A0A060XS05_ONCMY Loading...

Small integral membrane protein 13

AlphaFold DB , UniProt , Accession A0A060XS05, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110496697, Length 88 aa.

						>A0A060XS05_ONCMY|A0A060XS05|LOC110496697
MWQSVGLTVLVIVATLVCALLFMVFGWYVVWQLFLSKFKFLREMLGDTGSPQAETQPSESRSERTSPPPPRQRPKTARQRAVPPNSTT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.5	Low	87.9	Confident	209 Å²	209	117.5 Å²	117.5	100%	1.03	63%	0.628	S	S	*	*				0	-44.5	0	-68.4	-178.2	144.6	0	0	113.1	Q3 S4 V5	M1-Q3 VanDerWaalsContact C-N 3.34Å; M1-Q3 PolarHBondContact O-N 2.98Å; M1-S4 PolarHBondContact O-N 3.18Å; M1-V5 PolarHBondContact O-N 3.25Å
2	W	78.9	Confident	88.6	Confident	236 Å²	236	116.2 Å²	116.2	89%	0.894	62%	0.619	S	S	*	*	H	α-helix	trans	-58	-36.2	178.9	-111.6	69.9	0	0	0	115.5	V5 G6	W2-V5 PolarHBondContact O-N 3.06Å; W2-G6 PolarHBondContact O-N 3.33Å
3	Q	81.5	Confident	89.3	Confident	153 Å²	153	113.5 Å²	113.5	72%	0.715	61%	0.609	S	S	*	*	H	α-helix	trans	-63.1	-42.5	178.8	-68.1	-68.9	-40.1	0	0	112.6	M1 V5 G6 L7	M1-Q3 VanDerWaalsContact C-N 3.34Å; M1-Q3 PolarHBondContact O-N 2.98Å; Q3-V5 VanDerWaalsContact C-N 3.34Å; Q3-V5 PolarHBondContact O-N 3.34Å; Q3-G6 PolarHBondContact O-N 2.83Å; Q3-L7 PolarHBondContact O-N 2.73Å
4	S	86.8	Confident	89.8	Confident	76 Å²	76	108.8 Å²	108.8	53%	0.531	59%	0.594	S	S	.	*	H	α-helix	trans	-64.5	-40.3	177.8	-46.2	0	0	0	0	111.3	M1 L7 T8	M1-S4 PolarHBondContact O-N 3.18Å; S4-L7 PolarHBondContact O-N 2.7Å; S4-T8 PolarHBondContact O-N 3.3Å; S4-T8 PolarHBondContact O-OG1 3.2Å
5	V	92.2	Very high	90.3	Very high	93 Å²	93	107.3 Å²	107.3	56%	0.564	59%	0.59	S	S	*	*	H	α-helix	trans	-64.6	-44.5	176.5	179.8	0	0	0	0	110.8	M1 W2 Q3 L7 T8 V9	M1-V5 PolarHBondContact O-N 3.25Å; W2-V5 PolarHBondContact O-N 3.06Å; Q3-V5 VanDerWaalsContact C-N 3.34Å; Q3-V5 PolarHBondContact O-N 3.34Å; V5-L7 PolarHBondContact O-N 2.53Å; V5-T8 PolarHBondContact O-N 3.42Å; V5-V9 HydrophobicContact CG1-CG2 4.34Å; V5-V9 WeakPolarHBondContact O-CB 2.92Å; V5-V9 VanDerWaalsContact O-CG2 3.25Å; V5-V9 WeakPolarHBondContact O-CG2 3.4Å; V5-V9 PolarHBondContact O-N 3.25Å
6	G	90.8	Very high	90.7	Very high	41 Å²	41	107.6 Å²	107.6	42%	0.423	59%	0.589	S	S	.	*	H	α-helix	trans	-60.7	-44.6	176.9	0	0	0	0	0	113	W2 Q3 V9 L10	W2-G6 PolarHBondContact O-N 3.33Å; Q3-G6 PolarHBondContact O-N 2.83Å; G6-V9 PolarHBondContact O-N 3.44Å; G6-L10 VanDerWaalsContact O-CB 3.31Å; G6-L10 WeakPolarHBondContact O-CB 3.13Å; G6-L10 PolarHBondContact O-N 2.73Å
7	L	93.4	Very high	91	Very high	117 Å²	117	105.5 Å²	105.5	61%	0.613	58%	0.58	S	S	*	*	H	α-helix	trans	-62.3	-46.9	175.8	-80.4	163.5	0	0	0	112.1	Q3 S4 V5 L10 V11	Q3-L7 PolarHBondContact O-N 2.73Å; S4-L7 PolarHBondContact O-N 2.7Å; V5-L7 PolarHBondContact O-N 2.53Å; L7-L10 PolarHBondContact O-N 3.4Å; L7-V11 WeakPolarHBondContact O-CG2 3.16Å; L7-V11 PolarHBondContact O-N 3.1Å
8	T	93.3	Very high	91.3	Very high	82 Å²	82	103.7 Å²	103.7	50%	0.503	58%	0.576	S	S	.	*	H	α-helix	trans	-62.9	-43.9	178.4	-58	0	0	0	0	111.7	S4 V5 L10 V11 I12	S4-T8 PolarHBondContact O-N 3.3Å; S4-T8 PolarHBondContact O-OG1 3.2Å; V5-T8 PolarHBondContact O-N 3.42Å; T8-L10 VanDerWaalsContact C-N 3.34Å; T8-L10 PolarHBondContact O-N 3.43Å; T8-V11 PolarHBondContact O-N 2.66Å; T8-I12 HydrophobicContact CG2-CD1 3.9Å; T8-I12 WeakPolarHBondContact O-CD1 3.47Å; T8-I12 VanDerWaalsContact O-CG1 3.24Å; T8-I12 WeakPolarHBondContact O-CG1 3.08Å; T8-I12 PolarHBondContact O-N 2.83Å
9	V	95.5	Very high	91.6	Very high	78 Å²	78	101.1 Å²	101.1	47%	0.473	57%	0.569	S	S	.	*	H	α-helix	trans	-61.6	-43.4	175.8	171.3	0	0	0	0	110.8	V5 G6 V11 I12 V13	V5-V9 HydrophobicContact CG1-CG2 4.34Å; V5-V9 WeakPolarHBondContact O-CB 2.92Å; V5-V9 VanDerWaalsContact O-CG2 3.25Å; V5-V9 WeakPolarHBondContact O-CG2 3.4Å; V5-V9 PolarHBondContact O-N 3.25Å; G6-V9 PolarHBondContact O-N 3.44Å; V9-V11 VanDerWaalsContact C-N 3.34Å; V9-V11 PolarHBondContact O-N 3.44Å; V9-I12 PolarHBondContact O-N 2.64Å; V9-V13 HydrophobicContact CG1-CG2 4.25Å; V9-V13 WeakPolarHBondContact O-CB 3.37Å; V9-V13 VanDerWaalsContact O-CG2 3.27Å; V9-V13 WeakPolarHBondContact O-CG2 3.31Å; V9-V13 PolarHBondContact O-N 2.78Å
