A0A060XVI5_ONCMY Loading...

Small integral membrane protein 19

AlphaFold DB , UniProt , Accession A0A060XVI5, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 106 aa.

						>A0A060XVI5_ONCMY|A0A060XVI5
MGGHGVMANEESLDYSVHEAWNEATNVYLLVILVSFGLLMYARKNKRKIMRIFALPPTAGATTEPNFYDSLQKVRLRQQLEMYSLARKFDQHQHQGQSESVQLSME
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.9	Very low	52.3	Low	252 Å²	252	116.8 Å²	116.8	100%	1.241	69%	0.693	S	S	*	*				0	95.4	0	-80.3	157	132.7	0	0	107.7
2	G	50.5	Low	52.5	Low	83 Å²	83	112.6 Å²	112.6	86%	0.856	67%	0.674	S	S	*	*			trans	-138.7	42.8	-171.5	0	0	0	0	0	112.4
3	G	49.4	Very low	52.6	Low	55 Å²	55	110.9 Å²	110.9	57%	0.567	66%	0.659	S	S	*	*			trans	-119.7	2.9	-172.1	0	0	0	0	0	115.6
4	H	48.9	Very low	52.9	Low	179 Å²	179	110.3 Å²	110.3	83%	0.829	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98	-8.5	-173.1	-123	-20.5	0	0	0	115.2
5	G	53.8	Low	53.1	Low	59 Å²	59	115 Å²	115	61%	0.608	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.4	-14.9	179	0	0	0	0	0	115.2
6	V	54.2	Low	53.6	Low	94 Å²	94	112.4 Å²	112.4	57%	0.57	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.6	-44.8	-176.1	179.1	0	0	0	0	111.2	A8 N9 E10	V6-A8 PolarHBondContact O-N 3.28Å; V6-N9 PolarHBondContact O-N 3.09Å; V6-E10 PolarHBondContact O-N 3.31Å; V6-E10 VanDerWaalsContact O-N 3.12Å
7	M	54.6	Low	54.3	Low	135 Å²	135	110.9 Å²	110.9	67%	0.665	64%	0.639	S	S	*	*	H	α-helix	trans	-68.1	-31.4	-178.5	-63.4	-145.4	-147.3	0	0	114.3	N9 E10 E11	M7-N9 VanDerWaalsContact C-N 3.31Å; M7-E10 PolarHBondContact O-N 3.15Å; M7-E11 PolarHBondContact O-N 3.13Å
8	A	53.6	Low	55	Low	64 Å²	64	111.7 Å²	111.7	53%	0.529	64%	0.636	S	S	.	*	H	α-helix	trans	-72.9	-26	176.4	0	0	0	0	0	112.8	V6 S12	V6-A8 PolarHBondContact O-N 3.28Å; A8-S12 PolarHBondContact O-OG 3.43Å
9	N	54.8	Low	55.8	Low	93 Å²	93	112.5 Å²	112.5	50%	0.497	63%	0.634	S	S	.	*	H	α-helix	trans	-77.6	-37.7	174.3	-156.8	-9.3	0	0	0	110.2	V6 M7 S12 L13	V6-N9 PolarHBondContact O-N 3.09Å; M7-N9 VanDerWaalsContact C-N 3.31Å; N9-S12 WeakPolarHBondContact CA-OG 3.49Å; N9-S12 PolarHBondContact O-N 3.35Å; N9-S12 PolarHBondContact O-OG 2.86Å; N9-S12 VanDerWaalsContact O-OG 3.1Å; N9-L13 VanDerWaalsContact O-CB 3.27Å; N9-L13 WeakPolarHBondContact O-CB 3.34Å; N9-L13 WeakPolarHBondContact O-CD1 3.41Å; N9-L13 WeakPolarHBondContact O-CG 3.42Å; N9-L13 PolarHBondContact O-N 3.39Å
