A0A060XRZ9_ONCMY Loading...

Single-pass membrane and coiled-coil domain-containing protein 4

AlphaFold DB , UniProt , Accession A0A060XRZ9, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene SMCO4, Length 59 aa.

						>A0A060XRZ9_ONCMY|A0A060XRZ9|SMCO4
MRQLKGKPKKETSRDKKERKAAMQEARSQVATVVLPTLAVVVLLIVVFVYVATMPRALE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.5	Very low	48.8	Very low	243 Å²	243	175.5 Å²	175.5	100%	1.197	84%	0.841	S	S	*	*				0	131.7	0	-61.1	-176.9	-172.5	0	0	106.8
2	R	54.3	Low	49.6	Very low	219 Å²	219	166.7 Å²	166.7	83%	0.826	81%	0.807	S	S	*	*			cis	-159.9	106.6	13	-164.3	162.8	149.5	-177.9	-7.6	104.7	L4	R2-L4 PolarHBondContact O-N 2.81Å; R2-L4 VanDerWaalsContact O-N 3.1Å
3	Q	58	Low	49.8	Very low	189 Å²	189	160.7 Å²	160.7	88%	0.883	79%	0.793	S	S	*	*			trans	-48.6	121.6	164.2	-73.4	-97.8	45.4	0	0	106.2	K5	Q3-K5 PolarHBondContact O-N 2.88Å
4	L	52.6	Low	50	Low	163 Å²	163	162.7 Å²	162.7	85%	0.853	79%	0.787	S	S	*	*			trans	-52.9	108.2	-177.5	-83.3	151.9	0	0	0	108.6	R2 G6	R2-L4 PolarHBondContact O-N 2.81Å; R2-L4 VanDerWaalsContact O-N 3.1Å; L4-G6 PolarHBondContact O-N 3.1Å
5	K	52.2	Low	50.2	Low	208 Å²	208	157.7 Å²	157.7	90%	0.904	77%	0.766	S	S	*	*	S	Bend	trans	-70.3	76.3	173.8	-170.7	172	-179.7	179.2	0	106.8	Q3	Q3-K5 PolarHBondContact O-N 2.88Å
6	G	47.8	Very low	50.4	Low	56 Å²	56	158.8 Å²	158.8	58%	0.577	77%	0.765	S	S	*	*			trans	-178.1	25.4	-169.5	0	0	0	0	0	112.8	L4 P8	L4-G6 PolarHBondContact O-N 3.1Å; G6-P8 WeakPolarHBondContact O-CD 3.08Å
7	K	45.3	Very low	50.7	Low	191 Å²	191	158.9 Å²	158.9	83%	0.83	76%	0.762	S	S	*	*			trans	-51.9	114.7	147.4	-68.3	-176.2	-179.3	-172.4	0	104	K9	K7-K9 PolarHBondContact O-N 2.75Å
8	P	48.9	Very low	50.9	Low	116 Å²	116	157.2 Å²	157.2	75%	0.753	75%	0.753	S	S	*	*			trans	-55.3	108.7	164.3	23.2	-29.4	0	0	0	103.6	G6 K10	G6-P8 WeakPolarHBondContact O-CD 3.08Å; P8-K10 VanDerWaalsContact C-N 3.33Å; P8-K10 PolarHBondContact O-N 2.62Å
9	K	44.6	Very low	51.2	Low	187 Å²	187	159.6 Å²	159.6	81%	0.813	75%	0.753	S	S	*	*			trans	-35.6	104.2	174.4	172.9	179.7	179.8	-176.6	0	105.1	K7 E11	K7-K9 PolarHBondContact O-N 2.75Å; K9-E11 WeakPolarHBondContact O-CA 3.32Å; K9-E11 PolarHBondContact O-N 2.79Å
10	K	43.9	Very low	51.5	Low	174 Å²	174	159.8 Å²	159.8	76%	0.757	75%	0.751	S	S	*	*			trans	-32.2	90.9	-176	-174.2	170.4	-175.3	175.1	0	107.3	P8 T12	P8-K10 VanDerWaalsContact C-N 3.33Å; P8-K10 PolarHBondContact O-N 2.62Å; K10-T12 VanDerWaalsContact O-CA 3.26Å; K10-T12 WeakPolarHBondContact O-CA 3.47Å; K10-T12 PolarHBondContact O-N 3.34Å
11	E	43.9	Very low	51.8	Low	184 Å²	184	154.5 Å²	154.5	86%	0.86	74%	0.735	S	S	*	*			trans	-64.7	118.1	-174	-98.3	-167.3	95.8	0	0	103.3	K9 S13	K9-E11 WeakPolarHBondContact O-CA 3.32Å; K9-E11 PolarHBondContact O-N 2.79Å; E11-S13 PolarHBondContact O-N 2.88Å; E11-S13 VanDerWaalsContact O-N 3.07Å
12	T	58.4	Low	52.3	Low	70 Å²	70	145.8 Å²	145.8	43%	0.429	70%	0.701	S	S	.	*			trans	-61.7	119.5	-142	-12.5	0	0	0	0	106.6	K10 R14 D15 K16	K10-T12 VanDerWaalsContact O-CA 3.26Å; K10-T12 WeakPolarHBondContact O-CA 3.47Å; K10-T12 PolarHBondContact O-N 3.34Å; T12-R14 HydrophobicContact CG2-CB 3.77Å; T12-R14 HydrophobicContact CG2-CG 4.2Å; T12-R14 CarbonylContact O-C 3.55Å; T12-R14 PolarHBondContact O-N 3.48Å; T12-D15 WeakPolarHBondContact O-CB 3.26Å; T12-D15 PolarHBondContact O-N 2.78Å; T12-K16 PolarHBondContact O-N 2.95Å