10	L	95.8	Very high	91.8	Very high	121 Å²	121	100.8 Å²	100.8	63%	0.634	57%	0.565	S	S	*	*	H	α-helix	trans	-64.2	-39.8	179.4	-164.6	129.6	0	0	0	112	G6 L7 T8 V13 A14	G6-L10 VanDerWaalsContact O-CB 3.31Å; G6-L10 WeakPolarHBondContact O-CB 3.13Å; G6-L10 PolarHBondContact O-N 2.73Å; L7-L10 PolarHBondContact O-N 3.4Å; T8-L10 VanDerWaalsContact C-N 3.34Å; T8-L10 PolarHBondContact O-N 3.43Å; L10-V13 PolarHBondContact O-N 2.72Å; L10-A14 VanDerWaalsContact O-CB 3.24Å; L10-A14 WeakPolarHBondContact O-CB 3.03Å; L10-A14 PolarHBondContact O-N 2.79Å
11	V	95.6	Very high	92	Very high	87 Å²	87	101.2 Å²	101.2	53%	0.527	57%	0.565	S	S	.	*	H	α-helix	trans	-64	-43.7	173.8	170.1	0	0	0	0	111.1	L7 T8 V9 A14 T15	L7-V11 WeakPolarHBondContact O-CG2 3.16Å; L7-V11 PolarHBondContact O-N 3.1Å; T8-V11 PolarHBondContact O-N 2.66Å; V9-V11 VanDerWaalsContact C-N 3.34Å; V9-V11 PolarHBondContact O-N 3.44Å; V11-A14 PolarHBondContact O-N 2.67Å; V11-T15 VanDerWaalsContact O-CB 3.31Å; V11-T15 WeakPolarHBondContact O-CB 3.42Å; V11-T15 PolarHBondContact O-N 2.75Å; V11-T15 PolarHBondContact O-OG1 2.76Å
12	I	96.1	Very high	93.4	Very high	101 Å²	101	99.2 Å²	99.2	52%	0.518	55%	0.551	S	S	.	*	H	α-helix	trans	-61.3	-48.3	177.1	-69	163.4	0	0	0	110	T8 V9 T15 L16	T8-I12 HydrophobicContact CG2-CD1 3.9Å; T8-I12 WeakPolarHBondContact O-CD1 3.47Å; T8-I12 VanDerWaalsContact O-CG1 3.24Å; T8-I12 WeakPolarHBondContact O-CG1 3.08Å; T8-I12 PolarHBondContact O-N 2.83Å; V9-I12 PolarHBondContact O-N 2.64Å; I12-T15 PolarHBondContact O-N 3.27Å; I12-L16 VanDerWaalsContact O-CB 3.3Å; I12-L16 WeakPolarHBondContact O-CB 3.2Å; I12-L16 PolarHBondContact O-N 2.83Å
13	V	97.5	Very high	94.2	Very high	81 Å²	81	94.6 Å²	94.6	49%	0.491	54%	0.542	S	S	.	.	H	α-helix	trans	-61.5	-47.5	178.7	172	0	0	0	0	110.8	V9 L10 T15 L16 V17	V9-V13 HydrophobicContact CG1-CG2 4.25Å; V9-V13 WeakPolarHBondContact O-CB 3.37Å; V9-V13 VanDerWaalsContact O-CG2 3.27Å; V9-V13 WeakPolarHBondContact O-CG2 3.31Å; V9-V13 PolarHBondContact O-N 2.78Å; L10-V13 PolarHBondContact O-N 2.72Å; V13-T15 VanDerWaalsContact C-N 3.33Å; V13-T15 PolarHBondContact O-N 2.65Å; V13-L16 PolarHBondContact O-N 3.43Å; V13-V17 HydrophobicContact CG1-CG2 4.4Å; V13-V17 VanDerWaalsContact O-CG2 3.31Å; V13-V17 WeakPolarHBondContact O-CG2 3.34Å; V13-V17 PolarHBondContact O-N 3.39Å
14	A	96.6	Very high	94.7	Very high	48 Å²	48	90.1 Å²	90.1	40%	0.397	53%	0.525	S	S	.	.	H	α-helix	trans	-60.4	-43.5	178	0	0	0	0	0	111.7	L10 V11 L16 V17 C18	L10-A14 VanDerWaalsContact O-CB 3.24Å; L10-A14 WeakPolarHBondContact O-CB 3.03Å; L10-A14 PolarHBondContact O-N 2.79Å; V11-A14 PolarHBondContact O-N 2.67Å; A14-L16 VanDerWaalsContact C-N 3.35Å; A14-L16 PolarHBondContact O-N 2.82Å; A14-V17 PolarHBondContact O-N 2.89Å; A14-C18 WeakPolarHBondContact O-CB 3.38Å; A14-C18 PolarHBondContact O-N 3.46Å; A14-C18 PolarHBondContact O-SG 2.83Å; A14-C18 VanDerWaalsContact O-SG 3.39Å
15	T	96.4	Very high	94.9	Very high	87 Å²	87	93.8 Å²	93.8	53%	0.534	53%	0.531	S	S	.	.	H	α-helix	trans	-64.3	-41.2	176.8	-52.8	0	0	0	0	111.2	V11 I12 V13 C18 A19	V11-T15 VanDerWaalsContact O-CB 3.31Å; V11-T15 WeakPolarHBondContact O-CB 3.42Å; V11-T15 PolarHBondContact O-N 2.75Å; V11-T15 PolarHBondContact O-OG1 2.76Å; I12-T15 PolarHBondContact O-N 3.27Å; V13-T15 VanDerWaalsContact C-N 3.33Å; V13-T15 PolarHBondContact O-N 2.65Å; T15-C18 PolarHBondContact O-N 3.43Å; T15-A19 WeakPolarHBondContact O-CB 3.25Å; T15-A19 PolarHBondContact O-N 3.38Å
16	L	97.1	Very high	94.8	Very high	112 Å²	112	91.3 Å²	91.3	59%	0.586	52%	0.524	S	S	*	.	H	α-helix	trans	-65	-43.2	178.3	-158	75.5	0	0	0	111.3	I12 V13 A14 A19 L20	I12-L16 VanDerWaalsContact O-CB 3.3Å; I12-L16 WeakPolarHBondContact O-CB 3.2Å; I12-L16 PolarHBondContact O-N 2.83Å; V13-L16 PolarHBondContact O-N 3.43Å; A14-L16 VanDerWaalsContact C-N 3.35Å; A14-L16 PolarHBondContact O-N 2.82Å; L16-A19 PolarHBondContact O-N 3.41Å; L16-L20 HydrophobicContact CG-CD1 4.35Å; L16-L20 WeakPolarHBondContact O-CB 3.23Å; L16-L20 WeakPolarHBondContact O-CD1 3.43Å; L16-L20 WeakPolarHBondContact O-CG 3.46Å; L16-L20 PolarHBondContact O-N 2.68Å