10	E	55.4	Low	56.7	Low	117 Å²	117	109.7 Å²	109.7	55%	0.547	63%	0.625	S	S	.	*	H	α-helix	trans	-64.5	-44.6	176.9	-74.7	175.3	126.3	0	0	113.5	V6 M7 S12 L13 D14	V6-E10 PolarHBondContact O-N 3.31Å; V6-E10 VanDerWaalsContact O-N 3.12Å; M7-E10 PolarHBondContact O-N 3.15Å; E10-S12 PolarHBondContact O-N 3.4Å; E10-L13 PolarHBondContact O-N 3.29Å; E10-D14 PolarHBondContact O-N 3.2Å
11	E	55.2	Low	57.7	Low	154 Å²	154	113 Å²	113	72%	0.72	63%	0.628	S	S	*	*	H	α-helix	trans	-67.6	-32.8	177.8	-80.8	-176.6	150.5	0	0	113.5	M7 Y15	M7-E11 PolarHBondContact O-N 3.13Å; E11-Y15 PolarHBondContact O-N 2.92Å
12	S	55	Low	59.2	Low	66 Å²	66	105.9 Å²	105.9	46%	0.462	59%	0.594	S	S	.	*	H	α-helix	trans	-78.1	-30.6	176.1	51.2	0	0	0	0	112.5	A8 N9 E10 Y15 S16	A8-S12 PolarHBondContact O-OG 3.43Å; N9-S12 WeakPolarHBondContact CA-OG 3.49Å; N9-S12 PolarHBondContact O-N 3.35Å; N9-S12 PolarHBondContact O-OG 2.86Å; N9-S12 VanDerWaalsContact O-OG 3.1Å; E10-S12 PolarHBondContact O-N 3.4Å; S12-Y15 PolarHBondContact O-N 3.35Å; S12-S16 WeakPolarHBondContact O-CB 3.45Å; S12-S16 PolarHBondContact O-N 3.34Å
13	L	54	Low	60.4	Low	91 Å²	91	108.4 Å²	108.4	48%	0.476	58%	0.584	S	S	.	*	H	α-helix	trans	-67.1	-41	170.6	-74.4	169.6	0	0	0	111.8	N9 E10 Y15 S16 V17	N9-L13 VanDerWaalsContact O-CB 3.27Å; N9-L13 WeakPolarHBondContact O-CB 3.34Å; N9-L13 WeakPolarHBondContact O-CD1 3.41Å; N9-L13 WeakPolarHBondContact O-CG 3.42Å; N9-L13 PolarHBondContact O-N 3.39Å; E10-L13 PolarHBondContact O-N 3.29Å; L13-Y15 VanDerWaalsContact C-N 3.3Å; L13-Y15 PolarHBondContact O-N 2.71Å; L13-S16 PolarHBondContact O-N 3.03Å; L13-V17 WeakPolarHBondContact O-CB 3.47Å; L13-V17 VanDerWaalsContact O-CG2 3.26Å; L13-V17 WeakPolarHBondContact O-CG2 3.42Å; L13-V17 PolarHBondContact O-N 2.79Å
14	D	55.9	Low	61.9	Low	102 Å²	102	107.7 Å²	107.7	55%	0.545	57%	0.573	S	S	.	*	H	α-helix	trans	-61.5	-40.3	174.5	-101.7	-9.5	0	0	0	111.3	E10 V17 H18	E10-D14 PolarHBondContact O-N 3.2Å; D14-V17 PolarHBondContact O-N 3.5Å; D14-H18 WeakPolarHBondContact O-CB 3.06Å; D14-H18 PolarHBondContact O-CD2 3.16Å; D14-H18 PolarHBondContact O-N 3.34Å
15	Y	56.6	Low	63.6	Low	181 Å²	181	101 Å²	101	71%	0.71	55%	0.545	S	S	*	.	H	α-helix	trans	-65.2	-41.6	175.1	-128.8	-91.6	0	0	0	112.6	E11 S12 L13 H18 E19	E11-Y15 PolarHBondContact O-N 2.92Å; S12-Y15 PolarHBondContact O-N 3.35Å; L13-Y15 VanDerWaalsContact C-N 3.3Å; L13-Y15 PolarHBondContact O-N 2.71Å; Y15-H18 PolarHBondContact O-N 2.81Å; Y15-E19 WeakPolarHBondContact O-CB 3.31Å; Y15-E19 PolarHBondContact O-N 2.82Å
