A0A060XV36_ONCMY Loading...

Protein AF1q

AlphaFold DB , UniProt , Accession A0A060XV36, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110496277, Length 88 aa.

						>A0A060XV36_ONCMY|A0A060XV36|LOC110496277
MLVKSNSEYDSFLYWRQPISAPDLSELEDLGVTKSKPTKKSKKATKKQNAALAKQRKQQEAELLEYTTFNYWREPIPSIDLLDFNLLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.3	Very low	69.2	Low	234 Å²	234	129.8 Å²	129.8	100%	1.153	68%	0.679	S	S	*	*				0	118.4	0	-71.7	176.1	-177.3	0	0	107.3	V3	M1-V3 PolarHBondContact O-N 3.41Å
2	L	51.5	Low	70.6	Confident	167 Å²	167	127.6 Å²	127.6	87%	0.874	66%	0.66	S	S	*	*			trans	-72	98	-176	-167	76.1	0	0	0	108.5	K4	L2-K4 VanDerWaalsContact C-N 3.27Å; L2-K4 PolarHBondContact O-N 3.25Å
3	V	56	Low	71.8	Confident	136 Å²	136	123.5 Å²	123.5	82%	0.824	64%	0.639	S	S	*	*			trans	-71.4	91.2	172.3	-177.4	0	0	0	0	106.5	M1 S5	M1-V3 PolarHBondContact O-N 3.41Å; V3-S5 PolarHBondContact O-N 3.01Å; V3-S5 VanDerWaalsContact O-N 3.08Å
4	K	63.4	Low	72.8	Confident	168 Å²	168	126.2 Å²	126.2	73%	0.73	64%	0.639	S	S	*	*			trans	-73.3	100.9	175.3	-156.5	171	175.3	-170	0	106	L2 N6	L2-K4 VanDerWaalsContact C-N 3.27Å; L2-K4 PolarHBondContact O-N 3.25Å; K4-N6 VanDerWaalsContact C-N 3.27Å; K4-N6 PolarHBondContact O-N 3.29Å
5	S	65.3	Low	73.7	Confident	99 Å²	99	132.3 Å²	132.3	69%	0.692	65%	0.651	S	S	*	*			trans	-60	92.9	172.9	49.3	0	0	0	0	107.9	V3 S7	V3-S5 PolarHBondContact O-N 3.01Å; V3-S5 VanDerWaalsContact O-N 3.08Å; S5-S7 VanDerWaalsContact C-N 3.32Å; S5-S7 PolarHBondContact O-N 3.25Å
6	N	68.5	Low	74.6	Confident	127 Å²	127	134.9 Å²	134.9	68%	0.679	65%	0.652	S	S	*	*			trans	-72.1	90.3	-176.8	-163.9	12.7	0	0	0	108	K4	K4-N6 VanDerWaalsContact C-N 3.27Å; K4-N6 PolarHBondContact O-N 3.29Å
7	S	79.6	Confident	75.2	Confident	61 Å²	61	134.4 Å²	134.4	43%	0.427	65%	0.648	S	S	.	*			trans	-73.4	152.7	177.5	176	0	0	0	0	109.9	S5 Y9 D10 S11	S5-S7 VanDerWaalsContact C-N 3.32Å; S5-S7 PolarHBondContact O-N 3.25Å; S7-Y9 PolarHBondContact O-N 2.94Å; S7-Y9 VanDerWaalsContact O-N 3.12Å; S7-Y9 PolarHBondContact OG-N 3.32Å; S7-D10 PolarHBondContact N-OD2 3.42Å; S7-D10 WeakPolarHBondContact O-CB 3.47Å; S7-D10 PolarHBondContact O-N 3.31Å; S7-S11 PolarHBondContact O-N 3.22Å
8	E	83	Confident	75.8	Confident	177 Å²	177	133.4 Å²	133.4	83%	0.827	65%	0.654	S	S	*	*	H	α-helix	trans	-51.9	-33.3	168	-64.7	175.6	177.5	0	0	111.1	S11 F12	E8-S11 WeakPolarHBondContact O-CB 3.44Å; E8-S11 PolarHBondContact O-N 3.12Å; E8-F12 PolarHBondContact O-N 3.46Å
9	Y	82	Confident	76.1	Confident	147 Å²	147	135.2 Å²	135.2	58%	0.576	67%	0.665	S	S	*	*	H	α-helix	trans	-67.4	-35.1	175.6	-170.2	-105.8	0	0	0	113.3	S7 S11 F12 L13	S7-Y9 PolarHBondContact O-N 2.94Å; S7-Y9 VanDerWaalsContact O-N 3.12Å; S7-Y9 PolarHBondContact OG-N 3.32Å; Y9-S11 VanDerWaalsContact C-N 3.32Å; Y9-F12 HydrophobicContact CE2-CD1 4.35Å; Y9-F12 WeakPolarHBondContact O-CB 3.38Å; Y9-F12 PolarHBondContact O-N 2.99Å; Y9-L13 HydrophobicContact CD1-CD1 4.07Å; Y9-L13 HydrophobicContact CD1-CG 4.33Å; Y9-L13 HydrophobicContact CE1-CD1 3.7Å; Y9-L13 HydrophobicContact CE1-CD2 4.36Å; Y9-L13 HydrophobicContact CE1-CG 4.01Å; Y9-L13 WeakPolarHBondContact O-CG 3.23Å; Y9-L13 PolarHBondContact O-N 2.89Å
10	D	83.4	Confident	76.5	Confident	60 Å²	60	133.7 Å²	133.7	32%	0.321	67%	0.668	S	S	.	*	H	α-helix	trans	-67.7	-36.7	175	-73.4	-38.6	0	0	0	111.2	S7 F12 L13 Y14	S7-D10 PolarHBondContact N-OD2 3.42Å; S7-D10 WeakPolarHBondContact O-CB 3.47Å; S7-D10 PolarHBondContact O-N 3.31Å; D10-F12 VanDerWaalsContact C-N 3.34Å; D10-L13 PolarHBondContact O-N 3.22Å; D10-Y14 WeakPolarHBondContact O-CB 3.45Å; D10-Y14 PolarHBondContact O-N 3.04Å
11	S	85.9	Confident	76.7	Confident	52 Å²	52	131.8 Å²	131.8	36%	0.364	67%	0.673	S	S	.	*	H	α-helix	trans	-62.9	-42.7	173.5	-62.9	0	0	0	0	111.1	S7 E8 Y9 L13 Y14 W15	S7-S11 PolarHBondContact O-N 3.22Å; E8-S11 WeakPolarHBondContact O-CB 3.44Å; E8-S11 PolarHBondContact O-N 3.12Å; Y9-S11 VanDerWaalsContact C-N 3.32Å; S11-L13 PolarHBondContact O-N 3.48Å; S11-Y14 WeakPolarHBondContact O-CB 3.4Å; S11-Y14 PolarHBondContact O-N 3.3Å; S11-W15 PolarHBondContact O-N 3.07Å; S11-W15 VanDerWaalsContact O-N 3.14Å
