A0A060XTC6_ONCMY Loading...

Small integral membrane protein 20

AlphaFold DB , UniProt , Accession A0A060XTC6, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 67 aa.

						>A0A060XTC6_ONCMY|A0A060XTC6
MSRNRRITLIFGGFITAVAAAFYPIFFHPLTHTADYNQVQRANRAGINQADVQPVGVKVWSDPYKPK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.3	Low	88.6	Confident	222 Å²	222	142.4 Å²	142.4	100%	1.094	68%	0.678	S	S	*	*				0	-30.5	0	-80.4	-72.6	-179.5	0	0	114.7
2	S	75.7	Confident	89.4	Confident	105 Å²	105	133.3 Å²	133.3	73%	0.734	65%	0.649	S	S	*	*	H	α-helix	trans	-74.3	-33.8	-172.7	65.1	0	0	0	0	116.3	R6	S2-R6 PolarHBondContact O-N 3.35Å
3	R	79.4	Confident	90.1	Very high	199 Å²	199	126.2 Å²	126.2	75%	0.751	63%	0.633	S	S	*	*	H	α-helix	trans	-66.7	-44.7	-175.6	-169.3	175.9	-67.7	-132.4	1.2	112.7	R5 R6 I7	R3-R5 PolarHBondContact O-N 3.42Å; R3-R6 PolarHBondContact O-N 3.11Å; R3-I7 HydrophobicContact CG-CD1 4.34Å; R3-I7 WeakPolarHBondContact O-CG1 3.3Å; R3-I7 PolarHBondContact O-N 3.09Å; R3-I7 VanDerWaalsContact O-N 3.15Å
4	N	89.4	Confident	90.7	Very high	117 Å²	117	126.2 Å²	126.2	63%	0.626	63%	0.627	S	S	*	*	H	α-helix	trans	-66.5	-40.2	180	-62.2	4.4	0	0	0	110.9	R6 I7 T8	N4-R6 VanDerWaalsContact C-N 3.34Å; N4-R6 PolarHBondContact O-N 2.93Å; N4-I7 PolarHBondContact O-N 3.08Å; N4-T8 PolarHBondContact O-N 3.27Å; N4-T8 PolarHBondContact O-OG1 3.35Å
5	R	94.1	Very high	91.2	Very high	188 Å²	188	123.3 Å²	123.3	71%	0.709	61%	0.613	S	S	*	*	H	α-helix	trans	-59.9	-42.3	175.5	-170.2	179.2	-177.8	-166.6	0.9	112.2	R3 T8 L9	R3-R5 PolarHBondContact O-N 3.42Å; R5-T8 PolarHBondContact O-N 3.06Å; R5-L9 HydrophobicContact CG-CD1 4.27Å; R5-L9 VanDerWaalsContact O-CG 3.3Å; R5-L9 WeakPolarHBondContact O-CG 3.25Å; R5-L9 PolarHBondContact O-N 3.2Å
6	R	92.5	Very high	91.6	Very high	182 Å²	182	121.6 Å²	121.6	69%	0.687	61%	0.612	S	S	*	*	H	α-helix	trans	-62.7	-44	176.7	-176.1	177.2	179.1	-177.3	-0.4	111.7	S2 R3 N4 L9 I10	S2-R6 PolarHBondContact O-N 3.35Å; R3-R6 PolarHBondContact O-N 3.11Å; N4-R6 VanDerWaalsContact C-N 3.34Å; N4-R6 PolarHBondContact O-N 2.93Å; R6-L9 PolarHBondContact O-N 3.19Å; R6-I10 HydrophobicContact CG-CD1 3.84Å; R6-I10 VanDerWaalsContact O-CG1 3.32Å; R6-I10 WeakPolarHBondContact O-CG1 3.25Å; R6-I10 PolarHBondContact O-N 3.34Å
7	I	95.3	Very high	92	Very high	101 Å²	101	117.9 Å²	117.9	52%	0.518	60%	0.604	S	S	.	*	H	α-helix	trans	-63	-46.9	178.3	-66.6	167.8	0	0	0	110.4	R3 N4 L9 I10 F11	R3-I7 HydrophobicContact CG-CD1 4.34Å; R3-I7 WeakPolarHBondContact O-CG1 3.3Å; R3-I7 PolarHBondContact O-N 3.09Å; R3-I7 VanDerWaalsContact O-N 3.15Å; N4-I7 PolarHBondContact O-N 3.08Å; I7-L9 VanDerWaalsContact C-N 3.31Å; I7-L9 PolarHBondContact O-N 3.24Å; I7-I10 PolarHBondContact O-N 2.96Å; I7-F11 WeakPolarHBondContact O-CB 3.29Å; I7-F11 PolarHBondContact O-N 2.99Å
8	T	96.4	Very high	92.4	Very high	100 Å²	100	114.1 Å²	114.1	61%	0.613	59%	0.588	S	S	*	*	H	α-helix	trans	-58.2	-42.8	177.4	-56.8	0	0	0	0	112.1	N4 R5 G12	N4-T8 PolarHBondContact O-N 3.27Å; N4-T8 PolarHBondContact O-OG1 3.35Å; R5-T8 PolarHBondContact O-N 3.06Å; T8-G12 WeakPolarHBondContact O-CA 3.31Å; T8-G12 PolarHBondContact O-N 3.29Å
9	L	96.9	Very high	92.6	Very high	116 Å²	116	111.1 Å²	111.1	61%	0.607	58%	0.582	S	S	*	*	H	α-helix	trans	-67.3	-43.7	179.4	-72	171.7	0	0	0	112.4	R5 R6 I7 G13	R5-L9 HydrophobicContact CG-CD1 4.27Å; R5-L9 VanDerWaalsContact O-CG 3.3Å; R5-L9 WeakPolarHBondContact O-CG 3.25Å; R5-L9 PolarHBondContact O-N 3.2Å; R6-L9 PolarHBondContact O-N 3.19Å; I7-L9 VanDerWaalsContact C-N 3.31Å; I7-L9 PolarHBondContact O-N 3.24Å; L9-G13 PolarHBondContact O-N 3.32Å
10	I	96.4	Very high	92.9	Very high	106 Å²	106	108.7 Å²	108.7	54%	0.544	58%	0.579	S	S	.	*	H	α-helix	trans	-64.9	-49.3	179	-68.2	169.4	0	0	0	110	R6 I7 G13 F14	R6-I10 HydrophobicContact CG-CD1 3.84Å; R6-I10 VanDerWaalsContact O-CG1 3.32Å; R6-I10 WeakPolarHBondContact O-CG1 3.25Å; R6-I10 PolarHBondContact O-N 3.34Å; I7-I10 PolarHBondContact O-N 2.96Å; I10-G13 PolarHBondContact O-N 3.1Å; I10-F14 WeakPolarHBondContact O-CB 3.45Å; I10-F14 PolarHBondContact O-N 3.19Å