17	V	96.5	Very high	94.8	Very high	72 Å²	72	97.5 Å²	97.5	44%	0.436	54%	0.535	S	S	.	.	H	α-helix	trans	-63.4	-45.4	174.6	172.3	0	0	0	0	110.5	V13 A14 A19 L20 L21	V13-V17 HydrophobicContact CG1-CG2 4.4Å; V13-V17 VanDerWaalsContact O-CG2 3.31Å; V13-V17 WeakPolarHBondContact O-CG2 3.34Å; V13-V17 PolarHBondContact O-N 3.39Å; A14-V17 PolarHBondContact O-N 2.89Å; V17-A19 VanDerWaalsContact C-N 3.33Å; V17-A19 PolarHBondContact O-N 3.02Å; V17-L20 PolarHBondContact O-N 3.48Å; V17-L21 HydrophobicContact CG1-CD1 4.03Å; V17-L21 HydrophobicContact CG1-CG 4.33Å; V17-L21 WeakPolarHBondContact O-CB 3.39Å; V17-L21 VanDerWaalsContact O-CG 3.28Å; V17-L21 WeakPolarHBondContact O-CG 3.21Å; V17-L21 PolarHBondContact O-N 3.43Å
18	C	96.1	Very high	94.6	Very high	73 Å²	73	97.5 Å²	97.5	49%	0.493	53%	0.528	S	S	.	.	H	α-helix	trans	-59.4	-44	174.8	-78.1	0	0	0	0	111.8	A14 T15 L21 F22	A14-C18 WeakPolarHBondContact O-CB 3.38Å; A14-C18 PolarHBondContact O-N 3.46Å; A14-C18 PolarHBondContact O-SG 2.83Å; A14-C18 VanDerWaalsContact O-SG 3.39Å; T15-C18 PolarHBondContact O-N 3.43Å; C18-L21 PolarHBondContact O-N 3.38Å; C18-F22 WeakPolarHBondContact O-CB 2.99Å; C18-F22 WeakPolarHBondContact O-CD2 3.3Å; C18-F22 PolarHBondContact O-N 2.79Å
19	A	95.9	Very high	94.3	Very high	54 Å²	54	96.5 Å²	96.5	45%	0.446	52%	0.522	S	S	.	.	H	α-helix	trans	-64.9	-43.2	177.5	0	0	0	0	0	111.9	T15 L16 V17 F22 M23	T15-A19 WeakPolarHBondContact O-CB 3.25Å; T15-A19 PolarHBondContact O-N 3.38Å; L16-A19 PolarHBondContact O-N 3.41Å; V17-A19 VanDerWaalsContact C-N 3.33Å; V17-A19 PolarHBondContact O-N 3.02Å; A19-F22 PolarHBondContact O-N 2.81Å; A19-M23 VanDerWaalsContact O-CB 3.26Å; A19-M23 WeakPolarHBondContact O-CB 2.97Å; A19-M23 PolarHBondContact O-N 3.49Å
20	L	96.3	Very high	93.9	Very high	95 Å²	95	97 Å²	97	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-59.5	-47.6	173.7	-85.8	156.1	0	0	0	111	L16 V17 F22 M23 V24	L16-L20 HydrophobicContact CG-CD1 4.35Å; L16-L20 WeakPolarHBondContact O-CB 3.23Å; L16-L20 WeakPolarHBondContact O-CD1 3.43Å; L16-L20 WeakPolarHBondContact O-CG 3.46Å; L16-L20 PolarHBondContact O-N 2.68Å; V17-L20 PolarHBondContact O-N 3.48Å; L20-F22 PolarHBondContact O-N 2.77Å; L20-M23 PolarHBondContact O-N 3.44Å; L20-V24 VanDerWaalsContact O-CB 3.23Å; L20-V24 WeakPolarHBondContact O-CB 3.1Å; L20-V24 WeakPolarHBondContact O-CG2 3.36Å; L20-V24 PolarHBondContact O-N 2.74Å
21	L	95.3	Very high	93.4	Very high	109 Å²	109	97.6 Å²	97.6	57%	0.571	52%	0.519	S	S	*	.	H	α-helix	trans	-60.7	-45.3	176.4	-73.4	175.1	0	0	0	111	V17 C18 F25	V17-L21 HydrophobicContact CG1-CD1 4.03Å; V17-L21 HydrophobicContact CG1-CG 4.33Å; V17-L21 WeakPolarHBondContact O-CB 3.39Å; V17-L21 VanDerWaalsContact O-CG 3.28Å; V17-L21 WeakPolarHBondContact O-CG 3.21Å; V17-L21 PolarHBondContact O-N 3.43Å; C18-L21 PolarHBondContact O-N 3.38Å; L21-F25 WeakPolarHBondContact O-CB 3.39Å; L21-F25 PolarHBondContact O-N 2.72Å
22	F	94.6	Very high	92.7	Very high	167 Å²	167	98.5 Å²	98.5	73%	0.732	52%	0.517	S	S	*	.	H	α-helix	trans	-64.7	-40.5	176.6	-99.8	-82.5	0	0	0	112.7	C18 A19 L20 F25 G26	C18-F22 WeakPolarHBondContact O-CB 2.99Å; C18-F22 WeakPolarHBondContact O-CD2 3.3Å; C18-F22 PolarHBondContact O-N 2.79Å; A19-F22 PolarHBondContact O-N 2.81Å; L20-F22 PolarHBondContact O-N 2.77Å; F22-F25 PolarHBondContact O-N 3.39Å; F22-G26 PolarHBondContact O-N 2.82Å
23	M	95.3	Very high	92	Very high	140 Å²	140	98.2 Å²	98.2	69%	0.69	52%	0.516	S	S	*	.	H	α-helix	trans	-64.8	-48	178.1	-172.6	-167.3	-179	0	0	110.5	A19 L20 W27	A19-M23 VanDerWaalsContact O-CB 3.26Å; A19-M23 WeakPolarHBondContact O-CB 2.97Å; A19-M23 PolarHBondContact O-N 3.49Å; L20-M23 PolarHBondContact O-N 3.44Å; M23-W27 WeakPolarHBondContact O-CB 3.41Å; M23-W27 PolarHBondContact O-N 2.79Å