12	F	86.5	Confident	78.4	Confident	103 Å²	103	125.4 Å²	125.4	45%	0.452	65%	0.649	S	S	.	*	H	α-helix	trans	-61.8	-42.1	174.8	175.4	-103.5	0	0	0	112.6	E8 Y9 D10 W15 R16	E8-F12 PolarHBondContact O-N 3.46Å; Y9-F12 HydrophobicContact CE2-CD1 4.35Å; Y9-F12 WeakPolarHBondContact O-CB 3.38Å; Y9-F12 PolarHBondContact O-N 2.99Å; D10-F12 VanDerWaalsContact C-N 3.34Å; F12-W15 PolarHBondContact O-N 3.45Å; F12-R16 HydrophobicContact CE1-CG 4.48Å; F12-R16 HydrophobicContact CE2-CG 4.47Å; F12-R16 HydrophobicContact CZ-CG 4.36Å; F12-R16 WeakPolarHBondContact O-CG 3.16Å; F12-R16 PolarHBondContact O-N 3.4Å
13	L	86	Confident	79.8	Confident	74 Å²	74	121.8 Å²	121.8	39%	0.387	63%	0.631	S	S	.	*	H	α-helix	trans	-64.4	-42.3	176.1	-70.7	-179.2	0	0	0	111.9	Y9 D10 S11 W15 R16 Q17	Y9-L13 HydrophobicContact CD1-CD1 4.07Å; Y9-L13 HydrophobicContact CD1-CG 4.33Å; Y9-L13 HydrophobicContact CE1-CD1 3.7Å; Y9-L13 HydrophobicContact CE1-CD2 4.36Å; Y9-L13 HydrophobicContact CE1-CG 4.01Å; Y9-L13 WeakPolarHBondContact O-CG 3.23Å; Y9-L13 PolarHBondContact O-N 2.89Å; D10-L13 PolarHBondContact O-N 3.22Å; S11-L13 PolarHBondContact O-N 3.48Å; L13-W15 VanDerWaalsContact C-N 3.27Å; L13-W15 PolarHBondContact O-N 2.81Å; L13-R16 CarbonylContact O-C 3.52Å; L13-R16 WeakPolarHBondContact O-CA 3.46Å; L13-R16 PolarHBondContact O-N 2.95Å; L13-Q17 VanDerWaalsContact O-CG 3.29Å; L13-Q17 WeakPolarHBondContact O-CG 3.32Å; L13-Q17 PolarHBondContact O-N 3.46Å; L13-Q17 VanDerWaalsContact O-N 3.11Å
14	Y	85.6	Confident	80.7	Confident	162 Å²	162	120.7 Å²	120.7	64%	0.635	62%	0.62	S	S	*	*	H	α-helix	trans	-54.2	-44.3	175.3	176.2	-110	0	0	0	111.5	D10 S11 R16 Q17	D10-Y14 WeakPolarHBondContact O-CB 3.45Å; D10-Y14 PolarHBondContact O-N 3.04Å; S11-Y14 WeakPolarHBondContact O-CB 3.4Å; S11-Y14 PolarHBondContact O-N 3.3Å; Y14-R16 PolarHBondContact O-N 3.28Å; Y14-Q17 WeakPolarHBondContact O-CB 3.36Å; Y14-Q17 PolarHBondContact O-N 3.48Å
15	W	86	Confident	81.3	Confident	217 Å²	217	115.8 Å²	115.8	82%	0.822	61%	0.607	S	S	*	*	H	α-helix	trans	-72.2	-18.4	179.9	-74.8	45.6	0	0	0	113.5	S11 F12 L13	S11-W15 PolarHBondContact O-N 3.07Å; S11-W15 VanDerWaalsContact O-N 3.14Å; F12-W15 PolarHBondContact O-N 3.45Å; L13-W15 VanDerWaalsContact C-N 3.27Å; L13-W15 PolarHBondContact O-N 2.81Å
16	R	88.6	Confident	81.7	Confident	175 Å²	175	117.6 Å²	117.6	66%	0.66	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.2	-2.1	176.1	-70.1	-173.5	67.1	-177.1	3.8	113.3	F12 L13 Y14	F12-R16 HydrophobicContact CE1-CG 4.48Å; F12-R16 HydrophobicContact CE2-CG 4.47Å; F12-R16 HydrophobicContact CZ-CG 4.36Å; F12-R16 WeakPolarHBondContact O-CG 3.16Å; F12-R16 PolarHBondContact O-N 3.4Å; L13-R16 CarbonylContact O-C 3.52Å; L13-R16 WeakPolarHBondContact O-CA 3.46Å; L13-R16 PolarHBondContact O-N 2.95Å; Y14-R16 PolarHBondContact O-N 3.28Å
17	Q	85.6	Confident	81.8	Confident	125 Å²	125	114.9 Å²	114.9	58%	0.584	59%	0.589	S	S	*	*	S	Bend	trans	-66.2	143	176.5	-63.6	-165.9	-94.5	0	0	110	L13 Y14 I19	L13-Q17 VanDerWaalsContact O-CG 3.29Å; L13-Q17 WeakPolarHBondContact O-CG 3.32Å; L13-Q17 PolarHBondContact O-N 3.46Å; L13-Q17 VanDerWaalsContact O-N 3.11Å; Y14-Q17 WeakPolarHBondContact O-CB 3.36Å; Y14-Q17 PolarHBondContact O-N 3.48Å; Q17-I19 PolarHBondContact O-N 3.05Å
18	P	85.2	Confident	81.5	Confident	118 Å²	118	117.7 Å²	117.7	77%	0.766	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-59.9	139.2	172.8	26.1	-33.2	0	0	0	109.5	S20	P18-S20 PolarHBondContact O-N 3.28Å
19	I	82.4	Confident	81.1	Confident	167 Å²	167	116.7 Å²	116.7	86%	0.856	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-64.9	124.3	174.8	-57.8	171.1	0	0	0	107.4	Q17 A21	Q17-I19 PolarHBondContact O-N 3.05Å; I19-A21 PolarHBondContact O-N 3.5Å
20	S	82.6	Confident	80.6	Confident	105 Å²	105	115.8 Å²	115.8	73%	0.734	60%	0.6	S	S	*	*	P	Polyproline II helix	trans	-55.1	135.8	173.2	-62.5	0	0	0	0	109.5	P18 P22	P18-S20 PolarHBondContact O-N 3.28Å; S20-P22 WeakPolarHBondContact O-CD 3.23Å
21	A	82	Confident	79.9	Confident	93 Å²	93	115.6 Å²	115.6	77%	0.769	61%	0.613	S	S	*	*	P	Polyproline II helix	trans	-58.2	125.6	174.3	0	0	0	0	0	108.5	I19	I19-A21 PolarHBondContact O-N 3.5Å
22	P	77.3	Confident	78.9	Confident	100 Å²	100	117.1 Å²	117.1	65%	0.649	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-65.1	140.4	175.6	26.9	-33	0	0	0	109.2	S20 L24	S20-P22 WeakPolarHBondContact O-CD 3.23Å; P22-L24 HydrophobicContact CG-CD2 4.44Å; P22-L24 PolarHBondContact O-N 3.35Å