13	S	52.2	Low	52.5	Low	89 Å²	89	141.6 Å²	141.6	62%	0.622	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.5	-14.2	165.5	-45.9	0	0	0	0	111.3	E11	E11-S13 PolarHBondContact O-N 2.88Å; E11-S13 VanDerWaalsContact O-N 3.07Å
14	R	52.9	Low	52.5	Low	189 Å²	189	139.2 Å²	139.2	71%	0.713	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.5	-44.3	166.3	-63.8	-175.7	163.6	-178.8	-6.4	114.2	T12 K16 K17 E18	T12-R14 HydrophobicContact CG2-CB 3.77Å; T12-R14 HydrophobicContact CG2-CG 4.2Å; T12-R14 CarbonylContact O-C 3.55Å; T12-R14 PolarHBondContact O-N 3.48Å; R14-K16 PolarHBondContact O-N 3.45Å; R14-K17 CarbonylContact O-C 3.55Å; R14-K17 WeakPolarHBondContact O-CA 3.36Å; R14-K17 VanDerWaalsContact O-CB 3.24Å; R14-K17 WeakPolarHBondContact O-CB 3.45Å; R14-K17 PolarHBondContact O-N 3.41Å; R14-E18 WeakPolarHBondContact O-CG 3.24Å; R14-E18 PolarHBondContact O-N 3.27Å
15	D	52.3	Low	52.8	Low	87 Å²	87	137.7 Å²	137.7	47%	0.465	67%	0.67	S	S	.	*	H	α-helix	trans	-66.9	-40.1	-178.1	-166.6	-83.7	0	0	0	111.7	T12 K17 E18 R19	T12-D15 WeakPolarHBondContact O-CB 3.26Å; T12-D15 PolarHBondContact O-N 2.78Å; D15-K17 PolarHBondContact O-N 3.07Å; D15-E18 PolarHBondContact O-N 3.04Å; D15-R19 PolarHBondContact O-N 3.32Å
16	K	53.6	Low	53.1	Low	175 Å²	175	130.3 Å²	130.3	76%	0.761	65%	0.647	S	S	*	*	H	α-helix	trans	-61.5	-28.5	169.2	-104.2	-175.8	-179.7	-177.6	0	113.3	T12 R14	T12-K16 PolarHBondContact O-N 2.95Å; R14-K16 PolarHBondContact O-N 3.45Å
17	K	56.4	Low	53.7	Low	162 Å²	162	136.4 Å²	136.4	70%	0.704	65%	0.653	S	S	*	*	H	α-helix	trans	-80.5	-41.4	178.3	-125.6	-176.7	179.5	-168.3	0	110.8	R14 D15 K20 A21	R14-K17 CarbonylContact O-C 3.55Å; R14-K17 WeakPolarHBondContact O-CA 3.36Å; R14-K17 VanDerWaalsContact O-CB 3.24Å; R14-K17 WeakPolarHBondContact O-CB 3.45Å; R14-K17 PolarHBondContact O-N 3.41Å; D15-K17 PolarHBondContact O-N 3.07Å; K17-K20 PolarHBondContact O-N 3.27Å; K17-A21 WeakPolarHBondContact O-CB 3.36Å; K17-A21 PolarHBondContact O-N 3.45Å
18	E	54.4	Low	54.4	Low	128 Å²	128	130.8 Å²	130.8	60%	0.598	64%	0.638	S	S	*	*	H	α-helix	trans	-64.9	-40.5	178.6	-73.5	174.5	88.3	0	0	111.9	R14 D15 K20 A21 A22	R14-E18 WeakPolarHBondContact O-CG 3.24Å; R14-E18 PolarHBondContact O-N 3.27Å; D15-E18 PolarHBondContact O-N 3.04Å; E18-K20 PolarHBondContact O-N 2.94Å; E18-A21 PolarHBondContact O-N 3.32Å; E18-A22 WeakPolarHBondContact O-CB 3.49Å; E18-A22 PolarHBondContact O-N 2.9Å
19	R	56.2	Low	54.9	Low	203 Å²	203	131.8 Å²	131.8	77%	0.766	63%	0.632	S	S	*	*	H	α-helix	trans	-63.1	-36.6	173.5	-90.5	-176	161.3	-128.8	-1.8	113.9	D15 M23	D15-R19 PolarHBondContact O-N 3.32Å; R19-M23 PolarHBondContact O-N 2.86Å
20	K	56.8	Low	55.8	Low	163 Å²	163	127.3 Å²	127.3	71%	0.709	62%	0.621	S	S	*	*	H	α-helix	trans	-74.3	-37.9	175.9	-79.9	-170.1	174.7	-168.8	0	112.1	K17 E18 Q24	K17-K20 PolarHBondContact O-N 3.27Å; E18-K20 PolarHBondContact O-N 2.94Å; K20-Q24 PolarHBondContact O-N 3Å