24	V	91.9	Very high	90.8	Very high	59 Å²	59	100.7 Å²	100.7	36%	0.358	52%	0.52	S	S	.	.	H	α-helix	trans	-61.7	-47.3	173.7	167.3	0	0	0	0	109.1	L20 G26 W27 Y28	L20-V24 VanDerWaalsContact O-CB 3.23Å; L20-V24 WeakPolarHBondContact O-CB 3.1Å; L20-V24 WeakPolarHBondContact O-CG2 3.36Å; L20-V24 PolarHBondContact O-N 2.74Å; V24-G26 PolarHBondContact O-N 2.82Å; V24-W27 CarbonylContact O-C 3.59Å; V24-W27 PolarHBondContact O-N 3.43Å; V24-Y28 HydrophobicContact CB-CD2 4.17Å; V24-Y28 HydrophobicContact CB-CE2 4.14Å; V24-Y28 HydrophobicContact CG1-CD2 3.38Å; V24-Y28 HydrophobicContact CG1-CE2 3.2Å; V24-Y28 HydrophobicContact CG1-CG 4.2Å; V24-Y28 HydrophobicContact CG2-CE2 4.44Å; V24-Y28 WeakPolarHBondContact O-CA 3.34Å; V24-Y28 WeakPolarHBondContact O-CB 3.04Å; V24-Y28 WeakPolarHBondContact O-CD2 3.17Å; V24-Y28 PolarHBondContact O-N 3.31Å
25	F	91.3	Very high	89.6	Confident	152 Å²	152	102.6 Å²	102.6	67%	0.667	52%	0.523	S	S	*	.	H	α-helix	trans	-63.2	-44.8	-179.5	-143.9	-94.6	0	0	0	111.8	L21 F22 Y28 V29	L21-F25 WeakPolarHBondContact O-CB 3.39Å; L21-F25 PolarHBondContact O-N 2.72Å; F22-F25 PolarHBondContact O-N 3.39Å; F25-Y28 PolarHBondContact O-N 2.87Å; F25-V29 HydrophobicContact CD1-CG2 3.83Å; F25-V29 HydrophobicContact CE1-CG2 4Å; F25-V29 VanDerWaalsContact O-CB 3.24Å; F25-V29 WeakPolarHBondContact O-CB 2.95Å; F25-V29 WeakPolarHBondContact O-CG2 3.47Å; F25-V29 PolarHBondContact O-N 3.21Å
26	G	89.6	Confident	88.2	Confident	41 Å²	41	101.1 Å²	101.1	42%	0.423	52%	0.516	S	S	.	.	H	α-helix	trans	-62.6	-44.5	174.9	0	0	0	0	0	112.2	F22 V24 V29 V30	F22-G26 PolarHBondContact O-N 2.82Å; V24-G26 PolarHBondContact O-N 2.82Å; G26-V29 PolarHBondContact O-N 2.83Å; G26-V30 VanDerWaalsContact O-CG2 3.31Å; G26-V30 WeakPolarHBondContact O-CG2 3.08Å; G26-V30 PolarHBondContact O-N 3.34Å
27	W	90.4	Very high	86.7	Confident	172 Å²	172	102.1 Å²	102.1	65%	0.652	52%	0.516	S	S	*	.	H	α-helix	trans	-63.8	-45.3	176.1	-177.6	-95.5	0	0	0	112.2	M23 V24 V30 W31	M23-W27 WeakPolarHBondContact O-CB 3.41Å; M23-W27 PolarHBondContact O-N 2.79Å; V24-W27 CarbonylContact O-C 3.59Å; V24-W27 PolarHBondContact O-N 3.43Å; W27-V30 PolarHBondContact O-N 2.84Å; W27-W31 WeakPolarHBondContact O-CB 3Å; W27-W31 PolarHBondContact O-N 3.44Å
28	Y	89.6	Confident	85.2	Confident	116 Å²	116	105 Å²	105	46%	0.455	52%	0.523	S	S	.	.	H	α-helix	trans	-71.9	-32.8	179.9	-82.4	-115.4	0	0	0	111.2	V24 F25 W31 Q32	V24-Y28 HydrophobicContact CB-CD2 4.17Å; V24-Y28 HydrophobicContact CB-CE2 4.14Å; V24-Y28 HydrophobicContact CG1-CD2 3.38Å; V24-Y28 HydrophobicContact CG1-CE2 3.2Å; V24-Y28 HydrophobicContact CG1-CG 4.2Å; V24-Y28 HydrophobicContact CG2-CE2 4.44Å; V24-Y28 WeakPolarHBondContact O-CA 3.34Å; V24-Y28 WeakPolarHBondContact O-CB 3.04Å; V24-Y28 WeakPolarHBondContact O-CD2 3.17Å; V24-Y28 PolarHBondContact O-N 3.31Å; F25-Y28 PolarHBondContact O-N 2.87Å; Y28-W31 HydrophobicContact CD1-CE3 4.34Å; Y28-W31 HydrophobicContact CE1-CE3 4.43Å; Y28-W31 HydrophobicContact CE1-CZ3 4.27Å; Y28-W31 CarbonylContact O-C 3.58Å; Y28-W31 PolarHBondContact O-N 2.83Å; Y28-Q32 WeakPolarHBondContact O-CA 3.21Å; Y28-Q32 WeakPolarHBondContact O-CB 3.08Å; Y28-Q32 WeakPolarHBondContact O-CG 3.42Å; Y28-Q32 PolarHBondContact O-N 3.31Å
29	V	87.3	Confident	83.8	Confident	62 Å²	62	106.7 Å²	106.7	38%	0.376	52%	0.522	S	S	.	.	H	α-helix	trans	-68	-42.5	172.9	167.3	0	0	0	0	109.9	F25 G26 Q32 L33	F25-V29 HydrophobicContact CD1-CG2 3.83Å; F25-V29 HydrophobicContact CE1-CG2 4Å; F25-V29 VanDerWaalsContact O-CB 3.24Å; F25-V29 WeakPolarHBondContact O-CB 2.95Å; F25-V29 WeakPolarHBondContact O-CG2 3.47Å; F25-V29 PolarHBondContact O-N 3.21Å; G26-V29 PolarHBondContact O-N 2.83Å; V29-Q32 PolarHBondContact O-N 3.47Å; V29-L33 HydrophobicContact CG1-CD1 3.72Å; V29-L33 HydrophobicContact CG1-CG 4.3Å; V29-L33 WeakPolarHBondContact O-CB 3.17Å; V29-L33 WeakPolarHBondContact O-CD1 3.08Å; V29-L33 WeakPolarHBondContact O-CG 3.09Å; V29-L33 PolarHBondContact O-N 3.45Å