23	D	81.3	Confident	77.7	Confident	92 Å²	92	115 Å²	115	49%	0.492	62%	0.615	S	S	.	*			trans	-70.6	112	170.5	-169.8	-9.6	0	0	0	108.6	S25 E26	D23-S25 PolarHBondContact O-N 3.03Å; D23-S25 WeakPolarHBondContact OD1-CB 3.39Å; D23-S25 PolarHBondContact OD1-N 2.93Å; D23-S25 PolarHBondContact OD1-OG 3.45Å; D23-S25 PolarHBondContact OD2-OG 3Å; D23-S25 VanDerWaalsContact OD2-OG 3.05Å; D23-E26 HydrophobicContact CB-CG 4.35Å
24	L	75.1	Confident	76.6	Confident	112 Å²	112	119.9 Å²	119.9	59%	0.586	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.9	-13.1	-177.1	-61.9	177.8	0	0	0	112.4	P22 E26 L27 T33	P22-L24 HydrophobicContact CG-CD2 4.44Å; P22-L24 PolarHBondContact O-N 3.35Å; L24-E26 VanDerWaalsContact C-N 3.32Å; L24-L27 PolarHBondContact O-N 3.28Å; L24-T33 WeakPolarHBondContact O-CG2 3.37Å
25	S	75.4	Confident	75.3	Confident	66 Å²	66	117 Å²	117	46%	0.462	64%	0.637	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.6	-35	175.7	67.2	0	0	0	0	111.8	D23 L27 E28	D23-S25 PolarHBondContact O-N 3.03Å; D23-S25 WeakPolarHBondContact OD1-CB 3.39Å; D23-S25 PolarHBondContact OD1-N 2.93Å; D23-S25 PolarHBondContact OD1-OG 3.45Å; D23-S25 PolarHBondContact OD2-OG 3Å; D23-S25 VanDerWaalsContact OD2-OG 3.05Å; S25-L27 PolarHBondContact O-N 2.97Å; S25-E28 VanDerWaalsContact O-CB 3.23Å; S25-E28 WeakPolarHBondContact O-CB 3.43Å; S25-E28 PolarHBondContact O-N 3.47Å
26	E	74	Confident	74.3	Confident	137 Å²	137	115.3 Å²	115.3	64%	0.64	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.7	-24.6	175.4	-60.3	-178.9	-174.9	0	0	112.9	D23 L24 E28	D23-E26 HydrophobicContact CB-CG 4.35Å; L24-E26 VanDerWaalsContact C-N 3.32Å; E26-E28 VanDerWaalsContact C-N 3.35Å
27	L	70.3	Confident	72.6	Confident	69 Å²	69	112.6 Å²	112.6	36%	0.361	64%	0.641	S	S	.	*	T	Hydrogen-bonded Turn	trans	-84.8	-9.1	177.2	-113.7	71	0	0	0	113.2	L24 S25 L30 G31 V32 T33	L24-L27 PolarHBondContact O-N 3.28Å; S25-L27 PolarHBondContact O-N 2.97Å; L27-L30 HydrophobicContact CD1-CD1 4.14Å; L27-L30 HydrophobicContact CG-CD1 4.32Å; L27-L30 PolarHBondContact O-N 2.89Å; L27-G31 PolarHBondContact O-N 3.04Å; L27-V32 HydrophobicContact CD2-CB 4.02Å; L27-V32 HydrophobicContact CD2-CG1 3.95Å; L27-V32 HydrophobicContact CG-CB 4.26Å; L27-V32 PolarHBondContact O-N 3.48Å; L27-T33 HydrophobicContact CB-CG2 3.88Å
28	E	74.4	Confident	71.2	Confident	121 Å²	121	112.7 Å²	112.7	57%	0.565	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.8	-39.9	178.4	-172	165.6	-164.2	0	0	111.1	S25 E26 L30 G31 T33	S25-E28 VanDerWaalsContact O-CB 3.23Å; S25-E28 WeakPolarHBondContact O-CB 3.43Å; S25-E28 PolarHBondContact O-N 3.47Å; E26-E28 VanDerWaalsContact C-N 3.35Å; E28-L30 PolarHBondContact O-N 2.96Å; E28-G31 PolarHBondContact O-N 2.81Å; E28-T33 HydrophobicContact CB-CG2 4.21Å
29	D	74.3	Confident	69.5	Low	155 Å²	155	116.2 Å²	116.2	83%	0.829	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63	-26.6	175.5	-67.6	-16.9	0	0	0	112.5	G31	D29-G31 VanDerWaalsContact C-N 3.35Å
30	L	71.2	Confident	68	Low	128 Å²	128	117.3 Å²	117.3	67%	0.67	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87	-3.5	177.8	-65.2	167.2	0	0	0	112.9	L27 E28 V32	L27-L30 HydrophobicContact CD1-CD1 4.14Å; L27-L30 HydrophobicContact CG-CD1 4.32Å; L27-L30 PolarHBondContact O-N 2.89Å; E28-L30 PolarHBondContact O-N 2.96Å; L30-V32 HydrophobicContact CB-CG2 3.91Å; L30-V32 PolarHBondContact O-N 3.25Å
31	G	67.9	Low	66.5	Low	56 Å²	56	117.4 Å²	117.4	58%	0.577	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	69.3	11.8	179.7	0	0	0	0	0	115.1	L27 E28 D29	L27-G31 PolarHBondContact O-N 3.04Å; E28-G31 PolarHBondContact O-N 2.81Å; D29-G31 VanDerWaalsContact C-N 3.35Å
32	V	64.3	Low	65.3	Low	85 Å²	85	122 Å²	122	52%	0.515	66%	0.655	S	S	.	*			trans	-84.7	-20.3	-173.1	-175.1	0	0	0	0	112.5	L27 L30 K34	L27-V32 HydrophobicContact CD2-CB 4.02Å; L27-V32 HydrophobicContact CD2-CG1 3.95Å; L27-V32 HydrophobicContact CG-CB 4.26Å; L27-V32 PolarHBondContact O-N 3.48Å; L30-V32 HydrophobicContact CB-CG2 3.91Å; L30-V32 PolarHBondContact O-N 3.25Å; V32-K34 VanDerWaalsContact C-N 3.26Å; V32-K34 PolarHBondContact O-N 3.24Å; V32-K34 VanDerWaalsContact O-N 3.15Å
33	T	61.4	Low	64.4	Low	59 Å²	59	126.6 Å²	126.6	36%	0.362	66%	0.664	S	S	.	*	T	Hydrogen-bonded Turn	trans	-70.8	-11.6	-169.4	58.1	0	0	0	0	115.3	L24 L27 E28 S35	L24-T33 WeakPolarHBondContact O-CG2 3.37Å; L27-T33 HydrophobicContact CB-CG2 3.88Å; E28-T33 HydrophobicContact CB-CG2 4.21Å; T33-S35 PolarHBondContact O-N 3.06Å