11	F	97.6	Very high	93.1	Very high	130 Å²	130	106.6 Å²	106.6	57%	0.57	58%	0.576	S	S	*	*	H	α-helix	trans	-68.5	-43.9	-177.4	-165.7	-97.1	0	0	0	111.7	I7 G13 F14 I15	I7-F11 WeakPolarHBondContact O-CB 3.29Å; I7-F11 PolarHBondContact O-N 2.99Å; F11-G13 VanDerWaalsContact C-N 3.34Å; F11-G13 PolarHBondContact O-N 3.19Å; F11-F14 PolarHBondContact O-N 3.5Å; F11-I15 HydrophobicContact CD1-CG1 4.05Å; F11-I15 HydrophobicContact CE1-CD1 4.15Å; F11-I15 HydrophobicContact CE1-CG1 3.75Å; F11-I15 HydrophobicContact CZ-CD1 4.12Å; F11-I15 HydrophobicContact CZ-CG1 4.19Å; F11-I15 WeakPolarHBondContact O-CG1 3.45Å; F11-I15 PolarHBondContact O-N 2.91Å
12	G	98	Very high	94.9	Very high	33 Å²	33	100.5 Å²	100.5	34%	0.34	54%	0.544	S	S	.	.	H	α-helix	trans	-61.9	-41.8	175.4	0	0	0	0	0	112.4	T8 I15 T16	T8-G12 WeakPolarHBondContact O-CA 3.31Å; T8-G12 PolarHBondContact O-N 3.29Å; G12-I15 PolarHBondContact O-N 3.33Å; G12-T16 WeakPolarHBondContact O-CB 3.27Å; G12-T16 PolarHBondContact O-N 2.92Å; G12-T16 PolarHBondContact O-OG1 3.48Å
13	G	98	Very high	95.8	Very high	42 Å²	42	101.3 Å²	101.3	43%	0.433	53%	0.532	S	S	.	.	H	α-helix	trans	-62.5	-43.3	174.6	0	0	0	0	0	112.2	L9 I10 F11 T16 A17	L9-G13 PolarHBondContact O-N 3.32Å; I10-G13 PolarHBondContact O-N 3.1Å; F11-G13 VanDerWaalsContact C-N 3.34Å; F11-G13 PolarHBondContact O-N 3.19Å; G13-T16 PolarHBondContact O-N 3.04Å; G13-A17 WeakPolarHBondContact O-CB 3.42Å; G13-A17 PolarHBondContact O-N 3.08Å
14	F	98.3	Very high	96.6	Very high	126 Å²	126	95.2 Å²	95.2	55%	0.553	52%	0.518	S	S	*	.	H	α-helix	trans	-61.3	-50.3	176.3	177.6	-104.9	0	0	0	112.1	I10 F11 T16 A17 V18	I10-F14 WeakPolarHBondContact O-CB 3.45Å; I10-F14 PolarHBondContact O-N 3.19Å; F11-F14 PolarHBondContact O-N 3.5Å; F14-T16 VanDerWaalsContact C-N 3.28Å; F14-T16 PolarHBondContact O-N 3.34Å; F14-A17 PolarHBondContact O-N 3.26Å; F14-A17 VanDerWaalsContact O-N 3.16Å; F14-V18 HydrophobicContact CD1-CG2 4.33Å; F14-V18 HydrophobicContact CD2-CG2 4.42Å; F14-V18 HydrophobicContact CE1-CG2 3.92Å; F14-V18 HydrophobicContact CE2-CG2 4.01Å; F14-V18 HydrophobicContact CZ-CG2 3.74Å; F14-V18 WeakPolarHBondContact O-CG2 3.26Å; F14-V18 PolarHBondContact O-N 2.9Å
15	I	98.3	Very high	96.9	Very high	82 Å²	82	94.7 Å²	94.7	42%	0.421	51%	0.514	S	S	.	.	H	α-helix	trans	-61.5	-39.2	177.9	-63.5	-60.9	0	0	0	111.2	F11 G12 V18 A19	F11-I15 HydrophobicContact CD1-CG1 4.05Å; F11-I15 HydrophobicContact CE1-CD1 4.15Å; F11-I15 HydrophobicContact CE1-CG1 3.75Å; F11-I15 HydrophobicContact CZ-CD1 4.12Å; F11-I15 HydrophobicContact CZ-CG1 4.19Å; F11-I15 WeakPolarHBondContact O-CG1 3.45Å; F11-I15 PolarHBondContact O-N 2.91Å; G12-I15 PolarHBondContact O-N 3.33Å; I15-V18 PolarHBondContact O-N 3.49Å; I15-A19 WeakPolarHBondContact O-CB 3.23Å; I15-A19 PolarHBondContact O-N 3.4Å
16	T	98.2	Very high	96.8	Very high	96 Å²	96	91.2 Å²	91.2	59%	0.589	50%	0.504	S	S	*	.	H	α-helix	trans	-61.2	-45.6	175.1	-58.2	0	0	0	0	111.4	G12 G13 F14 V18 A19 A20	G12-T16 WeakPolarHBondContact O-CB 3.27Å; G12-T16 PolarHBondContact O-N 2.92Å; G12-T16 PolarHBondContact O-OG1 3.48Å; G13-T16 PolarHBondContact O-N 3.04Å; F14-T16 VanDerWaalsContact C-N 3.28Å; F14-T16 PolarHBondContact O-N 3.34Å; T16-V18 VanDerWaalsContact C-N 3.34Å; T16-V18 PolarHBondContact O-N 2.94Å; T16-A19 PolarHBondContact O-N 3.43Å; T16-A20 WeakPolarHBondContact O-CB 3.37Å; T16-A20 PolarHBondContact O-N 3.23Å
17	A	98.3	Very high	96.9	Very high	59 Å²	59	88.3 Å²	88.3	49%	0.488	50%	0.497	S	S	.	.	H	α-helix	trans	-62.5	-42.2	177.6	0	0	0	0	0	111.7	G13 F14 A20 A21	G13-A17 WeakPolarHBondContact O-CB 3.42Å; G13-A17 PolarHBondContact O-N 3.08Å; F14-A17 PolarHBondContact O-N 3.26Å; F14-A17 VanDerWaalsContact O-N 3.16Å; A17-A20 PolarHBondContact O-N 2.91Å; A17-A21 WeakPolarHBondContact O-CB 3.19Å; A17-A21 PolarHBondContact O-N 3.42Å
