicContact CG2-CG2 3.98Å; I101-L109 HydrophobicContact CD1-CD1 4.36Å; I101-L109 HydrophobicContact CD1-CD2 4.46Å
102	H	83.9	Confident	81.6	Confident	54 Å²	54	115.6 Å²	115.6	25%	0.25	62%	0.617	C	S	.	*			trans	-71.4	134.6	176.6	-170.9	-75.2	0	0	0	110.8	P44 I46 D104 F105	P44-H102 PolarHBondContact O-N 3.27Å; I46-H102 HydrophobicContact CD1-CB 3.85Å; I46-H102 HydrophobicContact CG1-CB 3.91Å; H102-D104 IonicContact CE1-OD2 3.27Å; H102-D104 PolarHBondContact CE1-OD2 3.45Å; H102-D104 VanDerWaalsContact CE1-OD2 3.27Å; H102-D104 PolarHBondContact ND1-N 3.09Å; H102-D104 IonicContact ND1-OD2 3.88Å; H102-D104 PolarHBondContact O-N 3.26Å; H102-D104 VanDerWaalsContact O-N 3.15Å; H102-F105 HydrophobicContact CB-CD2 3.72Å; H102-F105 HydrophobicContact CB-CE2 4.3Å; H102-F105 AromaticContact CG-CD2 3.94Å; H102-F105 AromaticContact ND1-CD2 3.76Å; H102-F105 PolarHBondContact O-N 2.67Å
103	V	79.8	Confident	81.2	Confident	139 Å²	139	120 Å²	120	84%	0.842	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.9	-31.5	-170.7	-175.9	0	0	0	0	112.7	F105	V103-F105 VanDerWaalsContact C-N 3.26Å; V103-F105 PolarHBondContact O-N 3.26Å
104	D	81.1	Confident	80.7	Confident	128 Å²	128	119.6 Å²	119.6	68%	0.684	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.2	-3.1	178.9	-59.3	-20.8	0	0	0	114.4	H102 P106	H102-D104 IonicContact CE1-OD2 3.27Å; H102-D104 PolarHBondContact CE1-OD2 3.45Å; H102-D104 VanDerWaalsContact CE1-OD2 3.27Å; H102-D104 PolarHBondContact ND1-N 3.09Å; H102-D104 IonicContact ND1-OD2 3.88Å; H102-D104 PolarHBondContact O-N 3.26Å; H102-D104 VanDerWaalsContact O-N 3.15Å; D104-P106 VanDerWaalsContact O-CD 3.3Å; D104-P106 WeakPolarHBondContact O-CD 3.3Å
105	F	76.9	Confident	80.2	Confident	76 Å²	76	123.8 Å²	123.8	33%	0.333	65%	0.653	S	S	.	*			trans	-107	99.8	178.5	-71.8	-95.2	0	0	0	109.9	A42 P44 H102 V103 V107	A42-F105 HydrophobicContact CB-CE2 3.67Å; A42-F105 HydrophobicContact CB-CZ 3.89Å; A42-F105 WeakPolarHBondContact O-CZ 2.82Å; P44-F105 HydrophobicContact CB-CB 4.35Å; P44-F105 HydrophobicContact CB-CD1 4.39Å; P44-F105 HydrophobicContact CB-CG 4.25Å; H102-F105 HydrophobicContact CB-CD2 3.72Å; H102-F105 HydrophobicContact CB-CE2 4.3Å; H102-F105 AromaticContact CG-CD2 3.94Å; H102-F105 AromaticContact ND1-CD2 3.76Å; H102-F105 PolarHBondContact O-N 2.67Å; V103-F105 VanDerWaalsContact C-N 3.26Å; V103-F105 PolarHBondContact O-N 3.26Å; F105-V107 HydrophobicContact CB-CG2 4.15Å; F105-V107 PolarHBondContact O-N 3.16Å; F105-V107 VanDerWaalsContact O-N 3.09Å
106	P	76.9	Confident	79.6	Confident	132 Å²	132	120.6 Å²	120.6	86%	0.857	65%	0.646	S	S	*	*			trans	-66.6	109.4	169.6	27.5	-32.2	0	0	0	108.8	D104	D104-P106 VanDerWaalsContact O-CD 3.3Å; D104-P106 WeakPolarHBondContact O-CD 3.3Å
107	V	73.2	Confident	79.2	Confident	73 Å²	73	125.6 Å²	125.6	44%	0.442	67%	0.673	S	S	.	*			trans	-119.4	133.6	179.6	-178.5	0	0	0	0	109.1	I101 F105 L109	I101-V107 HydrophobicContact CD1-CB 4.31Å; I101-V107 HydrophobicContact CD1-CG1 4.46Å; I101-V107 HydrophobicContact CG2-CB 4.43Å; I101-V107 HydrophobicContact CG2-CG2 3.98Å; F105-V107 HydrophobicContact CB-CG2 4.15Å; F105-V107 PolarHBondContact O-N 3.16Å; F105-V107 VanDerWaalsContact O-N 3.09Å; V107-L109 HydrophobicContact CG1-CD2 4.22Å
108	I	72.9	Confident	78.6	Confident	154 Å²	154	123.4 Å²	123.4	79%	0.79	66%	0.661	S	S	*	*			trans	-101	122.3	170.6	-57.7	173.9	0	0	0	107.3
109	L	77.4	Confident	78	Confident	141 Å²	141	121.5 Å²	121.5	74%	0.738	66%	0.659	S	S	*	*			trans	-93.7	119.4	175	-62.2	173	0	0	0	108.2	I101 V107	I101-L109 HydrophobicContact CD1-CD1 4.36Å; I101-L109 HydrophobicContact CD1-CD2 4.46Å; V107-L109 HydrophobicContact CG1-CD2 4.22Å
110	C	69.9	Low	77.4	Confident	113 Å²	113	126.2 Å²	126.2	76%	0.764	68%	0.679	S	S	*	*			trans	-106.2	130.2	173	-60.3	0	0	0	0	109
111	E	81.4	Confident	76.7	Confident	195 Å²	195	123.8 Å²	123.8	91%	0.911	69%	0.687	S	S	*	*			trans	-82.5	145.3	165	-170.4	172.8	-175.5	0	0	108.6
112	V	61.6	Low	75.9	Confident	209 Å²	209	128.5 Å²	128.5	100%	1.267	72%	0.716	S	S	*	*			trans	-98	0	-179.7	179.8	0	0	0	0	109.9

Retrieved 112 of 112 residues in 325.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).