16	S	61.3	Low	65.1	Low	73 Å²	73	102.4 Å²	102.4	51%	0.51	54%	0.538	S	S	.	.	H	α-helix	trans	-67.1	-37.8	176.7	-177.3	0	0	0	0	112.7	S12 L13 E19 A20	S12-S16 WeakPolarHBondContact O-CB 3.45Å; S12-S16 PolarHBondContact O-N 3.34Å; L13-S16 PolarHBondContact O-N 3.03Å; S16-E19 PolarHBondContact O-N 3.07Å; S16-A20 PolarHBondContact O-N 3.46Å
17	V	65.1	Low	66.8	Low	88 Å²	88	102 Å²	102	53%	0.533	54%	0.535	S	S	.	.	H	α-helix	trans	-69	-41.2	176	169.1	0	0	0	0	110.8	L13 D14 E19 A20 W21	L13-V17 WeakPolarHBondContact O-CB 3.47Å; L13-V17 VanDerWaalsContact O-CG2 3.26Å; L13-V17 WeakPolarHBondContact O-CG2 3.42Å; L13-V17 PolarHBondContact O-N 2.79Å; D14-V17 PolarHBondContact O-N 3.5Å; V17-E19 VanDerWaalsContact C-N 3.28Å; V17-E19 PolarHBondContact O-N 2.8Å; V17-A20 PolarHBondContact O-N 3.49Å; V17-W21 VanDerWaalsContact O-CB 3.27Å; V17-W21 WeakPolarHBondContact O-CB 3.19Å; V17-W21 PolarHBondContact O-N 2.84Å
18	H	66.7	Low	68.4	Low	124 Å²	124	102.9 Å²	102.9	57%	0.574	53%	0.532	S	S	*	.	H	α-helix	trans	-63	-35.6	174.8	-82.7	-59.3	0	0	0	112.5	D14 Y15 W21 N22	D14-H18 WeakPolarHBondContact O-CB 3.06Å; D14-H18 PolarHBondContact O-CD2 3.16Å; D14-H18 PolarHBondContact O-N 3.34Å; Y15-H18 PolarHBondContact O-N 2.81Å; H18-W21 PolarHBondContact O-N 3.48Å; H18-N22 VanDerWaalsContact O-CB 3.27Å; H18-N22 WeakPolarHBondContact O-CB 3.32Å; H18-N22 PolarHBondContact O-N 2.96Å
19	E	69.6	Low	70.2	Confident	128 Å²	128	104.1 Å²	104.1	60%	0.598	53%	0.53	S	S	*	.	H	α-helix	trans	-70.7	-43	176.3	-165	147.2	-153.4	0	0	111.9	Y15 S16 V17 W21 N22 E23	Y15-E19 WeakPolarHBondContact O-CB 3.31Å; Y15-E19 PolarHBondContact O-N 2.82Å; S16-E19 PolarHBondContact O-N 3.07Å; V17-E19 VanDerWaalsContact C-N 3.28Å; V17-E19 PolarHBondContact O-N 2.8Å; E19-W21 VanDerWaalsContact C-N 3.29Å; E19-W21 PolarHBondContact O-N 3.18Å; E19-N22 PolarHBondContact O-N 3.42Å; E19-E23 WeakPolarHBondContact O-CB 3.45Å; E19-E23 PolarHBondContact O-N 2.98Å
20	A	73.9	Confident	72	Confident	56 Å²	56	104.5 Å²	104.5	46%	0.463	53%	0.531	S	S	.	.	H	α-helix	trans	-63.9	-34.7	172.5	0	0	0	0	0	112.5	S16 V17 A24	S16-A20 PolarHBondContact O-N 3.46Å; V17-A20 PolarHBondContact O-N 3.49Å; A20-A24 VanDerWaalsContact O-CB 3.28Å; A20-A24 WeakPolarHBondContact O-CB 3.28Å; A20-A24 PolarHBondContact O-N 3.29Å
21	W	78.9	Confident	73.8	Confident	179 Å²	179	103.2 Å²	103.2	68%	0.678	53%	0.531	S	S	*	.	H	α-helix	trans	-71.1	-38.9	175.5	-161.3	82.7	0	0	0	111.6	V17 H18 E19 T25	V17-W21 VanDerWaalsContact O-CB 3.27Å; V17-W21 WeakPolarHBondContact O-CB 3.19Å; V17-W21 PolarHBondContact O-N 2.84Å; H18-W21 PolarHBondContact O-N 3.48Å; E19-W21 VanDerWaalsContact C-N 3.29Å; E19-W21 PolarHBondContact O-N 3.18Å; W21-T25 WeakPolarHBondContact O-CB 3.33Å; W21-T25 PolarHBondContact O-N 3.37Å; W21-T25 PolarHBondContact O-OG1 3.47Å