30	V	86.8	Confident	82	Confident	88 Å²	88	110.5 Å²	110.5	53%	0.533	53%	0.529	S	S	.	.	H	α-helix	trans	-63	-45	172.8	172.5	0	0	0	0	110.4	G26 W27 L33 F34	G26-V30 VanDerWaalsContact O-CG2 3.31Å; G26-V30 WeakPolarHBondContact O-CG2 3.08Å; G26-V30 PolarHBondContact O-N 3.34Å; W27-V30 PolarHBondContact O-N 2.84Å; V30-L33 PolarHBondContact O-N 2.85Å; V30-F34 WeakPolarHBondContact O-CB 3.21Å; V30-F34 PolarHBondContact O-N 3.32Å
31	W	84.6	Confident	80.6	Confident	134 Å²	134	110.9 Å²	110.9	51%	0.508	53%	0.531	S	S	.	.	H	α-helix	trans	-65.6	-38.7	178.3	-169	19.3	0	0	0	112.3	W27 Y28 F34 L35	W27-W31 WeakPolarHBondContact O-CB 3Å; W27-W31 PolarHBondContact O-N 3.44Å; Y28-W31 HydrophobicContact CD1-CE3 4.34Å; Y28-W31 HydrophobicContact CE1-CE3 4.43Å; Y28-W31 HydrophobicContact CE1-CZ3 4.27Å; Y28-W31 CarbonylContact O-C 3.58Å; Y28-W31 PolarHBondContact O-N 2.83Å; W31-F34 WeakPolarHBondContact O-CB 3.31Å; W31-F34 PolarHBondContact O-N 2.85Å; W31-L35 HydrophobicContact CD2-CD1 4.34Å; W31-L35 HydrophobicContact CG-CD1 4.18Å; W31-L35 WeakPolarHBondContact O-CB 3.49Å; W31-L35 PolarHBondContact O-N 3.35Å
32	Q	81	Confident	79.3	Confident	106 Å²	106	114.9 Å²	114.9	50%	0.495	54%	0.538	S	S	.	.	H	α-helix	trans	-74.5	-35.5	176.7	-81	-74.9	14	0	0	111.9	Y28 V29 F34 S36	Y28-Q32 WeakPolarHBondContact O-CA 3.21Å; Y28-Q32 WeakPolarHBondContact O-CB 3.08Å; Y28-Q32 WeakPolarHBondContact O-CG 3.42Å; Y28-Q32 PolarHBondContact O-N 3.31Å; V29-Q32 PolarHBondContact O-N 3.47Å; Q32-F34 VanDerWaalsContact C-N 3.29Å; Q32-S36 WeakPolarHBondContact O-CA 3.2Å; Q32-S36 WeakPolarHBondContact O-CB 3.45Å; Q32-S36 PolarHBondContact O-N 2.94Å; Q32-S36 PolarHBondContact O-OG 3.28Å
33	L	81.2	Confident	77.9	Confident	94 Å²	94	111.4 Å²	111.4	49%	0.492	52%	0.524	S	S	.	.	H	α-helix	trans	-67.4	-36.6	171.1	-78.1	165.5	0	0	0	109.8	V29 V30 K37	V29-L33 HydrophobicContact CG1-CD1 3.72Å; V29-L33 HydrophobicContact CG1-CG 4.3Å; V29-L33 WeakPolarHBondContact O-CB 3.17Å; V29-L33 WeakPolarHBondContact O-CD1 3.08Å; V29-L33 WeakPolarHBondContact O-CG 3.09Å; V29-L33 PolarHBondContact O-N 3.45Å; V30-L33 PolarHBondContact O-N 2.85Å; L33-K37 WeakPolarHBondContact O-CB 3.23Å; L33-K37 WeakPolarHBondContact O-CG 3.34Å; L33-K37 PolarHBondContact O-N 3.22Å
34	F	73.3	Confident	76.3	Confident	133 Å²	133	109.8 Å²	109.8	58%	0.583	52%	0.516	S	S	*	.	H	α-helix	trans	-64.5	-52.8	171.3	-109.5	-94.6	0	0	0	111.8	V30 W31 Q32 K37 F38	V30-F34 WeakPolarHBondContact O-CB 3.21Å; V30-F34 PolarHBondContact O-N 3.32Å; W31-F34 WeakPolarHBondContact O-CB 3.31Å; W31-F34 PolarHBondContact O-N 2.85Å; Q32-F34 VanDerWaalsContact C-N 3.29Å; F34-K37 PolarHBondContact O-N 3.43Å; F34-F38 HydrophobicContact CD1-CD2 4.2Å; F34-F38 HydrophobicContact CD1-CE2 4.11Å; F34-F38 HydrophobicContact CE1-CE2 4.23Å; F34-F38 WeakPolarHBondContact O-CB 3.27Å; F34-F38 WeakPolarHBondContact O-CD2 3.31Å; F34-F38 PolarHBondContact O-N 2.69Å
35	L	71.4	Confident	74.9	Confident	89 Å²	89	113.4 Å²	113.4	47%	0.466	53%	0.533	S	S	.	.	H	α-helix	trans	-66	-38.3	179.1	-83.8	157.4	0	0	0	112.3	W31 F38 K39	W31-L35 HydrophobicContact CD2-CD1 4.34Å; W31-L35 HydrophobicContact CG-CD1 4.18Å; W31-L35 WeakPolarHBondContact O-CB 3.49Å; W31-L35 PolarHBondContact O-N 3.35Å; L35-F38 CarbonylContact O-C 3.59Å; L35-F38 PolarHBondContact O-N 2.84Å; L35-K39 WeakPolarHBondContact O-CA 3.26Å; L35-K39 WeakPolarHBondContact O-CB 3.11Å; L35-K39 PolarHBondContact O-N 3.44Å
36	S	67.3	Low	73.2	Confident	55 Å²	55	108.4 Å²	108.4	39%	0.385	52%	0.524	S	S	.	.	H	α-helix	trans	-75.8	-35	178.3	-62.3	0	0	0	0	111.4	Q32 K39 F40	Q32-S36 WeakPolarHBondContact O-CA 3.2Å; Q32-S36 WeakPolarHBondContact O-CB 3.45Å; Q32-S36 PolarHBondContact O-N 2.94Å; Q32-S36 PolarHBondContact O-OG 3.28Å; S36-K39 PolarHBondContact O-N 3.39Å; S36-F40 WeakPolarHBondContact O-CB 3.24Å; S36-F40 PolarHBondContact O-N 3.5Å