18	V	98.3	Very high	96.9	Very high	50 Å²	50	86.4 Å²	86.4	30%	0.303	49%	0.485	S	S	.	.	H	α-helix	trans	-61.2	-50	175.7	170.9	0	0	0	0	110.7	F14 I15 T16 A20 A21 F22	F14-V18 HydrophobicContact CD1-CG2 4.33Å; F14-V18 HydrophobicContact CD2-CG2 4.42Å; F14-V18 HydrophobicContact CE1-CG2 3.92Å; F14-V18 HydrophobicContact CE2-CG2 4.01Å; F14-V18 HydrophobicContact CZ-CG2 3.74Å; F14-V18 WeakPolarHBondContact O-CG2 3.26Å; F14-V18 PolarHBondContact O-N 2.9Å; I15-V18 PolarHBondContact O-N 3.49Å; T16-V18 VanDerWaalsContact C-N 3.34Å; T16-V18 PolarHBondContact O-N 2.94Å; V18-A20 VanDerWaalsContact C-N 3.33Å; V18-A20 PolarHBondContact O-N 3.21Å; V18-A21 PolarHBondContact O-N 2.9Å; V18-F22 HydrophobicContact CG1-CD2 3.55Å; V18-F22 HydrophobicContact CG1-CE2 3.58Å; V18-F22 WeakPolarHBondContact O-CD2 3.21Å; V18-F22 PolarHBondContact O-N 3.31Å
19	A	97.6	Very high	96.7	Very high	57 Å²	57	83.1 Å²	83.1	47%	0.471	47%	0.466	S	S	.	.	H	α-helix	trans	-60.8	-42.1	178.8	0	0	0	0	0	112.1	I15 T16 F22 Y23	I15-A19 WeakPolarHBondContact O-CB 3.23Å; I15-A19 PolarHBondContact O-N 3.4Å; T16-A19 PolarHBondContact O-N 3.43Å; A19-F22 PolarHBondContact O-N 3.44Å; A19-Y23 PolarHBondContact O-N 3.03Å
20	A	97.8	Very high	96.4	Very high	63 Å²	63	84 Å²	84	52%	0.521	47%	0.471	S	S	.	.	H	α-helix	trans	-62.1	-43.2	176.4	0	0	0	0	0	111.9	T16 A17 V18 F22 Y23	T16-A20 WeakPolarHBondContact O-CB 3.37Å; T16-A20 PolarHBondContact O-N 3.23Å; A17-A20 PolarHBondContact O-N 2.91Å; V18-A20 VanDerWaalsContact C-N 3.33Å; V18-A20 PolarHBondContact O-N 3.21Å; A20-F22 VanDerWaalsContact C-N 3.3Å; A20-F22 PolarHBondContact O-N 2.95Å; A20-Y23 WeakPolarHBondContact O-CB 3.3Å; A20-Y23 PolarHBondContact O-N 3.36Å
21	A	97.8	Very high	96.4	Very high	64 Å²	64	83.2 Å²	83.2	53%	0.529	47%	0.471	S	S	.	.	H	α-helix	trans	-64.5	-34.2	176.4	0	0	0	0	0	112.6	A17 V18 P24	A17-A21 WeakPolarHBondContact O-CB 3.19Å; A17-A21 PolarHBondContact O-N 3.42Å; V18-A21 PolarHBondContact O-N 2.9Å; A21-P24 WeakPolarHBondContact O-CD 3.4Å
22	F	97.8	Very high	96.2	Very high	95 Å²	95	80.4 Å²	80.4	42%	0.417	46%	0.459	S	S	.	.	H	α-helix	trans	-82.2	-16.8	179.1	-82.5	-59.5	0	0	0	114.6	V18 A19 A20 I25 F26	V18-F22 HydrophobicContact CG1-CD2 3.55Å; V18-F22 HydrophobicContact CG1-CE2 3.58Å; V18-F22 WeakPolarHBondContact O-CD2 3.21Å; V18-F22 PolarHBondContact O-N 3.31Å; A19-F22 PolarHBondContact O-N 3.44Å; A20-F22 VanDerWaalsContact C-N 3.3Å; A20-F22 PolarHBondContact O-N 2.95Å; F22-I25 HydrophobicContact CD1-CD1 4.02Å; F22-I25 HydrophobicContact CE1-CD1 4.4Å; F22-I25 PolarHBondContact O-N 3.49Å; F22-F26 HydrophobicContact CB-CD2 4.07Å; F22-F26 AromaticContact CD1-CD2 3.72Å; F22-F26 HydrophobicContact CD1-CD2 3.72Å; F22-F26 AromaticContact CD1-CE2 3.37Å; F22-F26 HydrophobicContact CD1-CE2 3.37Å; F22-F26 AromaticContact CE1-CE2 3.78Å; F22-F26 HydrophobicContact CE1-CE2 3.78Å; F22-F26 HydrophobicContact CG-CD2 4.18Å; F22-F26 HydrophobicContact CG-CE2 4.12Å; F22-F26 PolarHBondContact O-N 3.32Å
23	Y	96.5	Very high	96	Very high	122 Å²	122	82.5 Å²	82.5	48%	0.478	47%	0.466	S	S	.	.	I	π-helix	trans	-51	-52	178.9	-172.6	-91.1	0	0	0	114	A19 A20 I25 F27 H28	A19-Y23 PolarHBondContact O-N 3.03Å; A20-Y23 WeakPolarHBondContact O-CB 3.3Å; A20-Y23 PolarHBondContact O-N 3.36Å; Y23-I25 PolarHBondContact O-N 3.12Å; Y23-F27 HydrophobicContact CD2-CB 3.82Å; Y23-F27 HydrophobicContact CD2-CD2 4.31Å; Y23-F27 HydrophobicContact CD2-CG 4.26Å; Y23-F27 HydrophobicContact CE2-CB 3.84Å; Y23-F27 HydrophobicContact CG-CB 4.41Å; Y23-F27 PolarHBondContact O-N 3.21Å; Y23-H28 HydrophobicContact CD1-CB 4.46Å; Y23-H28 HydrophobicContact CE1-CB 4.23Å; Y23-H28 PolarHBondContact O-N 3.36Å