22	N	76.8	Confident	75.6	Confident	102 Å²	102	100.4 Å²	100.4	55%	0.545	52%	0.52	S	S	.	.	H	α-helix	trans	-65.5	-42.4	174.1	-179.7	55.2	0	0	0	111.5	H18 E19 T25 N26	H18-N22 VanDerWaalsContact O-CB 3.27Å; H18-N22 WeakPolarHBondContact O-CB 3.32Å; H18-N22 PolarHBondContact O-N 2.96Å; E19-N22 PolarHBondContact O-N 3.42Å; N22-T25 PolarHBondContact O-N 2.83Å; N22-N26 VanDerWaalsContact O-CB 3.3Å; N22-N26 WeakPolarHBondContact O-CB 3.32Å; N22-N26 PolarHBondContact O-N 3.42Å
23	E	74.6	Confident	77.5	Confident	137 Å²	137	103 Å²	103	64%	0.64	53%	0.528	S	S	*	.	H	α-helix	trans	-63.3	-48.4	175.8	-170.6	175.6	-176.4	0	0	111.2	E19 T25 N26 V27	E19-E23 WeakPolarHBondContact O-CB 3.45Å; E19-E23 PolarHBondContact O-N 2.98Å; E23-T25 VanDerWaalsContact C-N 3.34Å; E23-T25 PolarHBondContact O-N 2.89Å; E23-N26 PolarHBondContact O-N 3.46Å; E23-V27 WeakPolarHBondContact O-CG2 3.15Å; E23-V27 PolarHBondContact O-N 2.92Å; E23-V27 VanDerWaalsContact O-N 3.08Å
24	A	81.3	Confident	79.4	Confident	40 Å²	40	103 Å²	103	33%	0.331	53%	0.532	S	S	.	.	H	α-helix	trans	-59.3	-44.6	174.7	0	0	0	0	0	111.7	A20 N26 V27 Y28	A20-A24 VanDerWaalsContact O-CB 3.28Å; A20-A24 WeakPolarHBondContact O-CB 3.28Å; A20-A24 PolarHBondContact O-N 3.29Å; A24-N26 PolarHBondContact O-N 3Å; A24-V27 WeakPolarHBondContact O-CB 3.43Å; A24-V27 PolarHBondContact O-N 2.88Å; A24-Y28 HydrophobicContact CB-CE2 4.19Å; A24-Y28 WeakPolarHBondContact O-CD2 3.24Å; A24-Y28 PolarHBondContact O-N 3.23Å
25	T	84.2	Confident	81.2	Confident	38 Å²	38	101.4 Å²	101.4	23%	0.233	53%	0.528	C	S	.	.	H	α-helix	trans	-62.6	-43.1	178.6	-60.8	0	0	0	0	111.4	W21 N22 E23 V27 Y28 L29	W21-T25 WeakPolarHBondContact O-CB 3.33Å; W21-T25 PolarHBondContact O-N 3.37Å; W21-T25 PolarHBondContact O-OG1 3.47Å; N22-T25 PolarHBondContact O-N 2.83Å; E23-T25 VanDerWaalsContact C-N 3.34Å; E23-T25 PolarHBondContact O-N 2.89Å; T25-V27 VanDerWaalsContact C-N 3.31Å; T25-V27 PolarHBondContact O-N 3.46Å; T25-Y28 CarbonylContact O-C 3.59Å; T25-Y28 PolarHBondContact O-N 2.75Å; T25-Y28 VanDerWaalsContact O-N 3.11Å; T25-L29 HydrophobicContact CG2-CD1 4.05Å; T25-L29 HydrophobicContact CG2-CG 4.21Å; T25-L29 VanDerWaalsContact O-CG 3.27Å; T25-L29 WeakPolarHBondContact O-CG 3.11Å; T25-L29 PolarHBondContact O-N 2.83Å