21	A	57.5	Low	56.8	Low	49 Å²	49	121.2 Å²	121.2	41%	0.405	60%	0.603	S	S	.	*	H	α-helix	trans	-65.8	-46.5	178.1	0	0	0	0	0	111.5	K17 E18 M23 Q24 E25	K17-A21 WeakPolarHBondContact O-CB 3.36Å; K17-A21 PolarHBondContact O-N 3.45Å; E18-A21 PolarHBondContact O-N 3.32Å; A21-M23 VanDerWaalsContact C-N 3.27Å; A21-M23 PolarHBondContact O-N 3Å; A21-Q24 PolarHBondContact O-N 3.33Å; A21-Q24 VanDerWaalsContact O-N 3.08Å; A21-E25 WeakPolarHBondContact O-CB 3.25Å; A21-E25 PolarHBondContact O-N 3.21Å
22	A	57.2	Low	58.2	Low	59 Å²	59	117.2 Å²	117.2	49%	0.488	59%	0.591	S	S	.	*	H	α-helix	trans	-61.6	-34.7	178.5	0	0	0	0	0	112.8	E18 A26	E18-A22 WeakPolarHBondContact O-CB 3.49Å; E18-A22 PolarHBondContact O-N 2.9Å; A22-A26 WeakPolarHBondContact O-CB 3.39Å; A22-A26 PolarHBondContact O-N 3.2Å
23	M	56.8	Low	59.3	Low	131 Å²	131	118 Å²	118	65%	0.645	60%	0.596	S	S	*	*	H	α-helix	trans	-73.6	-29.5	177	-155.9	173.6	-143.4	0	0	112.6	R19 A21 R27	R19-M23 PolarHBondContact O-N 2.86Å; A21-M23 VanDerWaalsContact C-N 3.27Å; A21-M23 PolarHBondContact O-N 3Å; M23-R27 WeakPolarHBondContact O-CG 3.48Å; M23-R27 PolarHBondContact O-N 3.22Å
24	Q	58	Low	60.9	Low	140 Å²	140	117.1 Å²	117.1	65%	0.654	59%	0.586	S	S	*	*	H	α-helix	trans	-75.3	-39.7	172	-75.6	-171.9	-13.7	0	0	111.6	K20 A21 R27 S28	K20-Q24 PolarHBondContact O-N 3Å; A21-Q24 PolarHBondContact O-N 3.33Å; A21-Q24 VanDerWaalsContact O-N 3.08Å; Q24-R27 PolarHBondContact O-N 3.35Å; Q24-S28 PolarHBondContact O-N 2.87Å; Q24-S28 PolarHBondContact O-OG 2.59Å
25	E	59.2	Low	62.3	Low	130 Å²	130	114.1 Å²	114.1	61%	0.607	58%	0.583	S	S	*	*	H	α-helix	trans	-64.4	-42.7	178.2	-162.6	172.5	166.3	0	0	111.4	A21 R27 S28 Q29	A21-E25 WeakPolarHBondContact O-CB 3.25Å; A21-E25 PolarHBondContact O-N 3.21Å; E25-R27 VanDerWaalsContact C-N 3.34Å; E25-R27 PolarHBondContact O-N 2.85Å; E25-S28 PolarHBondContact O-N 3.08Å; E25-Q29 WeakPolarHBondContact O-CB 3.16Å; E25-Q29 PolarHBondContact O-N 2.84Å
26	A	59.3	Low	64.1	Low	53 Å²	53	113.1 Å²	113.1	44%	0.438	58%	0.582	S	S	.	*	H	α-helix	trans	-61.1	-40.4	172.7	0	0	0	0	0	112.5	A22 Q29 V30	A22-A26 WeakPolarHBondContact O-CB 3.39Å; A22-A26 PolarHBondContact O-N 3.2Å; A26-Q29 PolarHBondContact O-N 3.29Å; A26-V30 WeakPolarHBondContact O-CB 3.45Å; A26-V30 VanDerWaalsContact O-CG2 3.25Å; A26-V30 WeakPolarHBondContact O-CG2 3.33Å; A26-V30 PolarHBondContact O-N 2.91Å
27	R	60	Low	66	Low	185 Å²	185	108.3 Å²	108.3	70%	0.698	57%	0.567	S	S	*	*	H	α-helix	trans	-67	-40.2	175.7	-76.7	178.2	-179.3	-137.9	0.3	112.3	M23 Q24 E25 A31	M23-R27 WeakPolarHBondContact O-CG 3.48Å; M23-R27 PolarHBondContact O-N 3.22Å; Q24-R27 PolarHBondContact O-N 3.35Å; E25-R27 VanDerWaalsContact C-N 3.34Å; E25-R27 PolarHBondContact O-N 2.85Å; R27-A31 VanDerWaalsContact O-CB 3.28Å; R27-A31 WeakPolarHBondContact O-CB 3.37Å; R27-A31 PolarHBondContact O-N 3.18Å
28	S	59.6	Low	67.8	Low	72 Å²	72	105.5 Å²	105.5	50%	0.503	56%	0.56	S	S	.	*	H	α-helix	trans	-64.5	-42.9	175.5	-66.2	0	0	0	0	111	Q24 E25 A31 T32	Q24-S28 PolarHBondContact O-N 2.87Å; Q24-S28 PolarHBondContact O-OG 2.59Å; E25-S28 PolarHBondContact O-N 3.08Å; S28-A31 PolarHBondContact O-N 3.13Å; S28-T32 WeakPolarHBondContact O-CB 3.35Å; S28-T32 PolarHBondContact O-N 3.27Å; S28-T32 PolarHBondContact O-OG1 2.87Å