34	K	63.1	Low	63.2	Low	176 Å²	176	124.2 Å²	124.2	77%	0.765	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.7	6.7	-173.8	-60.1	-79.8	-176	-177	0	114.3	V32 K36	V32-K34 VanDerWaalsContact C-N 3.26Å; V32-K34 PolarHBondContact O-N 3.24Å; V32-K34 VanDerWaalsContact O-N 3.15Å; K34-K36 PolarHBondContact O-N 3.29Å
35	S	59.9	Low	62.8	Low	102 Å²	102	123.3 Å²	123.3	71%	0.713	66%	0.657	S	S	*	*			trans	-71.9	99.2	173.1	71.1	0	0	0	0	109.2	T33	T33-S35 PolarHBondContact O-N 3.06Å
36	K	63.6	Low	62.2	Low	181 Å²	181	129.1 Å²	129.1	79%	0.787	67%	0.674	S	S	*	*			trans	-46.3	135.4	168.5	-75.4	176	179.7	168.6	0	108.2	K34 T38	K34-K36 PolarHBondContact O-N 3.29Å; K36-T38 PolarHBondContact O-N 3.15Å
37	P	54.2	Low	61.6	Low	118 Å²	118	131.1 Å²	131.1	77%	0.766	68%	0.68	S	S	*	*			trans	-55.6	113.9	170.4	23.1	-30.8	0	0	0	106.1	K39	P37-K39 PolarHBondContact O-N 3.05Å
38	T	54.8	Low	61.4	Low	127 Å²	127	133.1 Å²	133.1	78%	0.779	69%	0.688	S	S	*	*			trans	-62.7	93.7	170.1	53.8	0	0	0	0	104.5	K36 K40	K36-T38 PolarHBondContact O-N 3.15Å; T38-K40 PolarHBondContact O-N 3.49Å
39	K	49.2	Very low	61	Low	191 Å²	191	131.6 Å²	131.6	83%	0.83	68%	0.684	S	S	*	*			trans	-42.1	118.3	161.2	-73.2	-175.9	178	179	0	103.8	P37 S41	P37-K39 PolarHBondContact O-N 3.05Å; K39-S41 PolarHBondContact O-N 2.7Å
40	K	51.8	Low	60.9	Low	191 Å²	191	127 Å²	127	83%	0.83	67%	0.668	S	S	*	*			trans	-55.4	90.6	-177.6	-66.4	-168.1	-176.4	-177.4	0	107.6	T38 K42	T38-K40 PolarHBondContact O-N 3.49Å; K40-K42 PolarHBondContact O-N 3.01Å
41	S	50.6	Low	60.9	Low	107 Å²	107	123.7 Å²	123.7	75%	0.748	66%	0.658	S	S	*	*			trans	-74.6	83.7	169.6	49.4	0	0	0	0	104.2	K39 K43	K39-S41 PolarHBondContact O-N 2.7Å; S41-K43 PolarHBondContact O-N 3.26Å
42	K	56.7	Low	61.1	Low	188 Å²	188	125.7 Å²	125.7	82%	0.817	66%	0.655	S	S	*	*			trans	-61.4	86.7	163.9	-72.6	-176.8	179.6	177.9	0	106.8	K40	K40-K42 PolarHBondContact O-N 3.01Å
43	K	58	Low	61.6	Low	197 Å²	197	124 Å²	124	86%	0.857	65%	0.65	S	S	*	*			trans	180	53.5	157.3	-98.9	167.1	-168.4	-172.2	0	110.1	S41 T45	S41-K43 PolarHBondContact O-N 3.26Å; K43-T45 PolarHBondContact O-N 2.97Å
44	A	56.9	Low	62.3	Low	42 Å²	42	128 Å²	128	35%	0.347	66%	0.662	S	S	.	*			trans	-75.1	117.1	152.1	0	0	0	0	0	106.9	N49	A44-N49 VanDerWaalsContact CB-OD1 3.26Å; A44-N49 WeakPolarHBondContact CB-OD1 3.47Å; A44-N49 PolarHBondContact O-ND2 3.05Å; A44-N49 VanDerWaalsContact O-ND2 3.11Å
45	T	66.4	Low	62.7	Low	93 Å²	93	125.7 Å²	125.7	57%	0.571	66%	0.655	S	S	*	*			trans	-58.1	144.2	178.1	-42	0	0	0	0	109.3	K43 K47 Q48 N49	K43-T45 PolarHBondContact O-N 2.97Å; T45-K47 PolarHBondContact O-N 3.18Å; T45-Q48 PolarHBondContact O-N 3.37Å; T45-N49 PolarHBondContact O-N 3.15Å
46	K	62.1	Low	63.2	Low	188 Å²	188	129.1 Å²	129.1	82%	0.817	65%	0.652	S	S	*	*	H	α-helix	trans	-44.2	-33.8	-177.6	-171.2	176.8	-180	177.7	0	114	A50	K46-A50 WeakPolarHBondContact O-CB 3.06Å; K46-A50 PolarHBondContact O-N 3.39Å; K46-A50 VanDerWaalsContact O-N 3.1Å
47	K	63.1	Low	63.6	Low	179 Å²	179	127.8 Å²	127.8	78%	0.778	65%	0.646	S	S	*	*	H	α-helix	trans	-68.4	-40	176.1	-69.4	-174.1	176.6	-177.6	0	114.3	T45 A50 A51	T45-K47 PolarHBondContact O-N 3.18Å; K47-A50 PolarHBondContact O-N 3.1Å; K47-A51 PolarHBondContact O-N 3.11Å
48	Q	64.9	Low	64.4	Low	112 Å²	112	126.8 Å²	126.8	52%	0.523	63%	0.631	S	S	.	*	H	α-helix	trans	-69.9	-43.2	178.2	-70.2	177.9	-8.5	0	0	110.8	T45 A50 A51 L52	T45-Q48 PolarHBondContact O-N 3.37Å; Q48-A50 VanDerWaalsContact C-N 3.3Å; Q48-A50 PolarHBondContact O-N 3.45Å; Q48-A51 PolarHBondContact O-N 3.32Å; Q48-L52 WeakPolarHBondContact O-CD1 3.37Å; Q48-L52 PolarHBondContact O-N 2.88Å
49	N	66.3	Low	65.2	Low	88 Å²	88	126.3 Å²	126.3	47%	0.471	62%	0.62	S	S	.	*	H	α-helix	trans	-62.8	-37	174.6	-71.8	-35	0	0	0	112.4	A44 T45 A53	A44-N49 VanDerWaalsContact CB-OD1 3.26Å; A44-N49 WeakPolarHBondContact CB-OD1 3.47Å; A44-N49 PolarHBondContact O-ND2 3.05Å; A44-N49 VanDerWaalsContact O-ND2 3.11Å; T45-N49 PolarHBondContact O-N 3.15Å; N49-A53 WeakPolarHBondContact O-CB 3.43Å; N49-A53 PolarHBondContact O-N 3.46Å