26	N	86.6	Confident	83	Confident	89 Å²	89	99.2 Å²	99.2	48%	0.476	52%	0.523	S	S	.	.	H	α-helix	trans	-63.1	-40.1	178.9	-161.9	9.6	0	0	0	111.2	N22 E23 A24 L29 L30	N22-N26 VanDerWaalsContact O-CB 3.3Å; N22-N26 WeakPolarHBondContact O-CB 3.32Å; N22-N26 PolarHBondContact O-N 3.42Å; E23-N26 PolarHBondContact O-N 3.46Å; A24-N26 PolarHBondContact O-N 3Å; N26-L29 PolarHBondContact O-N 2.82Å; N26-L30 WeakPolarHBondContact O-CG 3.29Å; N26-L30 PolarHBondContact O-N 2.77Å
27	V	88	Confident	84.4	Confident	84 Å²	84	97.8 Å²	97.8	51%	0.509	52%	0.519	S	S	.	.	H	α-helix	trans	-60.2	-46.2	171.7	175.4	0	0	0	0	111	E23 A24 T25 L29 L30 V31	E23-V27 WeakPolarHBondContact O-CG2 3.15Å; E23-V27 PolarHBondContact O-N 2.92Å; E23-V27 VanDerWaalsContact O-N 3.08Å; A24-V27 WeakPolarHBondContact O-CB 3.43Å; A24-V27 PolarHBondContact O-N 2.88Å; T25-V27 VanDerWaalsContact C-N 3.31Å; T25-V27 PolarHBondContact O-N 3.46Å; V27-L29 PolarHBondContact O-N 2.86Å; V27-L30 PolarHBondContact O-N 3.27Å; V27-V31 WeakPolarHBondContact O-CG2 3.17Å; V27-V31 PolarHBondContact O-N 2.86Å
28	Y	89.9	Confident	85.5	Confident	154 Å²	154	98.9 Å²	98.9	60%	0.604	52%	0.522	S	S	*	.	H	α-helix	trans	-62.3	-41.1	176.5	-69.7	-61.3	0	0	0	112.5	A24 T25 L30 V31 I32	A24-Y28 HydrophobicContact CB-CE2 4.19Å; A24-Y28 WeakPolarHBondContact O-CD2 3.24Å; A24-Y28 PolarHBondContact O-N 3.23Å; T25-Y28 CarbonylContact O-C 3.59Å; T25-Y28 PolarHBondContact O-N 2.75Å; T25-Y28 VanDerWaalsContact O-N 3.11Å; Y28-L30 VanDerWaalsContact C-N 3.33Å; Y28-L30 PolarHBondContact O-N 3.26Å; Y28-V31 PolarHBondContact O-N 2.89Å; Y28-I32 WeakPolarHBondContact O-CB 3.38Å; Y28-I32 WeakPolarHBondContact O-CD1 3.44Å; Y28-I32 WeakPolarHBondContact O-CG1 3.39Å; Y28-I32 PolarHBondContact O-N 2.67Å
29	L	91.3	Very high	86.4	Confident	91 Å²	91	97.5 Å²	97.5	48%	0.476	52%	0.518	S	S	.	.	H	α-helix	trans	-62.7	-40.1	177.6	-70.1	174.3	0	0	0	111.6	T25 N26 V27 I32 L33	T25-L29 HydrophobicContact CG2-CD1 4.05Å; T25-L29 HydrophobicContact CG2-CG 4.21Å; T25-L29 VanDerWaalsContact O-CG 3.27Å; T25-L29 WeakPolarHBondContact O-CG 3.11Å; T25-L29 PolarHBondContact O-N 2.83Å; N26-L29 PolarHBondContact O-N 2.82Å; V27-L29 PolarHBondContact O-N 2.86Å; L29-I32 PolarHBondContact O-N 3.02Å; L29-L33 WeakPolarHBondContact O-CB 3.48Å; L29-L33 WeakPolarHBondContact O-CG 3.27Å; L29-L33 PolarHBondContact O-N 2.77Å