29	Q	60.5	Low	69.7	Low	137 Å²	137	102.3 Å²	102.3	64%	0.64	56%	0.555	S	S	*	*	H	α-helix	trans	-65.8	-43.8	179.8	-150.4	174.7	68.7	0	0	111.5	E25 A26 T32 V33	E25-Q29 WeakPolarHBondContact O-CB 3.16Å; E25-Q29 PolarHBondContact O-N 2.84Å; A26-Q29 PolarHBondContact O-N 3.29Å; Q29-T32 PolarHBondContact O-N 3.31Å; Q29-V33 WeakPolarHBondContact O-CG2 3.36Å; Q29-V33 PolarHBondContact O-N 3.26Å; Q29-V33 VanDerWaalsContact O-N 3.13Å
30	V	62.2	Low	71.6	Confident	94 Å²	94	96.7 Å²	96.7	57%	0.57	54%	0.543	S	S	*	.	H	α-helix	trans	-61.5	-46.2	173	173.4	0	0	0	0	111	A26 T32 V33 V34	A26-V30 WeakPolarHBondContact O-CB 3.45Å; A26-V30 VanDerWaalsContact O-CG2 3.25Å; A26-V30 WeakPolarHBondContact O-CG2 3.33Å; A26-V30 PolarHBondContact O-N 2.91Å; V30-T32 VanDerWaalsContact C-N 3.28Å; V30-T32 PolarHBondContact O-N 3.43Å; V30-V33 PolarHBondContact O-N 2.9Å; V30-V34 HydrophobicContact CG1-CG2 3.92Å; V30-V34 WeakPolarHBondContact O-CB 3.42Å; V30-V34 WeakPolarHBondContact O-CG2 3.37Å; V30-V34 PolarHBondContact O-N 2.86Å
31	A	66.2	Low	73.5	Confident	46 Å²	46	92.2 Å²	92.2	38%	0.38	53%	0.529	S	S	.	.	H	α-helix	trans	-61.2	-37.8	177.2	0	0	0	0	0	112.4	R27 S28 V33 V34 L35	R27-A31 VanDerWaalsContact O-CB 3.28Å; R27-A31 WeakPolarHBondContact O-CB 3.37Å; R27-A31 PolarHBondContact O-N 3.18Å; S28-A31 PolarHBondContact O-N 3.13Å; A31-V33 VanDerWaalsContact C-N 3.3Å; A31-V33 PolarHBondContact O-N 3.41Å; A31-V34 PolarHBondContact O-N 2.89Å; A31-L35 WeakPolarHBondContact O-CB 3.28Å; A31-L35 WeakPolarHBondContact O-CG 3.31Å; A31-L35 PolarHBondContact O-N 2.94Å
32	T	73.5	Confident	75.3	Confident	99 Å²	99	94.1 Å²	94.1	61%	0.607	54%	0.536	S	S	*	.	H	α-helix	trans	-69.5	-25.8	180	-47.3	0	0	0	0	112.4	S28 Q29 V30 P36	S28-T32 WeakPolarHBondContact O-CB 3.35Å; S28-T32 PolarHBondContact O-N 3.27Å; S28-T32 PolarHBondContact O-OG1 2.87Å; Q29-T32 PolarHBondContact O-N 3.31Å; V30-T32 VanDerWaalsContact C-N 3.28Å; V30-T32 PolarHBondContact O-N 3.43Å; T32-P36 WeakPolarHBondContact O-CD 3.01Å; T32-P36 WeakPolarHBondContact O-CG 2.86Å
33	V	80.8	Confident	77.2	Confident	88 Å²	88	96.7 Å²	96.7	53%	0.533	54%	0.54	S	S	.	.	H	α-helix	trans	-89.7	-38.3	174.3	177.9	0	0	0	0	111.5	Q29 V30 A31 P36 T37	Q29-V33 WeakPolarHBondContact O-CG2 3.36Å; Q29-V33 PolarHBondContact O-N 3.26Å; Q29-V33 VanDerWaalsContact O-N 3.13Å; V30-V33 PolarHBondContact O-N 2.9Å; A31-V33 VanDerWaalsContact C-N 3.3Å; A31-V33 PolarHBondContact O-N 3.41Å; V33-P36 VanDerWaalsContact O-CD 3.29Å; V33-P36 WeakPolarHBondContact O-CD 3.37Å; V33-P36 VanDerWaalsContact O-CG 3.31Å; V33-P36 WeakPolarHBondContact O-CG 3.31Å; V33-T37 WeakPolarHBondContact O-CB 3.49Å; V33-T37 PolarHBondContact O-N 3.28Å; V33-T37 VanDerWaalsContact O-N 3.15Å; V33-T37 PolarHBondContact O-OG1 3.47Å
34	V	85	Confident	79.1	Confident	70 Å²	70	95.5 Å²	95.5	42%	0.424	54%	0.536	S	S	.	.	H	α-helix	trans	-68.7	-41.6	-177.7	172.8	0	0	0	0	111.4	V30 A31 T37 L38	V30-V34 HydrophobicContact CG1-CG2 3.92Å; V30-V34 WeakPolarHBondContact O-CB 3.42Å; V30-V34 WeakPolarHBondContact O-CG2 3.37Å; V30-V34 PolarHBondContact O-N 2.86Å; A31-V34 PolarHBondContact O-N 2.89Å; V34-T37 PolarHBondContact O-N 3.45Å; V34-L38 HydrophobicContact CG1-CD1 3.87Å; V34-L38 HydrophobicContact CG1-CG 4.19Å; V34-L38 WeakPolarHBondContact O-CB 3.29Å; V34-L38 WeakPolarHBondContact O-CG 3.49Å; V34-L38 PolarHBondContact O-N 3.42Å