50	A	71.9	Confident	66.3	Low	60 Å²	60	123.3 Å²	123.3	50%	0.496	61%	0.609	S	S	.	*	H	α-helix	trans	-66.7	-39.9	175.8	0	0	0	0	0	112.5	K46 K47 Q48 A53 K54	K46-A50 WeakPolarHBondContact O-CB 3.06Å; K46-A50 PolarHBondContact O-N 3.39Å; K46-A50 VanDerWaalsContact O-N 3.1Å; K47-A50 PolarHBondContact O-N 3.1Å; Q48-A50 VanDerWaalsContact C-N 3.3Å; Q48-A50 PolarHBondContact O-N 3.45Å; A50-A53 PolarHBondContact O-N 3.4Å; A50-K54 WeakPolarHBondContact O-CB 3.22Å; A50-K54 PolarHBondContact O-N 2.94Å
51	A	72.7	Confident	67.3	Low	57 Å²	57	117.2 Å²	117.2	47%	0.471	59%	0.594	S	S	.	*	H	α-helix	trans	-66	-45.9	176.1	0	0	0	0	0	111.8	K47 Q48 A53 K54 Q55	K47-A51 PolarHBondContact O-N 3.11Å; Q48-A51 PolarHBondContact O-N 3.32Å; A51-A53 PolarHBondContact O-N 3.2Å; A51-K54 PolarHBondContact O-N 2.85Å; A51-Q55 WeakPolarHBondContact O-CG 3.1Å; A51-Q55 PolarHBondContact O-N 2.62Å
52	L	71.6	Confident	68.5	Low	98 Å²	98	118.4 Å²	118.4	51%	0.513	59%	0.588	S	S	.	*	H	α-helix	trans	-63.8	-38.9	175.1	-86.5	91.4	0	0	0	112.2	Q48 K54 Q55 R56	Q48-L52 WeakPolarHBondContact O-CD1 3.37Å; Q48-L52 PolarHBondContact O-N 2.88Å; L52-K54 VanDerWaalsContact C-N 3.34Å; L52-Q55 PolarHBondContact O-N 2.77Å; L52-R56 WeakPolarHBondContact O-CB 3.35Å; L52-R56 WeakPolarHBondContact O-CG 3.21Å; L52-R56 PolarHBondContact O-N 2.85Å
53	A	74	Confident	69.2	Low	50 Å²	50	114.6 Å²	114.6	41%	0.413	58%	0.576	S	S	.	*	H	α-helix	trans	-66	-36.9	176.3	0	0	0	0	0	112.1	N49 A50 A51 K57	N49-A53 WeakPolarHBondContact O-CB 3.43Å; N49-A53 PolarHBondContact O-N 3.46Å; A50-A53 PolarHBondContact O-N 3.4Å; A51-A53 PolarHBondContact O-N 3.2Å; A53-K57 WeakPolarHBondContact O-CG 3.36Å; A53-K57 PolarHBondContact O-N 3.38Å
54	K	75.6	Confident	69.9	Low	142 Å²	142	109.7 Å²	109.7	62%	0.617	56%	0.559	S	S	*	*	H	α-helix	trans	-67.8	-43.1	176.1	-166	177.5	-178.3	-176.2	0	111.6	A50 A51 L52 K57 Q58	A50-K54 WeakPolarHBondContact O-CB 3.22Å; A50-K54 PolarHBondContact O-N 2.94Å; A51-K54 PolarHBondContact O-N 2.85Å; L52-K54 VanDerWaalsContact C-N 3.34Å; K54-K57 PolarHBondContact O-N 3.21Å; K54-Q58 WeakPolarHBondContact O-CG 3.26Å; K54-Q58 PolarHBondContact O-N 2.91Å
55	Q	71.7	Confident	70.4	Confident	129 Å²	129	114.6 Å²	114.6	60%	0.603	57%	0.574	S	S	*	*	H	α-helix	trans	-63.6	-42	175.4	-71.3	-119.1	-58.4	0	0	112.3	A51 L52 K57 Q58 Q59	A51-Q55 WeakPolarHBondContact O-CG 3.1Å; A51-Q55 PolarHBondContact O-N 2.62Å; L52-Q55 PolarHBondContact O-N 2.77Å; Q55-K57 PolarHBondContact O-N 2.67Å; Q55-Q58 PolarHBondContact O-N 3.39Å; Q55-Q59 PolarHBondContact O-N 3.29Å
56	R	70.4	Confident	70.6	Confident	173 Å²	173	118.3 Å²	118.3	65%	0.653	58%	0.579	S	S	*	*	H	α-helix	trans	-62.4	-42.1	174.7	-76.6	-178.2	-173.3	179.9	1	112.5	L52 Q58 Q59 E60	L52-R56 WeakPolarHBondContact O-CB 3.35Å; L52-R56 WeakPolarHBondContact O-CG 3.21Å; L52-R56 PolarHBondContact O-N 2.85Å; R56-Q58 VanDerWaalsContact C-N 3.32Å; R56-Q58 PolarHBondContact O-N 2.71Å; R56-Q59 PolarHBondContact O-N 3.24Å; R56-E60 VanDerWaalsContact O-CB 3.23Å; R56-E60 WeakPolarHBondContact O-CB 3.41Å; R56-E60 PolarHBondContact O-N 3.46Å
57	K	72.3	Confident	71.2	Confident	153 Å²	153	111.4 Å²	111.4	67%	0.665	55%	0.553	S	S	*	*	H	α-helix	trans	-64.3	-35.5	176.2	-77.7	-174.3	176.7	-167.1	0	113	A53 K54 Q55 A61	A53-K57 WeakPolarHBondContact O-CG 3.36Å; A53-K57 PolarHBondContact O-N 3.38Å; K54-K57 PolarHBondContact O-N 3.21Å; Q55-K57 PolarHBondContact O-N 2.67Å; K57-A61 WeakPolarHBondContact O-CB 3.25Å; K57-A61 PolarHBondContact O-N 3.41Å
58	Q	71.8	Confident	71.4	Confident	97 Å²	97	108.1 Å²	108.1	45%	0.453	55%	0.548	S	S	.	.	H	α-helix	trans	-68.2	-47.7	175.6	-73.6	175.7	-42.8	0	0	111	K54 Q55 R56 E60 A61 E62	K54-Q58 WeakPolarHBondContact O-CG 3.26Å; K54-Q58 PolarHBondContact O-N 2.91Å; Q55-Q58 PolarHBondContact O-N 3.39Å; R56-Q58 VanDerWaalsContact C-N 3.32Å; R56-Q58 PolarHBondContact O-N 2.71Å; Q58-E60 VanDerWaalsContact C-N 3.35Å; Q58-E60 PolarHBondContact O-N 3.06Å; Q58-A61 PolarHBondContact O-N 2.97Å; Q58-E62 WeakPolarHBondContact O-CG 3.38Å; Q58-E62 PolarHBondContact O-N 3.2Å
59	Q	71.2	Confident	71.5	Confident	118 Å²	118	109.1 Å²	109.1	55%	0.551	55%	0.55	S	S	*	*	H	α-helix	trans	-61.4	-41.3	174.2	-87.7	-178.3	-12.9	0	0	112.7	Q55 R56 A61 E62 L63	Q55-Q59 PolarHBondContact O-N 3.29Å; R56-Q59 PolarHBondContact O-N 3.24Å; Q59-A61 VanDerWaalsContact C-N 3.33Å; Q59-A61 PolarHBondContact O-N 3.48Å; Q59-E62 PolarHBondContact O-N 3.2Å; Q59-L63 WeakPolarHBondContact O-CB 3.4Å; Q59-L63 WeakPolarHBondContact O-CD1 3.5Å; Q59-L63 WeakPolarHBondContact O-CG 3.47Å; Q59-L63 PolarHBondContact O-N 3.13Å