30	L	91.2	Very high	87.1	Confident	101 Å²	101	98 Å²	98	53%	0.529	52%	0.522	S	S	.	.	H	α-helix	trans	-64.7	-44.6	173.7	-70.5	176.7	0	0	0	111.9	N26 V27 Y28 I32 L33 V34	N26-L30 WeakPolarHBondContact O-CG 3.29Å; N26-L30 PolarHBondContact O-N 2.77Å; V27-L30 PolarHBondContact O-N 3.27Å; Y28-L30 VanDerWaalsContact C-N 3.33Å; Y28-L30 PolarHBondContact O-N 3.26Å; L30-I32 VanDerWaalsContact C-N 3.31Å; L30-I32 PolarHBondContact O-N 2.88Å; L30-L33 PolarHBondContact O-N 2.79Å; L30-V34 WeakPolarHBondContact O-CB 3.4Å; L30-V34 VanDerWaalsContact O-CG2 3.27Å; L30-V34 WeakPolarHBondContact O-CG2 3.39Å; L30-V34 PolarHBondContact O-N 3.41Å
31	V	93.3	Very high	87.5	Confident	90 Å²	90	102.7 Å²	102.7	55%	0.545	53%	0.529	S	S	.	.	H	α-helix	trans	-61.2	-41.6	176.3	172.8	0	0	0	0	111	V27 Y28 V34 S35	V27-V31 WeakPolarHBondContact O-CG2 3.17Å; V27-V31 PolarHBondContact O-N 2.86Å; Y28-V31 PolarHBondContact O-N 2.89Å; V31-V34 PolarHBondContact O-N 2.66Å; V31-S35 WeakPolarHBondContact O-CB 3.46Å; V31-S35 PolarHBondContact O-N 2.85Å
32	I	93.3	Very high	87.4	Confident	94 Å²	94	96 Å²	96	48%	0.482	51%	0.512	S	S	.	.	H	α-helix	trans	-64.1	-44.8	176.7	-69.3	162.4	0	0	0	110.7	Y28 L29 L30 S35 F36	Y28-I32 WeakPolarHBondContact O-CB 3.38Å; Y28-I32 WeakPolarHBondContact O-CD1 3.44Å; Y28-I32 WeakPolarHBondContact O-CG1 3.39Å; Y28-I32 PolarHBondContact O-N 2.67Å; L29-I32 PolarHBondContact O-N 3.02Å; L30-I32 VanDerWaalsContact C-N 3.31Å; L30-I32 PolarHBondContact O-N 2.88Å; I32-S35 PolarHBondContact O-N 3.49Å; I32-F36 HydrophobicContact CG2-CD2 4.25Å; I32-F36 WeakPolarHBondContact O-CB 3.44Å; I32-F36 PolarHBondContact O-N 3.02Å
33	L	94.6	Very high	87.3	Confident	121 Å²	121	99 Å²	99	63%	0.634	52%	0.516	S	S	*	.	H	α-helix	trans	-62.9	-45	176.9	-83.3	168.1	0	0	0	112.2	L29 L30 S35 F36 G37	L29-L33 WeakPolarHBondContact O-CB 3.48Å; L29-L33 WeakPolarHBondContact O-CG 3.27Å; L29-L33 PolarHBondContact O-N 2.77Å; L30-L33 PolarHBondContact O-N 2.79Å; L33-S35 VanDerWaalsContact C-N 3.34Å; L33-F36 PolarHBondContact O-N 2.93Å; L33-G37 PolarHBondContact O-N 2.94Å
34	V	94.5	Very high	87.2	Confident	91 Å²	91	101.2 Å²	101.2	55%	0.552	52%	0.523	S	S	*	.	H	α-helix	trans	-63.1	-43	176.5	171.3	0	0	0	0	110.4	L30 V31 G37 L38	L30-V34 WeakPolarHBondContact O-CB 3.4Å; L30-V34 VanDerWaalsContact O-CG2 3.27Å; L30-V34 WeakPolarHBondContact O-CG2 3.39Å; L30-V34 PolarHBondContact O-N 3.41Å; V31-V34 PolarHBondContact O-N 2.66Å; V34-G37 PolarHBondContact O-N 3.49Å; V34-L38 HydrophobicContact CG1-CD1 3.8Å; V34-L38 WeakPolarHBondContact O-CB 3.31Å; V34-L38 WeakPolarHBondContact O-CG 3.09Å; V34-L38 PolarHBondContact O-N 3.39Å