24	P	95.6	Very high	95.8	Very high	71 Å²	71	83.7 Å²	83.7	46%	0.461	47%	0.472	S	S	.	.	I	π-helix	trans	-69.8	-15.7	179.4	28.4	-36.7	0	0	0	114.2	A21 P29	A21-P24 WeakPolarHBondContact O-CD 3.4Å; P24-P29 WeakPolarHBondContact O-CD 3.45Å; P24-P29 WeakPolarHBondContact O-CG 3.34Å
25	I	94.6	Very high	95.6	Very high	105 Å²	105	81.8 Å²	81.8	54%	0.538	47%	0.467	S	S	.	.	I	π-helix	trans	-89.4	-44	-176.3	-58.4	173.7	0	0	0	110.8	F22 Y23 P29	F22-I25 HydrophobicContact CD1-CD1 4.02Å; F22-I25 HydrophobicContact CE1-CD1 4.4Å; F22-I25 PolarHBondContact O-N 3.49Å; Y23-I25 PolarHBondContact O-N 3.12Å; I25-P29 WeakPolarHBondContact O-CG 3.12Å
26	F	93.1	Very high	95.2	Very high	115 Å²	115	82 Å²	82	50%	0.504	46%	0.463	S	S	.	.	I	π-helix	trans	-104.8	-52.2	-175.6	-68.4	-68.2	0	0	0	112.7	F22 L30	F22-F26 HydrophobicContact CB-CD2 4.07Å; F22-F26 AromaticContact CD1-CD2 3.72Å; F22-F26 HydrophobicContact CD1-CD2 3.72Å; F22-F26 AromaticContact CD1-CE2 3.37Å; F22-F26 HydrophobicContact CD1-CE2 3.37Å; F22-F26 AromaticContact CE1-CE2 3.78Å; F22-F26 HydrophobicContact CE1-CE2 3.78Å; F22-F26 HydrophobicContact CG-CD2 4.18Å; F22-F26 HydrophobicContact CG-CE2 4.12Å; F22-F26 PolarHBondContact O-N 3.32Å; F26-L30 WeakPolarHBondContact O-CB 3.47Å; F26-L30 WeakPolarHBondContact O-CD1 3.4Å; F26-L30 WeakPolarHBondContact O-CG 3.38Å
27	F	94.9	Very high	94.9	Very high	122 Å²	122	81 Å²	81	54%	0.535	45%	0.454	S	S	.	.	I	π-helix	trans	-82.6	-44.4	-167.3	-66	-85	0	0	0	112.3	Y23 L30 T31	Y23-F27 HydrophobicContact CD2-CB 3.82Å; Y23-F27 HydrophobicContact CD2-CD2 4.31Å; Y23-F27 HydrophobicContact CD2-CG 4.26Å; Y23-F27 HydrophobicContact CE2-CB 3.84Å; Y23-F27 HydrophobicContact CG-CB 4.41Å; Y23-F27 PolarHBondContact O-N 3.21Å; F27-L30 PolarHBondContact O-N 2.77Å; F27-T31 WeakPolarHBondContact O-CB 3.45Å; F27-T31 WeakPolarHBondContact O-CG2 3.4Å; F27-T31 PolarHBondContact O-N 3.13Å; F27-T31 PolarHBondContact O-OG1 2.95Å
28	H	94.6	Very high	94.7	Very high	60 Å²	60	84.8 Å²	84.8	28%	0.278	46%	0.462	S	S	.	.	H	α-helix	trans	-60.1	-48.1	-178.6	-170.4	-92.9	0	0	0	112.7	Y23 L30 T31 H32 Y36	Y23-H28 HydrophobicContact CD1-CB 4.46Å; Y23-H28 HydrophobicContact CE1-CB 4.23Å; Y23-H28 PolarHBondContact O-N 3.36Å; H28-L30 VanDerWaalsContact C-N 3.32Å; H28-L30 PolarHBondContact O-N 3.05Å; H28-T31 PolarHBondContact O-N 3.02Å; H28-T31 PolarHBondContact O-OG1 3.24Å; H28-T31 VanDerWaalsContact O-OG1 3.05Å; H28-H32 AromaticContact CD2-CE1 3.75Å; H28-H32 AromaticContact CD2-ND1 3.62Å; H28-H32 AromaticContact CE1-CG 3.99Å; H28-H32 AromaticContact NE2-CE1 3.78Å; H28-H32 AromaticContact NE2-CG 3.88Å; H28-H32 AromaticContact NE2-ND1 3.68Å; H28-H32 WeakPolarHBondContact O-CB 3.47Å; H28-H32 PolarHBondContact O-N 3Å; H28-H32 PolarHBondContact O-ND1 3.05Å; H28-H32 VanDerWaalsContact O-ND1 3.15Å; H28-Y36 AromaticContact CE1-CE2 3.93Å; H28-Y36 AromaticContact ND1-CE2 3.47Å; H28-Y36 WeakPolarHBondContact ND1-CE2 3.34Å; H28-Y36 AromaticContact ND1-CZ 3.76Å; H28-Y36 PolarHBondContact ND1-OH 3.04Å; H28-Y36 VanDerWaalsContact ND1-OH 3.12Å
29	P	92.3	Very high	94.4	Very high	32 Å²	32	86.3 Å²	86.3	21%	0.208	47%	0.471	C	S	.	.	H	α-helix	trans	-65.9	-34.1	-180	-19.8	34	0	0	0	113.3	P24 I25 T31 T33 Y36	P24-P29 WeakPolarHBondContact O-CD 3.45Å; P24-P29 WeakPolarHBondContact O-CG 3.34Å; I25-P29 WeakPolarHBondContact O-CG 3.12Å; P29-T31 VanDerWaalsContact C-N 3.34Å; P29-T33 PolarHBondContact O-N 3.24Å; P29-Y36 HydrophobicContact CB-CD1 4.16Å; P29-Y36 HydrophobicContact CB-CD2 4.25Å; P29-Y36 HydrophobicContact CB-CE1 3.96Å; P29-Y36 HydrophobicContact CB-CE2 4.06Å; P29-Y36 HydrophobicContact CB-CG 4.29Å; P29-Y36 HydrophobicContact CG-CE1 3.98Å; P29-Y36 HydrophobicContact CG-CE2 4.3Å