35	L	83.7	Confident	80.9	Confident	125 Å²	125	93.4 Å²	93.4	65%	0.654	53%	0.529	S	S	*	.	H	α-helix	trans	-56.2	-54.3	177	-86.6	163.5	0	0	0	113.9	A31 T37 L38 A39	A31-L35 WeakPolarHBondContact O-CB 3.28Å; A31-L35 WeakPolarHBondContact O-CG 3.31Å; A31-L35 PolarHBondContact O-N 2.94Å; L35-T37 VanDerWaalsContact C-N 3.32Å; L35-T37 PolarHBondContact O-N 2.67Å; L35-L38 PolarHBondContact O-N 3Å; L35-A39 PolarHBondContact O-N 2.99Å; L35-A39 VanDerWaalsContact O-N 3.07Å
36	P	89.9	Confident	82.6	Confident	67 Å²	67	91.6 Å²	91.6	44%	0.435	53%	0.526	S	S	.	.	H	α-helix	trans	-67.3	-33.7	177.8	25.1	-33.1	0	0	0	111.9	T32 V33 A39 V40	T32-P36 WeakPolarHBondContact O-CD 3.01Å; T32-P36 WeakPolarHBondContact O-CG 2.86Å; V33-P36 VanDerWaalsContact O-CD 3.29Å; V33-P36 WeakPolarHBondContact O-CD 3.37Å; V33-P36 VanDerWaalsContact O-CG 3.31Å; V33-P36 WeakPolarHBondContact O-CG 3.31Å; P36-A39 PolarHBondContact O-N 3.47Å; P36-V40 VanDerWaalsContact O-CG2 3.32Å; P36-V40 WeakPolarHBondContact O-CG2 3.32Å; P36-V40 PolarHBondContact O-N 3.47Å
37	T	92.8	Very high	84.2	Confident	74 Å²	74	92.6 Å²	92.6	45%	0.454	53%	0.527	S	S	.	.	H	α-helix	trans	-63.1	-45.6	176.3	-55	0	0	0	0	111.2	V33 V34 L35 A39 V40 V41	V33-T37 WeakPolarHBondContact O-CB 3.49Å; V33-T37 PolarHBondContact O-N 3.28Å; V33-T37 VanDerWaalsContact O-N 3.15Å; V33-T37 PolarHBondContact O-OG1 3.47Å; V34-T37 PolarHBondContact O-N 3.45Å; L35-T37 VanDerWaalsContact C-N 3.32Å; L35-T37 PolarHBondContact O-N 2.67Å; T37-A39 VanDerWaalsContact C-N 3.33Å; T37-A39 PolarHBondContact O-N 3.15Å; T37-V40 PolarHBondContact O-N 3.47Å; T37-V41 VanDerWaalsContact O-CG2 3.31Å; T37-V41 WeakPolarHBondContact O-CG2 3.3Å; T37-V41 PolarHBondContact O-N 3.31Å
38	L	93.3	Very high	85.7	Confident	103 Å²	103	91 Å²	91	54%	0.539	53%	0.525	S	S	.	.	H	α-helix	trans	-61.7	-41.1	175.2	-73.4	174.6	0	0	0	111.7	V34 L35 V40 V41 V42	V34-L38 HydrophobicContact CG1-CD1 3.87Å; V34-L38 HydrophobicContact CG1-CG 4.19Å; V34-L38 WeakPolarHBondContact O-CB 3.29Å; V34-L38 WeakPolarHBondContact O-CG 3.49Å; V34-L38 PolarHBondContact O-N 3.42Å; L35-L38 PolarHBondContact O-N 3Å; L38-V40 PolarHBondContact O-N 3.33Å; L38-V41 PolarHBondContact O-N 3.48Å; L38-V42 VanDerWaalsContact O-CG2 3.31Å; L38-V42 WeakPolarHBondContact O-CG2 3.36Å; L38-V42 PolarHBondContact O-N 3.48Å
39	A	94.4	Very high	87.3	Confident	61 Å²	61	91 Å²	91	50%	0.504	52%	0.522	S	S	.	.	H	α-helix	trans	-60.8	-43.9	176.1	0	0	0	0	0	112.1	L35 P36 T37 V42 L43	L35-A39 PolarHBondContact O-N 2.99Å; L35-A39 VanDerWaalsContact O-N 3.07Å; P36-A39 PolarHBondContact O-N 3.47Å; T37-A39 VanDerWaalsContact C-N 3.33Å; T37-A39 PolarHBondContact O-N 3.15Å; A39-V42 PolarHBondContact O-N 3.22Å; A39-L43 WeakPolarHBondContact O-CB 3.34Å; A39-L43 PolarHBondContact O-N 3.33Å
40	V	96.6	Very high	88.7	Confident	85 Å²	85	91.2 Å²	91.2	52%	0.515	52%	0.518	S	S	.	.	H	α-helix	trans	-63.9	-44.8	176.2	172.7	0	0	0	0	111.1	P36 T37 L38 V42 L43 L44	P36-V40 VanDerWaalsContact O-CG2 3.32Å; P36-V40 WeakPolarHBondContact O-CG2 3.32Å; P36-V40 PolarHBondContact O-N 3.47Å; T37-V40 PolarHBondContact O-N 3.47Å; L38-V40 PolarHBondContact O-N 3.33Å; V40-V42 PolarHBondContact O-N 3.24Å; V40-L43 PolarHBondContact O-N 3.47Å; V40-L44 HydrophobicContact CG1-CD1 4.03Å; V40-L44 HydrophobicContact CG1-CG 4.31Å; V40-L44 VanDerWaalsContact O-CG 3.32Å; V40-L44 WeakPolarHBondContact O-CG 3.31Å; V40-L44 PolarHBondContact O-N 2.87Å