35	S	93.3	Very high	86.5	Confident	68 Å²	68	101.3 Å²	101.3	48%	0.476	52%	0.518	S	S	.	.	H	α-helix	trans	-60.6	-47	174.7	-177.2	0	0	0	0	111.6	V31 I32 L33 G37 L38 L39	V31-S35 WeakPolarHBondContact O-CB 3.46Å; V31-S35 PolarHBondContact O-N 2.85Å; I32-S35 PolarHBondContact O-N 3.49Å; L33-S35 VanDerWaalsContact C-N 3.34Å; S35-G37 PolarHBondContact O-N 3.19Å; S35-L38 PolarHBondContact O-N 2.59Å; S35-L39 WeakPolarHBondContact O-CB 3.39Å; S35-L39 PolarHBondContact O-N 3.16Å
36	F	94.2	Very high	85.6	Confident	136 Å²	136	104.1 Å²	104.1	60%	0.596	53%	0.527	S	S	*	.	H	α-helix	trans	-63.1	-40.3	175.8	-110.6	-83.4	0	0	0	112.2	I32 L33 L39 M40	I32-F36 HydrophobicContact CG2-CD2 4.25Å; I32-F36 WeakPolarHBondContact O-CB 3.44Å; I32-F36 PolarHBondContact O-N 3.02Å; L33-F36 PolarHBondContact O-N 2.93Å; F36-L39 PolarHBondContact O-N 3.02Å; F36-M40 WeakPolarHBondContact O-CB 3.31Å; F36-M40 PolarHBondContact O-N 2.86Å
37	G	91.7	Very high	84.4	Confident	42 Å²	42	111.1 Å²	111.1	43%	0.433	55%	0.547	S	S	.	.	H	α-helix	trans	-63.1	-46.9	176.2	0	0	0	0	0	112.2	L33 V34 S35 M40 Y41	L33-G37 PolarHBondContact O-N 2.94Å; V34-G37 PolarHBondContact O-N 3.49Å; S35-G37 PolarHBondContact O-N 3.19Å; G37-M40 PolarHBondContact O-N 2.79Å; G37-Y41 WeakPolarHBondContact O-CB 3.34Å; G37-Y41 PolarHBondContact O-N 3.44Å
38	L	88.4	Confident	83.2	Confident	112 Å²	112	114 Å²	114	59%	0.586	55%	0.553	S	S	*	*	H	α-helix	trans	-61.8	-43.4	173.8	-78.5	160.1	0	0	0	111.4	V34 S35 Y41 A42	V34-L38 HydrophobicContact CG1-CD1 3.8Å; V34-L38 WeakPolarHBondContact O-CB 3.31Å; V34-L38 WeakPolarHBondContact O-CG 3.09Å; V34-L38 PolarHBondContact O-N 3.39Å; S35-L38 PolarHBondContact O-N 2.59Å; L38-Y41 PolarHBondContact O-N 3.06Å; L38-A42 VanDerWaalsContact O-CB 3.25Å; L38-A42 WeakPolarHBondContact O-CB 3.47Å; L38-A42 PolarHBondContact O-N 3.04Å
39	L	84.4	Confident	81.9	Confident	94 Å²	94	110.4 Å²	110.4	49%	0.492	54%	0.543	S	S	.	.	H	α-helix	trans	-66.9	-40.5	178.2	-173.8	139.9	0	0	0	111.6	S35 F36 R43	S35-L39 WeakPolarHBondContact O-CB 3.39Å; S35-L39 PolarHBondContact O-N 3.16Å; F36-L39 PolarHBondContact O-N 3.02Å; L39-R43 VanDerWaalsContact O-CB 3.28Å; L39-R43 WeakPolarHBondContact O-CB 3.15Å; L39-R43 PolarHBondContact O-N 3.46Å
40	M	85.2	Confident	80.4	Confident	138 Å²	138	112.4 Å²	112.4	68%	0.68	55%	0.552	S	S	*	*	H	α-helix	trans	-67.3	-40.6	173.8	-113.8	-145.7	160.2	0	0	111.5	F36 G37 R43 K44	F36-M40 WeakPolarHBondContact O-CB 3.31Å; F36-M40 PolarHBondContact O-N 2.86Å; G37-M40 PolarHBondContact O-N 2.79Å; M40-R43 CarbonylContact O-C 3.41Å; M40-R43 WeakPolarHBondContact O-CA 3.2Å; M40-R43 WeakPolarHBondContact O-CB 3.39Å; M40-R43 PolarHBondContact O-N 3.06Å; M40-K44 WeakPolarHBondContact O-CB 3.49Å; M40-K44 PolarHBondContact O-N 2.92Å