30	L	90.9	Very high	94	Very high	134 Å²	134	87.1 Å²	87.1	70%	0.702	47%	0.465	S	S	*	.	H	α-helix	trans	-74.4	-24.4	178.9	-67.3	177.2	0	0	0	113.1	F26 F27 H28 T33	F26-L30 WeakPolarHBondContact O-CB 3.47Å; F26-L30 WeakPolarHBondContact O-CD1 3.4Å; F26-L30 WeakPolarHBondContact O-CG 3.38Å; F27-L30 PolarHBondContact O-N 2.77Å; H28-L30 VanDerWaalsContact C-N 3.32Å; H28-L30 PolarHBondContact O-N 3.05Å; L30-T33 WeakPolarHBondContact O-CG2 3.49Å
31	T	95.1	Very high	93.7	Very high	90 Å²	90	93.4 Å²	93.4	55%	0.552	48%	0.475	S	S	*	.	H	α-helix	trans	-93.4	-21.4	177.5	50.4	0	0	0	0	113	F27 H28 P29	F27-T31 WeakPolarHBondContact O-CB 3.45Å; F27-T31 WeakPolarHBondContact O-CG2 3.4Å; F27-T31 PolarHBondContact O-N 3.13Å; F27-T31 PolarHBondContact O-OG1 2.95Å; H28-T31 PolarHBondContact O-N 3.02Å; H28-T31 PolarHBondContact O-OG1 3.24Å; H28-T31 VanDerWaalsContact O-OG1 3.05Å; P29-T31 VanDerWaalsContact C-N 3.34Å
32	H	94.8	Very high	93.5	Very high	71 Å²	71	93.5 Å²	93.5	33%	0.329	48%	0.477	S	S	.	.			trans	-116.4	43.6	-178.3	-62.3	73.3	0	0	0	111.5	H28 A34 D35 Y36	H28-H32 AromaticContact CD2-CE1 3.75Å; H28-H32 AromaticContact CD2-ND1 3.62Å; H28-H32 AromaticContact CE1-CG 3.99Å; H28-H32 AromaticContact NE2-CE1 3.78Å; H28-H32 AromaticContact NE2-CG 3.88Å; H28-H32 AromaticContact NE2-ND1 3.68Å; H28-H32 WeakPolarHBondContact O-CB 3.47Å; H28-H32 PolarHBondContact O-N 3Å; H28-H32 PolarHBondContact O-ND1 3.05Å; H28-H32 VanDerWaalsContact O-ND1 3.15Å; H32-A34 PolarHBondContact O-N 3.43Å; H32-A34 VanDerWaalsContact O-N 3.13Å; H32-D35 IonicContact CD2-OD2 3.88Å; H32-D35 PolarHBondContact O-N 3.25Å; H32-Y36 HydrophobicContact CB-CD2 4.29Å; H32-Y36 HydrophobicContact CB-CE2 4.34Å; H32-Y36 WeakPolarHBondContact O-CD2 3.49Å; H32-Y36 PolarHBondContact O-N 3.41Å
33	T	93.4	Very high	93.1	Very high	77 Å²	77	94.8 Å²	94.8	47%	0.472	49%	0.488	S	S	.	.	H	α-helix	trans	-58	-32.8	-172.7	55.2	0	0	0	0	113.4	P29 L30 N37	P29-T33 PolarHBondContact O-N 3.24Å; L30-T33 WeakPolarHBondContact O-CG2 3.49Å; T33-N37 WeakPolarHBondContact O-CB 3.2Å; T33-N37 PolarHBondContact O-N 2.99Å; T33-N37 PolarHBondContact O-ND2 3.49Å; T33-N37 VanDerWaalsContact O-ND2 3.08Å
34	A	94.3	Very high	92.7	Very high	67 Å²	67	96.4 Å²	96.4	55%	0.554	49%	0.493	S	S	*	.	H	α-helix	trans	-61.6	-49.1	179.1	0	0	0	0	0	112.2	H32 N37 Q38	H32-A34 PolarHBondContact O-N 3.43Å; H32-A34 VanDerWaalsContact O-N 3.13Å; A34-N37 PolarHBondContact O-N 3.36Å; A34-Q38 PolarHBondContact O-N 2.88Å
35	D	93.1	Very high	92.5	Very high	86 Å²	86	96.6 Å²	96.6	46%	0.46	50%	0.501	S	S	.	.	H	α-helix	trans	-64.3	-46.1	-178.5	-58.7	-22.9	0	0	0	110.8	H32 N37 Q38 V39	H32-D35 IonicContact CD2-OD2 3.88Å; H32-D35 PolarHBondContact O-N 3.25Å; D35-N37 VanDerWaalsContact C-N 3.32Å; D35-N37 PolarHBondContact O-N 2.99Å; D35-Q38 PolarHBondContact O-N 3.34Å; D35-V39 WeakPolarHBondContact O-CG2 3.41Å; D35-V39 PolarHBondContact O-N 3.37Å
36	Y	91.2	Very high	92.1	Very high	85 Å²	85	95.7 Å²	95.7	33%	0.333	52%	0.517	S	S	.	.	H	α-helix	trans	-65.5	-35.6	177.5	-79.7	-97.3	0	0	0	112.2	H28 P29 H32 Q40	H28-Y36 AromaticContact CE1-CE2 3.93Å; H28-Y36 AromaticContact ND1-CE2 3.47Å; H28-Y36 WeakPolarHBondContact ND1-CE2 3.34Å; H28-Y36 AromaticContact ND1-CZ 3.76Å; H28-Y36 PolarHBondContact ND1-OH 3.04Å; H28-Y36 VanDerWaalsContact ND1-OH 3.12Å; P29-Y36 HydrophobicContact CB-CD1 4.16Å; P29-Y36 HydrophobicContact CB-CD2 4.25Å; P29-Y36 HydrophobicContact CB-CE1 3.96Å; P29-Y36 HydrophobicContact CB-CE2 4.06Å; P29-Y36 HydrophobicContact CB-CG 4.29Å; P29-Y36 HydrophobicContact CG-CE1 3.98Å; P29-Y36 HydrophobicContact CG-CE2 4.3Å; H32-Y36 HydrophobicContact CB-CD2 4.29Å; H32-Y36 HydrophobicContact CB-CE2 4.34Å; H32-Y36 WeakPolarHBondContact O-CD2 3.49Å; H32-Y36 PolarHBondContact O-N 3.41Å; Y36-Q40 VanDerWaalsContact O-CB 3.3Å; Y36-Q40 WeakPolarHBondContact O-CB 3.45Å; Y36-Q40 VanDerWaalsContact O-CG 3.26Å; Y36-Q40 WeakPolarHBondContact O-CG 3.41Å; Y36-Q40 PolarHBondContact O-N 3.26Å