37	K	65.7	Low	71.5	Confident	134 Å²	134	112.4 Å²	112.4	58%	0.583	54%	0.536	S	S	*	.	H	α-helix	trans	-68.1	-38.1	169.1	-69.6	-75.1	170.7	68.1	0	110.8	L33 F34 L41	L33-K37 WeakPolarHBondContact O-CB 3.23Å; L33-K37 WeakPolarHBondContact O-CG 3.34Å; L33-K37 PolarHBondContact O-N 3.22Å; F34-K37 PolarHBondContact O-N 3.43Å; K37-L41 VanDerWaalsContact O-CB 3.3Å; K37-L41 WeakPolarHBondContact O-CB 3.3Å; K37-L41 WeakPolarHBondContact O-CD1 3.45Å; K37-L41 PolarHBondContact O-N 3.32Å
38	F	64	Low	69.5	Low	133 Å²	133	108.7 Å²	108.7	58%	0.583	53%	0.532	S	S	*	.	H	α-helix	trans	-73.4	-27.7	172.2	-92.2	-87.5	0	0	0	114.1	F34 L35 R42	F34-F38 HydrophobicContact CD1-CD2 4.2Å; F34-F38 HydrophobicContact CD1-CE2 4.11Å; F34-F38 HydrophobicContact CE1-CE2 4.23Å; F34-F38 WeakPolarHBondContact O-CB 3.27Å; F34-F38 WeakPolarHBondContact O-CD2 3.31Å; F34-F38 PolarHBondContact O-N 2.69Å; L35-F38 CarbonylContact O-C 3.59Å; L35-F38 PolarHBondContact O-N 2.84Å; F38-R42 WeakPolarHBondContact O-CB 3.45Å; F38-R42 PolarHBondContact O-N 2.86Å
39	K	66.6	Low	67.5	Low	107 Å²	107	106.1 Å²	106.1	47%	0.465	54%	0.541	S	S	.	.	H	α-helix	trans	-78.4	-34.7	175.2	-162.4	179.9	96.1	70.8	0	110.2	L35 S36 R42 E43	L35-K39 WeakPolarHBondContact O-CA 3.26Å; L35-K39 WeakPolarHBondContact O-CB 3.11Å; L35-K39 PolarHBondContact O-N 3.44Å; S36-K39 PolarHBondContact O-N 3.39Å; K39-R42 CarbonylContact O-C 3.49Å; K39-R42 PolarHBondContact O-N 2.88Å; K39-E43 IonicContact NZ-OE1 2.66Å; K39-E43 PolarHBondContact NZ-OE1 3.4Å; K39-E43 IonicContact NZ-OE2 3.74Å; K39-E43 WeakPolarHBondContact O-CB 3.49Å; K39-E43 VanDerWaalsContact O-CG 3.25Å; K39-E43 WeakPolarHBondContact O-CG 3.28Å; K39-E43 PolarHBondContact O-N 3Å
40	F	59.8	Low	65.6	Low	135 Å²	135	106 Å²	106	59%	0.592	54%	0.543	S	S	*	.	H	α-helix	trans	-74.1	-31.1	168.8	-154.3	-87.8	0	0	0	112	S36 M44	S36-F40 WeakPolarHBondContact O-CB 3.24Å; S36-F40 PolarHBondContact O-N 3.5Å; F40-M44 HydrophobicContact CD1-CG 3.95Å; F40-M44 HydrophobicContact CE1-CG 3.98Å; F40-M44 WeakPolarHBondContact O-CA 3.25Å; F40-M44 WeakPolarHBondContact O-CB 3.45Å; F40-M44 VanDerWaalsContact O-CG 3.23Å; F40-M44 WeakPolarHBondContact O-CG 3.24Å; F40-M44 PolarHBondContact O-N 3.41Å
41	L	65.3	Low	63.8	Low	103 Å²	103	107.2 Å²	107.2	54%	0.539	55%	0.553	S	S	.	*	H	α-helix	trans	-72	-34.9	167.3	-99.5	89.9	0	0	0	111.5	K37 L45	K37-L41 VanDerWaalsContact O-CB 3.3Å; K37-L41 WeakPolarHBondContact O-CB 3.3Å; K37-L41 WeakPolarHBondContact O-CD1 3.45Å; K37-L41 PolarHBondContact O-N 3.32Å; L41-L45 WeakPolarHBondContact O-CA 3.31Å; L41-L45 WeakPolarHBondContact O-CB 3.31Å; L41-L45 PolarHBondContact O-N 3.49Å
42	R	67.8	Low	62.1	Low	193 Å²	193	109.7 Å²	109.7	73%	0.728	57%	0.57	S	S	*	*	H	α-helix	trans	-78.7	-27.3	176.8	-170.1	164.8	75.2	157.8	3.6	112.1	F38 K39 G46	F38-R42 WeakPolarHBondContact O-CB 3.45Å; F38-R42 PolarHBondContact O-N 2.86Å; K39-R42 CarbonylContact O-C 3.49Å; K39-R42 PolarHBondContact O-N 2.88Å; R42-G46 WeakPolarHBondContact O-CA 3.49Å; R42-G46 PolarHBondContact O-N 3.5Å
43	E	66.7	Low	60.6	Low	94 Å²	94	108.9 Å²	108.9	44%	0.439	58%	0.581	S	S	.	*	H	α-helix	trans	-74.3	-45.6	165.1	-77.4	162.9	179.2	0	0	109.3	K39 L45 G46 D47	K39-E43 IonicContact NZ-OE1 2.66Å; K39-E43 PolarHBondContact NZ-OE1 3.4Å; K39-E43 IonicContact NZ-OE2 3.74Å; K39-E43 WeakPolarHBondContact O-CB 3.49Å; K39-E43 VanDerWaalsContact O-CG 3.25Å; K39-E43 WeakPolarHBondContact O-CG 3.28Å; K39-E43 PolarHBondContact O-N 3Å; E43-L45 PolarHBondContact O-N 3.35Å; E43-G46 PolarHBondContact O-N 3.46Å; E43-D47 WeakPolarHBondContact O-CA 3.39Å; E43-D47 WeakPolarHBondContact O-CB 3.35Å; E43-D47 PolarHBondContact O-N 3.35Å
44	M	61.9	Low	59.2	Low	105 Å²	105	113.3 Å²	113.3	52%	0.517	60%	0.599	S	S	.	*	H	α-helix	trans	-65.5	-38.8	175.3	-82.5	-106.6	57.1	0	0	113.6	F40 T48	F40-M44 HydrophobicContact CD1-CG 3.95Å; F40-M44 HydrophobicContact CE1-CG 3.98Å; F40-M44 WeakPolarHBondContact O-CA 3.25Å; F40-M44 WeakPolarHBondContact O-CB 3.45Å; F40-M44 VanDerWaalsContact O-CG 3.23Å; F40-M44 WeakPolarHBondContact O-CG 3.24Å; F40-M44 PolarHBondContact O-N 3.41Å; M44-T48 HydrophobicContact CE-CG2 4.28Å; M44-T48 VanDerWaalsContact O-CB 3.31Å; M44-T48 WeakPolarHBondContact O-CB 3.24Å; M44-T48 WeakPolarHBondContact O-CG2 3.33Å; M44-T48 PolarHBondContact O-N 2.92Å; M44-T48 VanDerWaalsContact O-N 3.1Å; M44-T48 PolarHBondContact O-OG1 2.92Å