41	V	96.8	Very high	89.8	Confident	69 Å²	69	90.1 Å²	90.1	42%	0.418	51%	0.511	S	S	.	.	H	α-helix	trans	-60.6	-45.9	178.5	170.7	0	0	0	0	111.2	T37 L38 L43 L44 I45	T37-V41 VanDerWaalsContact O-CG2 3.31Å; T37-V41 WeakPolarHBondContact O-CG2 3.3Å; T37-V41 PolarHBondContact O-N 3.31Å; L38-V41 PolarHBondContact O-N 3.48Å; V41-L43 VanDerWaalsContact C-N 3.34Å; V41-L43 PolarHBondContact O-N 2.94Å; V41-L44 PolarHBondContact O-N 2.98Å; V41-I45 HydrophobicContact CG1-CD1 3.95Å; V41-I45 VanDerWaalsContact O-CG1 3.3Å; V41-I45 WeakPolarHBondContact O-CG1 3.32Å; V41-I45 PolarHBondContact O-N 2.95Å
42	V	96.6	Very high	90.6	Very high	89 Å²	89	91 Å²	91	54%	0.539	52%	0.518	S	S	.	.	H	α-helix	trans	-61.8	-43.7	176.9	172.5	0	0	0	0	110.9	L38 A39 V40 L44 I45 V46	L38-V42 VanDerWaalsContact O-CG2 3.31Å; L38-V42 WeakPolarHBondContact O-CG2 3.36Å; L38-V42 PolarHBondContact O-N 3.48Å; A39-V42 PolarHBondContact O-N 3.22Å; V40-V42 PolarHBondContact O-N 3.24Å; V42-L44 PolarHBondContact O-N 3.07Å; V42-I45 PolarHBondContact O-N 2.83Å; V42-V46 HydrophobicContact CG1-CG2 4.49Å; V42-V46 WeakPolarHBondContact O-CG2 3.18Å; V42-V46 PolarHBondContact O-N 3.42Å
43	L	96.6	Very high	90.9	Very high	112 Å²	112	90.9 Å²	90.9	59%	0.586	52%	0.517	S	S	*	.	H	α-helix	trans	-62.4	-42.6	178.2	-169.2	145.6	0	0	0	111.7	A39 V40 V41 I45 V46 V47	A39-L43 WeakPolarHBondContact O-CB 3.34Å; A39-L43 PolarHBondContact O-N 3.33Å; V40-L43 PolarHBondContact O-N 3.47Å; V41-L43 VanDerWaalsContact C-N 3.34Å; V41-L43 PolarHBondContact O-N 2.94Å; L43-I45 VanDerWaalsContact C-N 3.34Å; L43-I45 PolarHBondContact O-N 3.36Å; L43-V46 PolarHBondContact O-N 3.29Å; L43-V47 HydrophobicContact CD2-CG2 4.08Å; L43-V47 VanDerWaalsContact O-CG2 3.31Å; L43-V47 WeakPolarHBondContact O-CG2 3.24Å; L43-V47 PolarHBondContact O-N 3.26Å
44	L	96.4	Very high	90.5	Very high	106 Å²	106	90.8 Å²	90.8	56%	0.555	51%	0.512	S	S	*	.	H	α-helix	trans	-61.3	-41.1	174.7	-72.4	174.2	0	0	0	112	V40 V41 V42 V47 F48	V40-L44 HydrophobicContact CG1-CD1 4.03Å; V40-L44 HydrophobicContact CG1-CG 4.31Å; V40-L44 VanDerWaalsContact O-CG 3.32Å; V40-L44 WeakPolarHBondContact O-CG 3.31Å; V40-L44 PolarHBondContact O-N 2.87Å; V41-L44 PolarHBondContact O-N 2.98Å; V42-L44 PolarHBondContact O-N 3.07Å; L44-V47 PolarHBondContact O-N 3.5Å; L44-F48 VanDerWaalsContact O-CB 3.24Å; L44-F48 WeakPolarHBondContact O-CB 3.28Å; L44-F48 PolarHBondContact O-N 2.84Å
45	I	95.2	Very high	89.6	Confident	97 Å²	97	93.5 Å²	93.5	50%	0.497	53%	0.531	S	S	.	.	H	α-helix	trans	-63.7	-45.5	176	-67.2	164.4	0	0	0	110.5	V41 V42 L43 V47 F48 V49	V41-I45 HydrophobicContact CG1-CD1 3.95Å; V41-I45 VanDerWaalsContact O-CG1 3.3Å; V41-I45 WeakPolarHBondContact O-CG1 3.32Å; V41-I45 PolarHBondContact O-N 2.95Å; V42-I45 PolarHBondContact O-N 2.83Å; L43-I45 VanDerWaalsContact C-N 3.34Å; L43-I45 PolarHBondContact O-N 3.36Å; I45-V47 PolarHBondContact O-N 2.86Å; I45-F48 PolarHBondContact O-N 3.46Å; I45-V49 HydrophobicContact CG2-CG2 4.26Å; I45-V49 WeakPolarHBondContact O-CB 3.3Å; I45-V49 VanDerWaalsContact O-CG2 3.3Å; I45-V49 WeakPolarHBondContact O-CG2 3.45Å; I45-V49 PolarHBondContact O-N 3.29Å