37	N	90.5	Very high	91.7	Very high	77 Å²	77	95 Å²	95	41%	0.412	52%	0.518	S	S	.	.	H	α-helix	trans	-65.9	-40.7	174.1	-76.7	-24.2	0	0	0	111.4	T33 A34 D35 Q40 R41	T33-N37 WeakPolarHBondContact O-CB 3.2Å; T33-N37 PolarHBondContact O-N 2.99Å; T33-N37 PolarHBondContact O-ND2 3.49Å; T33-N37 VanDerWaalsContact O-ND2 3.08Å; A34-N37 PolarHBondContact O-N 3.36Å; D35-N37 VanDerWaalsContact C-N 3.32Å; D35-N37 PolarHBondContact O-N 2.99Å; N37-Q40 PolarHBondContact O-N 3.15Å; N37-R41 WeakPolarHBondContact O-CB 3.38Å; N37-R41 VanDerWaalsContact O-CG 3.23Å; N37-R41 WeakPolarHBondContact O-CG 3.41Å; N37-R41 PolarHBondContact O-N 2.94Å
38	Q	94	Very high	91.1	Very high	137 Å²	137	93.3 Å²	93.3	64%	0.64	51%	0.514	S	S	*	.	H	α-helix	trans	-63.4	-48.3	176.4	-178	177.2	-4.7	0	0	111.4	A34 D35 Q40 R41 A42	A34-Q38 PolarHBondContact O-N 2.88Å; D35-Q38 PolarHBondContact O-N 3.34Å; Q38-Q40 VanDerWaalsContact C-N 3.33Å; Q38-Q40 PolarHBondContact O-N 3.48Å; Q38-R41 PolarHBondContact O-N 2.97Å; Q38-A42 PolarHBondContact O-N 3.16Å
39	V	91.8	Very high	90.2	Very high	83 Å²	83	96 Å²	96	50%	0.503	53%	0.527	S	S	.	.	H	α-helix	trans	-59.7	-44	176.3	171.8	0	0	0	0	110.9	D35 R41 A42 N43	D35-V39 WeakPolarHBondContact O-CG2 3.41Å; D35-V39 PolarHBondContact O-N 3.37Å; V39-R41 PolarHBondContact O-N 3.42Å; V39-A42 PolarHBondContact O-N 2.91Å; V39-N43 WeakPolarHBondContact CG1-ND2 3.46Å; V39-N43 WeakPolarHBondContact O-CB 3.38Å; V39-N43 VanDerWaalsContact O-CG 3.25Å; V39-N43 PolarHBondContact O-N 2.91Å; V39-N43 PolarHBondContact O-ND2 2.9Å
40	Q	90.2	Very high	89.5	Confident	74 Å²	74	96.6 Å²	96.6	35%	0.346	53%	0.534	S	S	.	.	H	α-helix	trans	-63.5	-40.2	176.6	-79.5	-175.8	72.4	0	0	112.9	Y36 N37 Q38 A42 N43 R44	Y36-Q40 VanDerWaalsContact O-CB 3.3Å; Y36-Q40 WeakPolarHBondContact O-CB 3.45Å; Y36-Q40 VanDerWaalsContact O-CG 3.26Å; Y36-Q40 WeakPolarHBondContact O-CG 3.41Å; Y36-Q40 PolarHBondContact O-N 3.26Å; N37-Q40 PolarHBondContact O-N 3.15Å; Q38-Q40 VanDerWaalsContact C-N 3.33Å; Q38-Q40 PolarHBondContact O-N 3.48Å; Q40-A42 VanDerWaalsContact C-N 3.34Å; Q40-N43 PolarHBondContact O-N 2.93Å; Q40-R44 VanDerWaalsContact O-CB 3.31Å; Q40-R44 WeakPolarHBondContact O-CB 3.36Å; Q40-R44 WeakPolarHBondContact O-CG 3.47Å; Q40-R44 PolarHBondContact O-N 3.37Å
41	R	90.6	Very high	89.1	Confident	194 Å²	194	96.3 Å²	96.3	73%	0.732	53%	0.533	S	S	*	.	H	α-helix	trans	-61.7	-43.6	176.3	-76	170.9	-174.5	-176.8	2.7	111.3	N37 Q38 V39 R44 A45	N37-R41 WeakPolarHBondContact O-CB 3.38Å; N37-R41 VanDerWaalsContact O-CG 3.23Å; N37-R41 WeakPolarHBondContact O-CG 3.41Å; N37-R41 PolarHBondContact O-N 2.94Å; Q38-R41 PolarHBondContact O-N 2.97Å; V39-R41 PolarHBondContact O-N 3.42Å; R41-R44 PolarHBondContact O-N 3.31Å; R41-A45 PolarHBondContact O-N 3.26Å; R41-A45 VanDerWaalsContact O-N 3.1Å
42	A	94.4	Very high	88.4	Confident	67 Å²	67	97.3 Å²	97.3	55%	0.554	54%	0.539	S	S	*	.	H	α-helix	trans	-64	-47.3	176.2	0	0	0	0	0	111.6	Q38 V39 Q40 R44 A45	Q38-A42 PolarHBondContact O-N 3.16Å; V39-A42 PolarHBondContact O-N 2.91Å; Q40-A42 VanDerWaalsContact C-N 3.34Å; A42-R44 VanDerWaalsContact C-N 3.28Å; A42-R44 PolarHBondContact O-N 2.83Å; A42-A45 VanDerWaalsContact O-CB 3.27Å; A42-A45 WeakPolarHBondContact O-CB 3.35Å; A42-A45 PolarHBondContact O-N 3.46Å
43	N	90	Very high	87.7	Confident	121 Å²	121	95.4 Å²	95.4	65%	0.647	53%	0.53	S	S	*	.	H	α-helix	trans	-67.6	-25.6	-179.4	-70	-21.7	0	0	0	113.7	V39 Q40	V39-N43 WeakPolarHBondContact CG1-ND2 3.46Å; V39-N43 WeakPolarHBondContact O-CB 3.38Å; V39-N43 VanDerWaalsContact O-CG 3.25Å; V39-N43 PolarHBondContact O-N 2.91Å; V39-N43 PolarHBondContact O-ND2 2.9Å; Q40-N43 PolarHBondContact O-N 2.93Å