45	L	60.8	Low	58	Low	136 Å²	136	113.3 Å²	113.3	71%	0.712	61%	0.611	S	S	*	*	H	α-helix	trans	-81.1	-24.8	176.5	-170.6	64.3	0	0	0	112.1	L41 E43 T48 G49	L41-L45 WeakPolarHBondContact O-CA 3.31Å; L41-L45 WeakPolarHBondContact O-CB 3.31Å; L41-L45 PolarHBondContact O-N 3.49Å; E43-L45 PolarHBondContact O-N 3.35Å; L45-T48 WeakPolarHBondContact CA-OG1 3.41Å; L45-G49 PolarHBondContact O-N 3.01Å
46	G	56.2	Low	56.2	Low	47 Å²	47	117.6 Å²	117.6	49%	0.485	63%	0.628	S	S	.	*	H	α-helix	trans	-84.9	-33.6	176.6	0	0	0	0	0	113.4	R42 E43 G49	R42-G46 WeakPolarHBondContact O-CA 3.49Å; R42-G46 PolarHBondContact O-N 3.5Å; E43-G46 PolarHBondContact O-N 3.46Å; G46-G49 PolarHBondContact O-N 3.48Å
47	D	53.1	Low	55	Low	125 Å²	125	120.5 Å²	120.5	67%	0.668	65%	0.646	S	S	*	*	H	α-helix	trans	-85	-20.9	174.3	-136.4	-30.4	0	0	0	111.1	E43	E43-D47 WeakPolarHBondContact O-CA 3.39Å; E43-D47 WeakPolarHBondContact O-CB 3.35Å; E43-D47 PolarHBondContact O-N 3.35Å
48	T	49.1	Very low	53.9	Low	94 Å²	94	120.2 Å²	120.2	58%	0.577	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.3	-3.8	163.6	51.6	0	0	0	0	114.3	M44 L45 S50	M44-T48 HydrophobicContact CE-CG2 4.28Å; M44-T48 VanDerWaalsContact O-CB 3.31Å; M44-T48 WeakPolarHBondContact O-CB 3.24Å; M44-T48 WeakPolarHBondContact O-CG2 3.33Å; M44-T48 PolarHBondContact O-N 2.92Å; M44-T48 VanDerWaalsContact O-N 3.1Å; M44-T48 PolarHBondContact O-OG1 2.92Å; L45-T48 WeakPolarHBondContact CA-OG1 3.41Å; T48-S50 VanDerWaalsContact C-N 3.29Å
49	G	47.6	Very low	53.1	Low	62 Å²	62	122.2 Å²	122.2	64%	0.639	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.4	-6.5	165.8	0	0	0	0	0	113.7	L45 G46	L45-G49 PolarHBondContact O-N 3.01Å; G46-G49 PolarHBondContact O-N 3.48Å
50	S	48.4	Very low	51.9	Low	59 Å²	59	122.9 Å²	122.9	41%	0.413	69%	0.69	S	S	.	*			trans	-123	83.4	174.1	171.7	0	0	0	0	111.4	T48	T48-S50 VanDerWaalsContact C-N 3.29Å
51	P	48.9	Very low	51.2	Low	114 Å²	114	127.8 Å²	127.8	74%	0.74	71%	0.705	S	S	*	*	S	Bend	trans	-73.3	124.4	132.7	30.3	-21.7	0	0	0	107.1
52	Q	48.8	Very low	49.9	Very low	186 Å²	186	128.7 Å²	128.7	87%	0.869	72%	0.72	S	S	*	*			trans	106.7	61.7	168.7	-157.1	-172.1	102.6	0	0	117.2
53	A	49.3	Very low	48.6	Very low	88 Å²	88	126.5 Å²	126.5	73%	0.727	72%	0.718	S	S	*	*			trans	-144.2	17.8	143	0	0	0	0	0	113.7	T55	A53-T55 PolarHBondContact O-N 3.38Å
54	E	51.2	Low	47.6	Very low	187 Å²	187	131.4 Å²	131.4	87%	0.874	73%	0.732	S	S	*	*			trans	-80.7	97.2	150	-77.6	-137.6	100.4	0	0	107.4
55	T	47.7	Very low	46.5	Very low	134 Å²	134	132.2 Å²	132.2	82%	0.822	74%	0.743	S	S	*	*				-177.8	82.3	126.6	-52.3	0	0	0	0	108.7	A53	A53-T55 PolarHBondContact O-N 3.38Å
56	Q	35.1	Very low	45.7	Very low	178 Å²	178	130.6 Å²	130.6	83%	0.832	74%	0.743	S	S	*	*				-172.6	130.5	121.5	-111.9	-165.5	15.1	0	0	110.8	S58	Q56-S58 PolarHBondContact O-N 3Å
57	P	41.9	Very low	45.3	Very low	116 Å²	116	134.2 Å²	134.2	75%	0.753	76%	0.758	S	S	*	*			trans	-72.6	115.5	-175.4	32.2	-32.8	0	0	0	109.2	E59	P57-E59 PolarHBondContact O-N 3.02Å
58	S	42.1	Very low	45	Very low	128 Å²	128	133.7 Å²	133.7	90%	0.895	76%	0.762	S	S	*	*			trans	-84	57.1	171.5	-140.4	0	0	0	0	110.1	Q56	Q56-S58 PolarHBondContact O-N 3Å
59	E	46.5	Very low	45.4	Very low	176 Å²	176	134.9 Å²	134.9	82%	0.822	77%	0.771	S	S	*	*			trans	-141.8	80.6	167.6	-70	-159.4	113.5	0	0	108.8	P57	P57-E59 PolarHBondContact O-N 3.02Å
60	S	41.8	Very low	45.4	Very low	121 Å²	121	137.4 Å²	137.4	85%	0.846	78%	0.776	S	S	*	*	S	Bend	trans	170.4	125.3	140.1	-83.2	0	0	0	0	111.6
61	R	45	Very low	45.7	Very low	238 Å²	238	145.8 Å²	145.8	90%	0.898	80%	0.799	S	S	*	*			trans	74.1	92.5	150	-157.6	178.2	-164.4	-145	3.5	117.2
62	S	38	Very low	45.7	Very low	122 Å²	122	149.2 Å²	149.2	85%	0.853	81%	0.805	S	S	*	*			trans	-145.2	59.4	140.9	-139.9	0	0	0	0	111.2
63	E	41.7	Very low	46	Very low	147 Å²	147	150.6 Å²	150.6	69%	0.687	80%	0.802	S	S	*	*			trans	-75.3	134.3	141.4	-171.6	177.2	104.2	0	0	107