46	V	94.6	Very high	88.5	Confident	92 Å²	92	97.3 Å²	97.3	56%	0.558	54%	0.537	S	S	*	.	H	α-helix	trans	-60.9	-45.6	178.3	171.1	0	0	0	0	111	V42 L43 V49 Y50	V42-V46 HydrophobicContact CG1-CG2 4.49Å; V42-V46 WeakPolarHBondContact O-CG2 3.18Å; V42-V46 PolarHBondContact O-N 3.42Å; L43-V46 PolarHBondContact O-N 3.29Å; V46-V49 PolarHBondContact O-N 2.83Å; V46-Y50 VanDerWaalsContact O-CB 3.28Å; V46-Y50 WeakPolarHBondContact O-CB 3.45Å; V46-Y50 PolarHBondContact O-N 3.27Å
47	V	93.6	Very high	87.1	Confident	74 Å²	74	96.6 Å²	96.6	45%	0.448	54%	0.537	S	S	.	.	H	α-helix	trans	-62.1	-45.8	176.1	171.7	0	0	0	0	110.7	L43 L44 I45 V49 Y50 V51	L43-V47 HydrophobicContact CD2-CG2 4.08Å; L43-V47 VanDerWaalsContact O-CG2 3.31Å; L43-V47 WeakPolarHBondContact O-CG2 3.24Å; L43-V47 PolarHBondContact O-N 3.26Å; L44-V47 PolarHBondContact O-N 3.5Å; I45-V47 PolarHBondContact O-N 2.86Å; V47-V49 PolarHBondContact O-N 3.46Å; V47-Y50 PolarHBondContact O-N 3.47Å; V47-V51 HydrophobicContact CG1-CG2 4.31Å; V47-V51 WeakPolarHBondContact O-CB 3.38Å; V47-V51 VanDerWaalsContact O-CG2 3.29Å; V47-V51 WeakPolarHBondContact O-CG2 3.4Å; V47-V51 PolarHBondContact O-N 2.92Å
48	F	92	Very high	85.4	Confident	150 Å²	150	101 Å²	101	66%	0.658	56%	0.557	S	S	*	*	H	α-helix	trans	-59.9	-48.2	178.3	178	-95.3	0	0	0	111.7	L44 I45 Y50 V51 A52	L44-F48 VanDerWaalsContact O-CB 3.24Å; L44-F48 WeakPolarHBondContact O-CB 3.28Å; L44-F48 PolarHBondContact O-N 2.84Å; I45-F48 PolarHBondContact O-N 3.46Å; F48-Y50 VanDerWaalsContact C-N 3.35Å; F48-V51 PolarHBondContact O-N 3.47Å; F48-A52 HydrophobicContact CE1-CB 4.43Å; F48-A52 WeakPolarHBondContact O-CB 3.31Å; F48-A52 PolarHBondContact O-N 3.29Å
49	V	92.1	Very high	83.6	Confident	73 Å²	73	107.7 Å²	107.7	44%	0.442	59%	0.585	S	S	.	*	H	α-helix	trans	-61.9	-45.3	176.5	172	0	0	0	0	109.9	I45 V46 V47 V51 A52 T53	I45-V49 HydrophobicContact CG2-CG2 4.26Å; I45-V49 WeakPolarHBondContact O-CB 3.3Å; I45-V49 VanDerWaalsContact O-CG2 3.3Å; I45-V49 WeakPolarHBondContact O-CG2 3.45Å; I45-V49 PolarHBondContact O-N 3.29Å; V46-V49 PolarHBondContact O-N 2.83Å; V47-V49 PolarHBondContact O-N 3.46Å; V49-V51 PolarHBondContact O-N 2.94Å; V49-A52 PolarHBondContact O-N 2.78Å; V49-T53 HydrophobicContact CG1-CG2 3.9Å; V49-T53 WeakPolarHBondContact O-CB 3.29Å; V49-T53 VanDerWaalsContact O-CG2 3.23Å; V49-T53 WeakPolarHBondContact O-CG2 3.16Å; V49-T53 PolarHBondContact O-N 3.33Å; V49-T53 PolarHBondContact O-OG1 2.86Å
50	Y	89.6	Confident	83	Confident	142 Å²	142	110.1 Å²	110.1	56%	0.557	59%	0.589	S	S	*	*	H	α-helix	trans	-59.8	-47.2	178.9	-177.9	-98	0	0	0	111.8	V46 V47 F48 T53 M54	V46-Y50 VanDerWaalsContact O-CB 3.28Å; V46-Y50 WeakPolarHBondContact O-CB 3.45Å; V46-Y50 PolarHBondContact O-N 3.27Å; V47-Y50 PolarHBondContact O-N 3.47Å; F48-Y50 VanDerWaalsContact C-N 3.35Å; Y50-T53 PolarHBondContact O-OG1 2.83Å; Y50-M54 HydrophobicContact CE1-CE 4.5Å; Y50-M54 HydrophobicContact CE1-SD 4Å; Y50-M54 WeakPolarHBondContact O-CB 3.23Å; Y50-M54 PolarHBondContact O-N 3.45Å