44	R	87.9	Confident	87.1	Confident	157 Å²	157	96.1 Å²	96.1	59%	0.592	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.1	5.7	176.7	-65.7	-174.6	177.1	134.4	4.5	113.4	Q40 R41 A42 G46 I47	Q40-R44 VanDerWaalsContact O-CB 3.31Å; Q40-R44 WeakPolarHBondContact O-CB 3.36Å; Q40-R44 WeakPolarHBondContact O-CG 3.47Å; Q40-R44 PolarHBondContact O-N 3.37Å; R41-R44 PolarHBondContact O-N 3.31Å; A42-R44 VanDerWaalsContact C-N 3.28Å; A42-R44 PolarHBondContact O-N 2.83Å; R44-G46 PolarHBondContact O-N 2.76Å; R44-I47 HydrophobicContact CB-CD1 4.38Å; R44-I47 HydrophobicContact CG-CD1 4.38Å; R44-I47 PolarHBondContact O-N 2.95Å
45	A	91	Very high	86.4	Confident	75 Å²	75	100.1 Å²	100.1	62%	0.62	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.4	130.2	177.2	0	0	0	0	0	109.9	R41 A42 I47	R41-A45 PolarHBondContact O-N 3.26Å; R41-A45 VanDerWaalsContact O-N 3.1Å; A42-A45 VanDerWaalsContact O-CB 3.27Å; A42-A45 WeakPolarHBondContact O-CB 3.35Å; A42-A45 PolarHBondContact O-N 3.46Å; A45-I47 VanDerWaalsContact C-N 3.26Å; A45-I47 PolarHBondContact O-N 3.36Å
46	G	86.1	Confident	85.6	Confident	85 Å²	85	100.2 Å²	100.2	88%	0.876	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	78.9	-1.8	179.7	0	0	0	0	0	115.6	R44 N48	R44-G46 PolarHBondContact O-N 2.76Å; G46-N48 PolarHBondContact O-N 3.37Å
47	I	85.4	Confident	84.8	Confident	102 Å²	102	100 Å²	100	52%	0.523	58%	0.582	S	S	.	*			trans	-78	105	171.4	-58.8	-177.4	0	0	0	108.6	R44 A45 Q49 V52	R44-I47 HydrophobicContact CB-CD1 4.38Å; R44-I47 HydrophobicContact CG-CD1 4.38Å; R44-I47 PolarHBondContact O-N 2.95Å; A45-I47 VanDerWaalsContact C-N 3.26Å; A45-I47 PolarHBondContact O-N 3.36Å; I47-Q49 PolarHBondContact O-N 2.89Å; I47-V52 HydrophobicContact CG2-CG2 3.69Å
48	N	81.4	Confident	84.1	Confident	86 Å²	86	104.9 Å²	104.9	46%	0.46	60%	0.6	S	S	.	*			trans	-77	111.4	166.5	178.1	9	0	0	0	108.9	G46 A50 D51	G46-N48 PolarHBondContact O-N 3.37Å; N48-A50 PolarHBondContact O-N 3.02Å; N48-A50 VanDerWaalsContact O-N 3.08Å; N48-A50 PolarHBondContact OD1-N 3.5Å; N48-D51 HydrophobicContact CB-CB 4.46Å; N48-D51 VanDerWaalsContact CB-OD2 3.25Å; N48-D51 WeakPolarHBondContact CB-OD2 3.46Å; N48-D51 VanDerWaalsContact ND2-CG 3.33Å; N48-D51 PolarHBondContact ND2-OD1 2.91Å; N48-D51 PolarHBondContact ND2-OD2 3.44Å; N48-D51 PolarHBondContact O-N 3.15Å
49	Q	75.3	Confident	83.2	Confident	116 Å²	116	101.8 Å²	101.8	54%	0.542	59%	0.59	S	S	.	*	H	α-helix	trans	-61.9	-21	-174.4	-158.5	-177.6	-17.2	0	0	113.2	I47 D51 Q53	I47-Q49 PolarHBondContact O-N 2.89Å; Q49-D51 VanDerWaalsContact C-N 3.33Å; Q49-Q53 VanDerWaalsContact O-CG 3.3Å; Q49-Q53 WeakPolarHBondContact O-CG 3.37Å; Q49-Q53 PolarHBondContact O-NE2 3.31Å
50	A	78	Confident	82.1	Confident	44 Å²	44	107.5 Å²	107.5	36%	0.364	60%	0.603	S	S	.	*	H	α-helix	trans	-69.6	-31	173.7	0	0	0	0	0	112.5	N48 V59	N48-A50 PolarHBondContact O-N 3.02Å; N48-A50 VanDerWaalsContact O-N 3.08Å; N48-A50 PolarHBondContact OD1-N 3.5Å; A50-V59 HydrophobicContact CB-CG2 4.07Å
51	D	82.3	Confident	81	Confident	128 Å²	128	108.4 Å²	108.4	68%	0.684	62%	0.617	S	S	*	*	H	α-helix	trans	-83.7	-21.6	-174	-58.7	-20.7	0	0	0	112.4	N48 Q49	N48-D51 HydrophobicContact CB-CB 4.46Å; N48-D51 VanDerWaalsContact CB-OD2 3.25Å; N48-D51 WeakPolarHBondContact CB-OD2 3.46Å; N48-D51 VanDerWaalsContact ND2-CG 3.33Å; N48-D51 PolarHBondContact ND2-OD1 2.91Å; N48-D51 PolarHBondContact ND2-OD2 3.44Å; N48-D51 PolarHBondContact O-N 3.15Å; Q49-D51 VanDerWaalsContact C-N 3.33Å
52	V	81.1	Confident	80	Confident	111 Å²	111	103.3 Å²	103.3	67%	0.673	60%	0.604	S	S	*	*	H	α-helix	trans	-83.3	-23.5	174.7	-178.8	0	0	0	0	111.5	I47	I47-V52 HydrophobicContact CG2-CG2 3.69Å
53	Q	79.7	Confident	78.4	Confident	31 Å²	31	105.4 Å²	105.4	15%	0.145	61%	0.612	C	S	.	*	S	Bend	trans	-78.3	149.9	-174.4	-79.4	-178.4	66.3	0	0	112.2	Q49 V55 V59	Q49-Q53 VanDerWaalsContact O-CG 3.3Å; Q49-Q53 WeakPolarHBondContact O-CG 3.37Å; Q49-Q53 PolarHBondContact O-NE2 3.31Å; Q53-V55 PolarHBondContact O-N 3.03Å; Q53-V59 VanDerWaalsContact NE2-CG1 3.3Å