64	R	45.2	Very low	45.9	Very low	196 Å²	196	151.8 Å²	151.8	74%	0.74	80%	0.802	S	S	*	*	S	Bend	trans	79.4	109.9	173	-77.3	179.1	-161.5	118	16.5	119.1
65	T	39	Very low	45.7	Very low	123 Å²	123	151.1 Å²	151.1	76%	0.755	80%	0.796	S	S	*	*				75.2	97.1	123.7	-57.5	0	0	0	0	116.5
66	S	44.3	Very low	45.8	Very low	102 Å²	102	151.6 Å²	151.6	71%	0.713	80%	0.799	S	S	*	*			trans	32.8	117.3	131.4	-166	0	0	0	0	118.2
67	P	46.9	Very low	46.3	Very low	122 Å²	122	147.6 Å²	147.6	79%	0.792	80%	0.797	S	S	*	*			trans	-114.2	129.3	156.7	33.9	-21.6	0	0	0	112.2
68	P	47.1	Very low	46.8	Very low	115 Å²	115	153.8 Å²	153.8	75%	0.747	81%	0.805	S	S	*	*			trans	-86.3	166.9	156.3	34.5	-27.3	0	0	0	111.3
69	P	57.7	Low	47.3	Very low	118 Å²	118	156.6 Å²	156.6	77%	0.766	80%	0.804	S	S	*	*			trans	-94.5	178.1	-152.6	40.2	-35.9	0	0	0	113.3
70	P	48	Very low	47.2	Very low	115 Å²	115	159.3 Å²	159.3	75%	0.747	81%	0.807	S	S	*	*				-151.2	150.9	96.8	35.6	-16.1	0	0	0	116.7
71	R	54.7	Low	47.4	Very low	236 Å²	236	158.5 Å²	158.5	89%	0.891	81%	0.808	S	S	*	*			trans	33.1	114.5	142.4	-74	174.1	159.6	178.7	-5.4	118.5
72	Q	48.5	Very low	47.6	Very low	186 Å²	186	152.6 Å²	152.6	87%	0.869	80%	0.798	S	S	*	*				-168.1	107.9	111.8	-106.3	173.3	-3	0	0	111.8
73	R	54.4	Low	48.6	Very low	214 Å²	214	152.4 Å²	152.4	81%	0.808	79%	0.794	S	S	*	*			trans	-77	125.3	157.7	179.9	-177.5	-178.4	-172.9	0.2	107	K75	R73-K75 HydrophobicContact CG-CB 4.39Å
74	P	47.7	Very low	48.9	Very low	114 Å²	114	150.1 Å²	150.1	74%	0.74	79%	0.792	S	S	*	*				-129.7	102.6	128.5	11.1	9.9	0	0	0	108.8	T76	P74-T76 PolarHBondContact O-N 2.95Å
75	K	45.7	Very low	48.9	Very low	172 Å²	172	148 Å²	148	75%	0.748	80%	0.795	S	S	*	*			trans	-72	109.9	172.3	-139.6	171.2	-175	178.6	0	106.4	R73 A77	R73-K75 HydrophobicContact CG-CB 4.39Å; K75-A77 PolarHBondContact O-N 3.34Å
76	T	50.5	Low	49.3	Very low	144 Å²	144	147.5 Å²	147.5	88%	0.883	80%	0.797	S	S	*	*			trans	-52.5	96.8	174.1	14.4	0	0	0	0	110.8	P74 R78	P74-T76 PolarHBondContact O-N 2.95Å; T76-R78 VanDerWaalsContact C-N 3.34Å; T76-R78 PolarHBondContact O-N 3.33Å
77	A	46.1	Very low	49.8	Very low	95 Å²	95	149 Å²	149	79%	0.785	80%	0.802	S	S	*	*			trans	-81	87.4	164.5	0	0	0	0	0	108.1	K75 Q79	K75-A77 PolarHBondContact O-N 3.34Å; A77-Q79 PolarHBondContact O-N 3.32Å
78	R	51.2	Low	49.8	Very low	245 Å²	245	153 Å²	153	93%	0.925	82%	0.824	S	S	*	*			trans	24.3	89.6	144.5	-145.7	178.2	-169.5	-172.3	2.4	114.7	T76	T76-R78 VanDerWaalsContact C-N 3.34Å; T76-R78 PolarHBondContact O-N 3.33Å
79	Q	53.9	Low	49.9	Very low	188 Å²	188	155 Å²	155	88%	0.879	83%	0.828	S	S	*	*			trans	-56.5	141.8	162.5	-83.6	-179.8	-46	0	0	110.8	A77	A77-Q79 PolarHBondContact O-N 3.32Å
80	R	43.9	Very low	49.5	Very low	232 Å²	232	156.9 Å²	156.9	88%	0.875	83%	0.831	S	S	*	*			trans	90.7	97	142	-145.8	173.8	-151.7	175.1	4.4	118
81	A	45.8	Very low	49.6	Very low	104 Å²	104	159.2 Å²	159.2	86%	0.86	84%	0.836	S	S	*	*			trans	-135	136.6	137.5	0	0	0	0	0	108.3
82	V	48.5	Very low	49.3	Very low	115 Å²	115	154.7 Å²	154.7	70%	0.697	83%	0.833	S	S	*	*			trans	-82.4	148.6	-163.2	167.8	0	0	0	0	112.2
83	P	60.3	Low	49.4	Very low	117 Å²	117	152.8 Å²	152.8	76%	0.76	83%	0.831	S	S	*	*			trans	-86.5	140.5	167.6	35.1	-30.2	0	0	0	110.9
84	P	48.2	Very low	49	Very low	100 Å²	100	148.7 Å²	148.7	65%	0.649	83%	0.832	S	S	*	*				-147.3	163	125.5	33.9	-17	0	0	0	113.7
85	N	45.8	Very low	49.1	Very low	151 Å²	151	151.1 Å²	151.1	81%	0.807	84%	0.839	S	S	*	*			trans	66	139.9	162.5	69.4	38.2	0	0	0	118.2
86	S	46.7	Very low	49.4	Very low	113 Å²	113	149.5 Å²	149.5	79%	0.79	85%	0.846	S	S	*	*			cis	-153.7	144.6	30.5	39.7	0	0	0	0	113.8
87	T	54.9	Low	49.3	Very low	134 Å²	134	150 Å²	150	82%	0.822	84%	0.843	S	S	*	*			trans	-56	135.8	161.1	-51	0	0	0	0	113
88	T	46.5	Very low	49.6	Very low	206 Å²	206	155 Å²	155	100%	1.264	85%	0.848	S	S	*	*			trans	153.8	0	134.5	-62.3	0	0	0	0	109.6

Retrieved 88 of 88 residues in 186.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).