51	V	87.2	Confident	82.3	Confident	71 Å²	71	111.4 Å²	111.4	43%	0.43	59%	0.593	S	S	.	*	H	α-helix	trans	-63.5	-47.7	176.4	171.7	0	0	0	0	111.3	V47 F48 V49 T53 M54 A57	V47-V51 HydrophobicContact CG1-CG2 4.31Å; V47-V51 WeakPolarHBondContact O-CB 3.38Å; V47-V51 VanDerWaalsContact O-CG2 3.29Å; V47-V51 WeakPolarHBondContact O-CG2 3.4Å; V47-V51 PolarHBondContact O-N 2.92Å; F48-V51 PolarHBondContact O-N 3.47Å; V49-V51 PolarHBondContact O-N 2.94Å; V51-T53 VanDerWaalsContact C-N 3.34Å; V51-T53 PolarHBondContact O-N 3.42Å; V51-M54 PolarHBondContact O-N 3.46Å; V51-A57 HydrophobicContact CG1-CB 3.73Å; V51-A57 WeakPolarHBondContact O-CB 3.27Å
52	A	81.4	Confident	81.5	Confident	63 Å²	63	113.7 Å²	113.7	52%	0.521	60%	0.603	S	S	.	*	H	α-helix	trans	-69.7	-29.3	-178.1	0	0	0	0	0	113.5	F48 V49	F48-A52 HydrophobicContact CE1-CB 4.43Å; F48-A52 WeakPolarHBondContact O-CB 3.31Å; F48-A52 PolarHBondContact O-N 3.29Å; V49-A52 PolarHBondContact O-N 2.78Å
53	T	80	Confident	80.6	Confident	97 Å²	97	115.2 Å²	115.2	60%	0.595	61%	0.607	S	S	*	*	H	α-helix	trans	-90.4	-15.2	176.3	59	0	0	0	0	112.8	V49 Y50 V51 P55	V49-T53 HydrophobicContact CG1-CG2 3.9Å; V49-T53 WeakPolarHBondContact O-CB 3.29Å; V49-T53 VanDerWaalsContact O-CG2 3.23Å; V49-T53 WeakPolarHBondContact O-CG2 3.16Å; V49-T53 PolarHBondContact O-N 3.33Å; V49-T53 PolarHBondContact O-OG1 2.86Å; Y50-T53 PolarHBondContact O-OG1 2.83Å; V51-T53 VanDerWaalsContact C-N 3.34Å; V51-T53 PolarHBondContact O-N 3.42Å; T53-P55 VanDerWaalsContact O-CD 3.27Å; T53-P55 WeakPolarHBondContact O-CD 3.22Å
54	M	73.2	Confident	79.6	Confident	87 Å²	87	115.4 Å²	115.4	43%	0.429	61%	0.608	S	S	.	*	S	Bend	trans	-73.7	114.3	171.6	-165.3	172.3	-144.9	0	0	108.1	Y50 V51 R56 A57	Y50-M54 HydrophobicContact CE1-CE 4.5Å; Y50-M54 HydrophobicContact CE1-SD 4Å; Y50-M54 WeakPolarHBondContact O-CB 3.23Å; Y50-M54 PolarHBondContact O-N 3.45Å; V51-M54 PolarHBondContact O-N 3.46Å; M54-R56 PolarHBondContact O-N 3.4Å; M54-A57 PolarHBondContact O-N 2.59Å
55	P	64.9	Low	78.5	Confident	126 Å²	126	116 Å²	116	82%	0.818	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.7	11.1	-171.6	28.8	-36.3	0	0	0	114.4	T53	T53-P55 VanDerWaalsContact O-CD 3.27Å; T53-P55 WeakPolarHBondContact O-CD 3.22Å
56	R	61.6	Low	77.3	Confident	205 Å²	205	117.4 Å²	117.4	77%	0.774	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-129.9	-1.7	-175	-61.6	-141.8	-166.4	169.5	3.9	114.7	M54 L58	M54-R56 PolarHBondContact O-N 3.4Å; R56-L58 PolarHBondContact O-N 2.78Å
57	A	60.1	Low	76	Confident	52 Å²	52	119.3 Å²	119.3	43%	0.43	62%	0.624	S	S	.	*	T	Hydrogen-bonded Turn	trans	-85.6	4.3	-178.8	0	0	0	0	0	113.2	V51 M54	V51-A57 HydrophobicContact CG1-CB 3.73Å; V51-A57 WeakPolarHBondContact O-CB 3.27Å; M54-A57 PolarHBondContact O-N 2.59Å
58	L	58.1	Low	74.5	Confident	167 Å²	167	123.1 Å²	123.1	87%	0.874	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-136.5	45.2	-174.8	-133	140.7	0	0	0	110.7	R56	R56-L58 PolarHBondContact O-N 2.78Å
59	E	54.4	Low	73	Confident	244 Å²	244	120.6 Å²	120.6	100%	1.14	64%	0.637	S	S	*	*			trans	-115.8	0	157.9	-82.9	-169.6	109	0	0	109.8

Retrieved 59 of 59 residues in 189.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).