54	P	80.2	Confident	77.5	Confident	93 Å²	93	109.3 Å²	109.3	60%	0.604	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-57.4	138.2	176.4	-14.8	25.1	0	0	0	110.5	V57	P54-V57 HydrophobicContact CB-CG2 4.08Å; P54-V57 HydrophobicContact CG-CG2 4.18Å; P54-V57 VanDerWaalsContact O-CG2 3.25Å; P54-V57 WeakPolarHBondContact O-CG2 3.32Å
55	V	79.3	Confident	76.7	Confident	150 Å²	150	109.2 Å²	109.2	91%	0.909	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.1	137.9	174.9	-79	0	0	0	0	110.8	Q53	Q53-V55 PolarHBondContact O-N 3.03Å
56	G	77.3	Confident	75.5	Confident	89 Å²	89	111.4 Å²	111.4	92%	0.918	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	89.6	1	176.6	0	0	0	0	0	116
57	V	75.4	Confident	74.7	Confident	80 Å²	80	121 Å²	121	49%	0.485	65%	0.649	S	S	.	*	S	Bend	trans	-109.2	148.7	170.3	-61.4	0	0	0	0	111.4	P54 V59	P54-V57 HydrophobicContact CB-CG2 4.08Å; P54-V57 HydrophobicContact CG-CG2 4.18Å; P54-V57 VanDerWaalsContact O-CG2 3.25Å; P54-V57 WeakPolarHBondContact O-CG2 3.32Å; V57-V59 PolarHBondContact O-N 3.38Å
58	K	75.6	Confident	74.1	Confident	180 Å²	180	121.9 Å²	121.9	78%	0.783	66%	0.655	S	S	*	*	P	Polyproline II helix	trans	-61	129.7	175.2	-177.6	179.8	179.1	-179	0	109.1	W60	K58-W60 PolarHBondContact O-N 2.93Å; K58-W60 VanDerWaalsContact O-N 3.11Å
59	V	74.6	Confident	73.7	Confident	72 Å²	72	123.8 Å²	123.8	44%	0.436	67%	0.665	S	S	.	*	P	Polyproline II helix	trans	-50.6	119	173.2	177.9	0	0	0	0	108.8	A50 Q53 V57 S61	A50-V59 HydrophobicContact CB-CG2 4.07Å; Q53-V59 VanDerWaalsContact NE2-CG1 3.3Å; V57-V59 PolarHBondContact O-N 3.38Å; V59-S61 PolarHBondContact O-N 3.45Å; V59-S61 VanDerWaalsContact O-N 3.09Å
60	W	69.4	Low	73.6	Confident	203 Å²	203	124.2 Å²	124.2	77%	0.769	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-58	116.4	-179.1	-75.4	5.1	0	0	0	110.2	K58	K58-W60 PolarHBondContact O-N 2.93Å; K58-W60 VanDerWaalsContact O-N 3.11Å
61	S	65.5	Low	73.4	Confident	92 Å²	92	128.9 Å²	128.9	64%	0.643	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-73.1	129	168.9	47.7	0	0	0	0	108.7	V59 P63	V59-S61 PolarHBondContact O-N 3.45Å; V59-S61 VanDerWaalsContact O-N 3.09Å; S61-P63 VanDerWaalsContact O-CD 3.29Å; S61-P63 WeakPolarHBondContact O-CD 3.44Å
62	D	69.6	Low	72.8	Confident	87 Å²	87	129 Å²	129	47%	0.465	69%	0.691	S	S	.	*			trans	-49.6	111.9	174.4	175.9	4	0	0	0	110.3	Y64 K65	D62-Y64 PolarHBondContact O-N 3.23Å; D62-Y64 PolarHBondContact OD1-N 3.4Å; D62-K65 HydrophobicContact CB-CB 4.1Å; D62-K65 HydrophobicContact CB-CD 4.49Å; D62-K65 HydrophobicContact CB-CG 4.46Å; D62-K65 PolarHBondContact O-N 3.17Å
63	P	62.4	Low	72.3	Confident	111 Å²	111	130.2 Å²	130.2	72%	0.721	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71	-9.7	-174.5	28.6	-33.7	0	0	0	113.1	S61	S61-P63 VanDerWaalsContact O-CD 3.29Å; S61-P63 WeakPolarHBondContact O-CD 3.44Å
64	Y	69.3	Low	71.7	Confident	203 Å²	203	137.3 Å²	137.3	80%	0.796	73%	0.731	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.3	5	179.8	-54.7	-71.3	0	0	0	113.1	D62 P66	D62-Y64 PolarHBondContact O-N 3.23Å; D62-Y64 PolarHBondContact OD1-N 3.4Å; Y64-P66 WeakPolarHBondContact O-CD 3.3Å
65	K	71.6	Confident	71.1	Confident	155 Å²	155	140.7 Å²	140.7	67%	0.674	74%	0.741	S	S	*	*			trans	-64.1	126.2	178.3	-137.5	179.1	-171.7	-176.4	0	109.4	D62 K67	D62-K65 HydrophobicContact CB-CB 4.1Å; D62-K65 HydrophobicContact CB-CD 4.49Å; D62-K65 HydrophobicContact CB-CG 4.46Å; D62-K65 PolarHBondContact O-N 3.17Å; K65-K67 PolarHBondContact O-N 3.03Å
66	P	66.9	Low	70.4	Confident	121 Å²	121	139.9 Å²	139.9	79%	0.786	73%	0.727	S	S	*	*			trans	-56	141.2	170.9	-21.5	32.2	0	0	0	110	Y64	Y64-P66 WeakPolarHBondContact O-CD 3.3Å
67	K	67.6	Low	69.8	Low	286 Å²	286	144.5 Å²	144.5	100%	1.243	71%	0.709	S	S	*	*			trans	-65.4	0	177.1	-70.5	-169.8	179.1	-176.9	0	111.9	K65	K65-K67 PolarHBondContact O-N 3.03Å

Retrieved 67 of 67 residues in 220.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).