60	E	71.9	Confident	71.4	Confident	128 Å²	128	109.5 Å²	109.5	60%	0.598	55%	0.553	S	S	*	*	H	α-helix	trans	-62.2	-43.3	177.9	-170.9	174.1	-168.7	0	0	110.6	R56 Q58 E62 L63 L64	R56-E60 VanDerWaalsContact O-CB 3.23Å; R56-E60 WeakPolarHBondContact O-CB 3.41Å; R56-E60 PolarHBondContact O-N 3.46Å; Q58-E60 VanDerWaalsContact C-N 3.35Å; Q58-E60 PolarHBondContact O-N 3.06Å; E60-E62 PolarHBondContact O-N 3.48Å; E60-L63 CarbonylContact O-C 3.58Å; E60-L63 PolarHBondContact O-N 3.18Å; E60-L64 WeakPolarHBondContact O-CG 3.48Å; E60-L64 PolarHBondContact O-N 3.24Å
61	A	72.6	Confident	71.1	Confident	62 Å²	62	115 Å²	115	51%	0.512	56%	0.562	S	S	.	*	H	α-helix	trans	-63.5	-38	175.9	0	0	0	0	0	113.4	K57 Q58 Q59 L64	K57-A61 WeakPolarHBondContact O-CB 3.25Å; K57-A61 PolarHBondContact O-N 3.41Å; Q58-A61 PolarHBondContact O-N 2.97Å; Q59-A61 VanDerWaalsContact C-N 3.33Å; Q59-A61 PolarHBondContact O-N 3.48Å; A61-L64 WeakPolarHBondContact O-CB 3.37Å; A61-L64 PolarHBondContact O-N 3.36Å
62	E	76.1	Confident	70.9	Confident	133 Å²	133	119.5 Å²	119.5	62%	0.621	57%	0.567	S	S	*	*	H	α-helix	trans	-69.6	-34.1	174.4	-70.8	168.6	-163.3	0	0	111.9	Q58 Q59 E60 L64 Y66	Q58-E62 WeakPolarHBondContact O-CG 3.38Å; Q58-E62 PolarHBondContact O-N 3.2Å; Q59-E62 PolarHBondContact O-N 3.2Å; E60-E62 PolarHBondContact O-N 3.48Å; E62-L64 VanDerWaalsContact C-N 3.32Å; E62-Y66 WeakPolarHBondContact O-CD2 3.29Å
63	L	71.8	Confident	70.9	Confident	107 Å²	107	123.6 Å²	123.6	56%	0.56	58%	0.575	S	S	*	*	H	α-helix	trans	-80	-11.5	178.1	-67.2	168.4	0	0	0	113.3	Q59 E60 E65 Y66 T67	Q59-L63 WeakPolarHBondContact O-CB 3.4Å; Q59-L63 WeakPolarHBondContact O-CD1 3.5Å; Q59-L63 WeakPolarHBondContact O-CG 3.47Å; Q59-L63 PolarHBondContact O-N 3.13Å; E60-L63 CarbonylContact O-C 3.58Å; E60-L63 PolarHBondContact O-N 3.18Å; L63-E65 PolarHBondContact O-N 3.46Å; L63-Y66 PolarHBondContact O-N 3.36Å; L63-Y66 VanDerWaalsContact O-N 3.12Å; L63-T67 PolarHBondContact O-N 3.14Å
64	L	71.8	Confident	70.8	Confident	95 Å²	95	129.7 Å²	129.7	50%	0.497	60%	0.595	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.7	-23.2	173.3	-76	175.6	0	0	0	112.8	E60 A61 E62 Y66 T67 N70	E60-L64 WeakPolarHBondContact O-CG 3.48Å; E60-L64 PolarHBondContact O-N 3.24Å; A61-L64 WeakPolarHBondContact O-CB 3.37Å; A61-L64 PolarHBondContact O-N 3.36Å; E62-L64 VanDerWaalsContact C-N 3.32Å; L64-Y66 VanDerWaalsContact C-N 3.33Å; L64-T67 HydrophobicContact CD2-CG2 4.23Å; L64-T67 WeakPolarHBondContact O-CG2 3.46Å; L64-N70 PolarHBondContact O-ND2 3.38Å
65	E	69.1	Low	70.7	Confident	144 Å²	144	128.2 Å²	128.2	67%	0.673	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.8	-28.7	175.1	-168.6	173.3	-179.5	0	0	111.8	L63	L63-E65 PolarHBondContact O-N 3.46Å
66	Y	70.9	Confident	70.9	Confident	172 Å²	172	129.8 Å²	129.8	68%	0.675	61%	0.611	S	S	*	*	S	Bend	trans	-99.5	-0.5	-175.5	-55.9	-80	0	0	0	113.7	E62 L63 L64 T68	E62-Y66 WeakPolarHBondContact O-CD2 3.29Å; L63-Y66 PolarHBondContact O-N 3.36Å; L63-Y66 VanDerWaalsContact O-N 3.12Å; L64-Y66 VanDerWaalsContact C-N 3.33Å; Y66-T68 PolarHBondContact O-N 3.34Å
67	T	73.1	Confident	71.1	Confident	42 Å²	42	126.4 Å²	126.4	26%	0.258	61%	0.611	S	S	.	*			trans	-80.7	110.5	176.9	175.6	0	0	0	0	111	L63 L64 F69 N70	L63-T67 PolarHBondContact O-N 3.14Å; L64-T67 HydrophobicContact CD2-CG2 4.23Å; L64-T67 WeakPolarHBondContact O-CG2 3.46Å; T67-F69 PolarHBondContact O-N 3.11Å; T67-F69 WeakPolarHBondContact OG1-CB 3.33Å; T67-F69 PolarHBondContact OG1-N 3.4Å; T67-F69 VanDerWaalsContact OG1-N 3.15Å; T67-N70 WeakPolarHBondContact CG2-ND2 3.41Å; T67-N70 PolarHBondContact O-N 3.46Å
68	T	68.6	Low	71.3	Confident	110 Å²	110	124.5 Å²	124.5	68%	0.675	62%	0.617	S	S	*	*	G	3₁₀ helix	trans	-60	-14.2	168.8	-45.5	0	0	0	0	112	Y66 N70 Y71 W72	Y66-T68 PolarHBondContact O-N 3.34Å; T68-N70 PolarHBondContact O-N 3.31Å; T68-Y71 PolarHBondContact O-N 3.21Å; T68-W72 PolarHBondContact O-N 3.28Å
69	F	66.9	Low	71.7	Confident	133 Å²	133	125 Å²	125	58%	0.583	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-71.1	-0.2	175.6	-147.1	-95.3	0	0	0	114	T67 W72	T67-F69 PolarHBondContact O-N 3.11Å; T67-F69 WeakPolarHBondContact OG1-CB 3.33Å; T67-F69 PolarHBondContact OG1-N 3.4Å; T67-F69 VanDerWaalsContact OG1-N 3.15Å; F69-W72 AromaticContact CD1-CE2 3.77Å; F69-W72 AromaticContact CD1-CZ2 3.98Å; F69-W72 HydrophobicContact CD1-CZ2 3.98Å; F69-W72 AromaticContact CD1-NE1 3.26Å; F69-W72 VanDerWaalsContact CD1-NE1 3.26Å; F69-W72 HydrophobicContact CD2-CD2 4.48Å; F69-W72 AromaticContact CD2-NE1 3.88Å; F69-W72 AromaticContact CE1-CE2 3.52Å; F69-W72 HydrophobicContact CE1-CH2 4.24Å; F69-W72 AromaticContact CE1-CZ2 3.24Å; F69-W72 HydrophobicContact CE1-CZ2 3.24Å; F69-W72 AromaticContact CE1-NE1 3.52Å; F69-W72 HydrophobicContact CE2-CD2 4.32Å; F69-W72 AromaticContact CE2-CE2 3.82Å; F69-W72 HydrophobicContact CE2-CH2 4.35Å; F69-W72 AromaticContact CE2-CZ2 3.86Å; F69-W72 HydrophobicContact CE2-CZ2 3.86Å; F69-W72 AromaticContact CG-CD1 3.96Å; F69-W72 AromaticContact CG-NE1 3.47Å; F69-W72 HydrophobicContact CZ-CD2 4.43Å; F69-W72 AromaticContact CZ-CE2 3.54Å; F69-W72 AromaticContact CZ-CH2 3.77Å; F69-W72 HydrophobicContact CZ-CH2 3.77Å; F69-W72 AromaticContact CZ-CZ2 3.16Å; F69-W72 HydrophobicContact CZ-CZ2 3.16Å; F69-W72 AromaticContact CZ-NE1 3.93Å; F69-W72 PolarHBondContact O-NE1 3.38Å
70	N	62.8	Low	72.3	Confident	97 Å²	97	124.3 Å²	124.3	52%	0.519	62%	0.622	S	S	.	*	G	3₁₀ helix	trans	-92.1	-17.8	164.5	-70.5	-30.5	0	0	0	112.6	L64 T67 T68	L64-N70 PolarHBondContact O-ND2 3.38Å; T67-N70 WeakPolarHBondContact CG2-ND2 3.41Å; T67-N70 PolarHBondContact O-N 3.46Å; T68-N70 PolarHBondContact O-N 3.31Å
71	Y	65.6	Low	72.7	Confident	174 Å²	174	124 Å²	124	68%	0.682	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.7	-10.7	-171.5	-56.2	-82.8	0	0	0	113.8	T68 R73	T68-Y71 PolarHBondContact O-N 3.21Å; Y71-R73 PolarHBondContact O-N 2.83Å
72	W	70	Confident	73	Confident	153 Å²	153	126.1 Å²	126.1	58%	0.58	63%	0.626	S	S	*	*	S	Bend	trans	-72	-10.8	173.6	73.3	-56.9	0	0	0	114	T68 F69	T68-W72 PolarHBondContact O-N 3.28Å; F69-W72 AromaticContact CD1-CE2 3.77Å; F69-W72 AromaticContact CD1-CZ2 3.98Å; F69-W72 HydrophobicContact CD1-CZ2 3.98Å; F69-W72 AromaticContact CD1-NE1 3.26Å; F69-W72 VanDerWaalsContact CD1-NE1 3.26Å; F69-W72 HydrophobicContact CD2-CD2 4.48Å; F69-W72 AromaticContact CD2-NE1 3.88Å; F69-W72 AromaticContact CE1-CE2 3.52Å; F69-W72 HydrophobicContact CE1-CH2 4.24Å; F69-W72 AromaticContact CE1-CZ2 3.24Å; F69-W72 HydrophobicContact CE1-CZ2 3.24Å; F69-W72 AromaticContact CE1-NE1 3.52Å; F69-W72 HydrophobicContact CE2-CD2 4.32Å; F69-W72 AromaticContact CE2-CE2 3.82Å; F69-W72 HydrophobicContact CE2-CH2 4.35Å; F69-W72 AromaticContact CE2-CZ2 3.86Å; F69-W72 HydrophobicContact CE2-CZ2 3.86Å; F69-W72 AromaticContact CG-CD1 3.96Å; F69-W72 AromaticContact CG-NE1 3.47Å; F69-W72 HydrophobicContact CZ-CD2 4.43Å; F69-W72 AromaticContact CZ-CE2 3.54Å; F69-W72 AromaticContact CZ-CH2 3.77Å; F69-W72 HydrophobicContact CZ-CH2 3.77Å; F69-W72 AromaticContact CZ-CZ2 3.16Å; F69-W72 HydrophobicContact CZ-CZ2 3.16Å; F69-W72 AromaticContact CZ-NE1 3.93Å; F69-W72 PolarHBondContact O-NE1 3.38Å
73	R	70.9	Confident	73	Confident	184 Å²	184	123.1 Å²	123.1	69%	0.694	61%	0.614	S	S	*	*	S	Bend	trans	-107.2	129.6	171.5	-68.6	-129.6	-87.7	-166.5	-6.6	108.8	Y71	Y71-R73 PolarHBondContact O-N 2.83Å
74	E	71.6	Confident	73.3	Confident	177 Å²	177	123.4 Å²	123.4	83%	0.827	61%	0.611	S	S	*	*	P	Polyproline II helix	trans	-53.5	133.4	169.7	-169.1	170.1	-159.2	0	0	108.5	I76	E74-I76 PolarHBondContact O-N 3.12Å
75	P	73.6	Confident	73.6	Confident	112 Å²	112	123.9 Å²	123.9	73%	0.727	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-50.7	130.1	176.7	-25.8	33.8	0	0	0	109.6	P77	P75-P77 VanDerWaalsContact O-CD 3.25Å; P75-P77 WeakPolarHBondContact O-CD 3.43Å; P75-P77 VanDerWaalsContact O-N 3.1Å
76	I	76.4	Confident	74	Confident	161 Å²	161	123.1 Å²	123.1	83%	0.826	61%	0.614	S	S	*	*	P	Polyproline II helix	trans	-61.7	118.5	175	-60.3	175.4	0	0	0	106.3	E74 S78	E74-I76 PolarHBondContact O-N 3.12Å; I76-S78 PolarHBondContact O-N 2.91Å
77	P	74.8	Confident	74.1	Confident	102 Å²	102	121.9 Å²	121.9	66%	0.662	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-58.4	131.8	178.2	-14.3	24.3	0	0	0	108.5	P75 I79	P75-P77 VanDerWaalsContact O-CD 3.25Å; P75-P77 WeakPolarHBondContact O-CD 3.43Å; P75-P77 VanDerWaalsContact O-N 3.1Å; P77-I79 PolarHBondContact O-N 3.2Å
78	S	76.8	Confident	73.3	Confident	113 Å²	113	130.1 Å²	130.1	79%	0.79	66%	0.66	S	S	*	*			trans	-67.6	106	167.2	54.4	0	0	0	0	107.4	I76 D80	I76-S78 PolarHBondContact O-N 2.91Å; S78-D80 PolarHBondContact O-N 3.3Å
79	I	79.8	Confident	73.6	Confident	109 Å²	109	131.2 Å²	131.2	56%	0.559	66%	0.659	S	S	*	*			trans	-78	114.8	176.2	-52.8	166.2	0	0	0	107	P77 D83 F84	P77-I79 PolarHBondContact O-N 3.2Å; I79-D83 HydrophobicContact CG2-CB 4.03Å; I79-F84 HydrophobicContact CB-CE2 4.14Å; I79-F84 HydrophobicContact CB-CZ 4.33Å; I79-F84 HydrophobicContact CG2-CD2 3.8Å; I79-F84 HydrophobicContact CG2-CE1 4.2Å; I79-F84 HydrophobicContact CG2-CE2 3.27Å; I79-F84 HydrophobicContact CG2-CG 4.47Å; I79-F84 HydrophobicContact CG2-CZ 3.51Å
80	D	82.7	Confident	73.9	Confident	102 Å²	102	131.1 Å²	131.1	55%	0.545	66%	0.663	S	S	.	*			trans	-86.9	159.6	174.4	-165.5	10.8	0	0	0	110.5	S78 L82 D83 F84	S78-D80 PolarHBondContact O-N 3.3Å; D80-L82 PolarHBondContact O-N 3.32Å; D80-D83 PolarHBondContact N-OD2 2.91Å; D80-D83 WeakPolarHBondContact O-CB 3.48Å; D80-D83 PolarHBondContact O-N 3.32Å; D80-F84 WeakPolarHBondContact O-CD2 3.39Å; D80-F84 PolarHBondContact O-N 3.48Å
81	L	80.6	Confident	74.6	Confident	123 Å²	123	132.9 Å²	132.9	64%	0.644	67%	0.671	S	S	*	*	H	α-helix	trans	-57	-31.4	174.8	-174.8	61.3	0	0	0	111.7	D83 F84 N85	L81-D83 VanDerWaalsContact C-N 3.32Å; L81-D83 PolarHBondContact O-N 2.93Å; L81-F84 PolarHBondContact O-N 3.06Å; L81-N85 PolarHBondContact O-N 3.29Å; L81-N85 PolarHBondContact O-ND2 3.32Å; L81-N85 VanDerWaalsContact O-ND2 3.13Å
82	L	78.6	Confident	75.1	Confident	106 Å²	106	130.5 Å²	130.5	56%	0.555	67%	0.671	S	S	*	*	H	α-helix	trans	-62.9	-36.8	174.9	-171.7	62.2	0	0	0	112.3	D80 F84 N85 L86	D80-L82 PolarHBondContact O-N 3.32Å; L82-F84 VanDerWaalsContact C-N 3.33Å; L82-F84 PolarHBondContact O-N 2.92Å; L82-N85 PolarHBondContact O-N 3.08Å; L82-L86 HydrophobicContact CG-CD1 4.4Å; L82-L86 WeakPolarHBondContact O-CG 3.5Å; L82-L86 PolarHBondContact O-N 3.04Å
83	D	76.9	Confident	75.4	Confident	69 Å²	69	129.1 Å²	129.1	37%	0.369	68%	0.676	S	S	.	*	H	α-helix	trans	-66.8	-36.6	178.7	-59.9	-37.6	0	0	0	111.4	I79 D80 L81 N85 L86 L87	I79-D83 HydrophobicContact CG2-CB 4.03Å; D80-D83 PolarHBondContact N-OD2 2.91Å; D80-D83 WeakPolarHBondContact O-CB 3.48Å; D80-D83 PolarHBondContact O-N 3.32Å; L81-D83 VanDerWaalsContact C-N 3.32Å; L81-D83 PolarHBondContact O-N 2.93Å; D83-N85 VanDerWaalsContact C-N 3.34Å; D83-L86 PolarHBondContact O-N 2.99Å; D83-L87 WeakPolarHBondContact O-CG 3.47Å; D83-L87 PolarHBondContact O-N 3.01Å
84	F	77.8	Confident	75.7	Confident	114 Å²	114	125.5 Å²	125.5	50%	0.5	68%	0.675	S	S	.	*	H	α-helix	trans	-66.2	-35.9	173.7	-70.6	-73.9	0	0	0	112.7	I79 D80 L81 L82 L86 L87	I79-F84 HydrophobicContact CB-CE2 4.14Å; I79-F84 HydrophobicContact CB-CZ 4.33Å; I79-F84 HydrophobicContact CG2-CD2 3.8Å; I79-F84 HydrophobicContact CG2-CE1 4.2Å; I79-F84 HydrophobicContact CG2-CE2 3.27Å; I79-F84 HydrophobicContact CG2-CG 4.47Å; I79-F84 HydrophobicContact CG2-CZ 3.51Å; D80-F84 WeakPolarHBondContact O-CD2 3.39Å; D80-F84 PolarHBondContact O-N 3.48Å; L81-F84 PolarHBondContact O-N 3.06Å; L82-F84 VanDerWaalsContact C-N 3.33Å; L82-F84 PolarHBondContact O-N 2.92Å; F84-L86 VanDerWaalsContact C-N 3.29Å; F84-L86 PolarHBondContact O-N 3.21Å; F84-L87 PolarHBondContact O-N 3.25Å
85	N	78.6	Confident	76	Confident	104 Å²	104	121.8 Å²	121.8	56%	0.556	66%	0.664	S	S	*	*	H	α-helix	trans	-71.3	-24.3	178.9	-67.8	-37	0	0	0	112.9	L81 L82 D83	L81-N85 PolarHBondContact O-N 3.29Å; L81-N85 PolarHBondContact O-ND2 3.32Å; L81-N85 VanDerWaalsContact O-ND2 3.13Å; L82-N85 PolarHBondContact O-N 3.08Å; D83-N85 VanDerWaalsContact C-N 3.34Å
86	L	76.2	Confident	76.2	Confident	128 Å²	128	122.5 Å²	122.5	67%	0.67	66%	0.659	S	S	*	*	H	α-helix	trans	-86.4	-11.2	177.5	-66.4	169.9	0	0	0	113.3	L82 D83 F84	L82-L86 HydrophobicContact CG-CD1 4.4Å; L82-L86 WeakPolarHBondContact O-CG 3.5Å; L82-L86 PolarHBondContact O-N 3.04Å; D83-L86 PolarHBondContact O-N 2.99Å; F84-L86 VanDerWaalsContact C-N 3.29Å; F84-L86 PolarHBondContact O-N 3.21Å
87	L	73.9	Confident	76.1	Confident	146 Å²	146	119.3 Å²	119.3	76%	0.764	65%	0.646	S	S	*	*			trans	-94.2	0.4	178	-72.8	169.5	0	0	0	113.4	D83 F84	D83-L87 WeakPolarHBondContact O-CG 3.47Å; D83-L87 PolarHBondContact O-N 3.01Å; F84-L87 PolarHBondContact O-N 3.25Å
88	L	57.2	Low	76.3	Confident	216 Å²	216	120.9 Å²	120.9	100%	1.131	64%	0.644	S	S	*	*			trans	-100	0	174.3	-128	91.1	0	0	0	111

Retrieved 88 of 88 residues in 226.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).