41	Y	81.8	Confident	79.1	Confident	155 Å²	155	117.2 Å²	117.2	61%	0.608	56%	0.563	S	S	*	*	H	α-helix	trans	-63.8	-45.8	176.5	-177.2	-95.6	0	0	0	111	G37 L38 K44 N45	G37-Y41 WeakPolarHBondContact O-CB 3.34Å; G37-Y41 PolarHBondContact O-N 3.44Å; L38-Y41 PolarHBondContact O-N 3.06Å; Y41-K44 PolarHBondContact O-N 3.22Å; Y41-K44 VanDerWaalsContact O-N 3.12Å; Y41-N45 VanDerWaalsContact CE1-ND2 3.35Å; Y41-N45 WeakPolarHBondContact CE1-ND2 3.47Å; Y41-N45 VanDerWaalsContact CE2-ND2 3.33Å; Y41-N45 WeakPolarHBondContact CE2-ND2 3.13Å; Y41-N45 WeakPolarHBondContact O-CB 3.21Å; Y41-N45 PolarHBondContact O-N 3.16Å; Y41-N45 PolarHBondContact O-ND2 3.08Å
42	A	76.3	Confident	77.8	Confident	40 Å²	40	119.3 Å²	119.3	33%	0.331	57%	0.57	S	S	.	*	H	α-helix	trans	-62.5	-40	171.7	0	0	0	0	0	111.5	L38 K44 N45 K46	L38-A42 VanDerWaalsContact O-CB 3.25Å; L38-A42 WeakPolarHBondContact O-CB 3.47Å; L38-A42 PolarHBondContact O-N 3.04Å; A42-K44 VanDerWaalsContact C-N 3.33Å; A42-K44 PolarHBondContact O-N 3.26Å; A42-N45 CarbonylContact O-C 3.34Å; A42-N45 PolarHBondContact O-N 2.82Å; A42-K46 VanDerWaalsContact O-CA 3.27Å; A42-K46 WeakPolarHBondContact O-CA 3.47Å; A42-K46 PolarHBondContact O-N 2.78Å
43	R	74.3	Confident	76.1	Confident	163 Å²	163	123.6 Å²	123.6	62%	0.615	59%	0.585	S	S	*	*	H	α-helix	trans	-65.2	-30.3	171.3	-106.2	-169.2	118.2	115.2	-8.1	112.3	L39 M40 K46	L39-R43 VanDerWaalsContact O-CB 3.28Å; L39-R43 WeakPolarHBondContact O-CB 3.15Å; L39-R43 PolarHBondContact O-N 3.46Å; M40-R43 CarbonylContact O-C 3.41Å; M40-R43 WeakPolarHBondContact O-CA 3.2Å; M40-R43 WeakPolarHBondContact O-CB 3.39Å; M40-R43 PolarHBondContact O-N 3.06Å; R43-K46 VanDerWaalsContact C-CE 3.5Å; R43-K46 HydrophobicContact CB-CD 4.47Å; R43-K46 HydrophobicContact CG-CD 4.26Å; R43-K46 VanDerWaalsContact O-CD 3.26Å; R43-K46 WeakPolarHBondContact O-CD 2.96Å; R43-K46 WeakPolarHBondContact O-CE 3.22Å; R43-K46 WeakPolarHBondContact O-CG 3.12Å
44	K	72.7	Confident	74.3	Confident	185 Å²	185	120.4 Å²	120.4	80%	0.804	58%	0.576	S	S	*	*	H	α-helix	trans	-80.7	-32.3	178.8	-159.1	169.2	178.5	177.2	0	110.1	M40 Y41 A42	M40-K44 WeakPolarHBondContact O-CB 3.49Å; M40-K44 PolarHBondContact O-N 2.92Å; Y41-K44 PolarHBondContact O-N 3.22Å; Y41-K44 VanDerWaalsContact O-N 3.12Å; A42-K44 VanDerWaalsContact C-N 3.33Å; A42-K44 PolarHBondContact O-N 3.26Å
45	N	67.4	Low	72.2	Confident	42 Å²	42	122.5 Å²	122.5	23%	0.225	58%	0.584	C	S	.	*	S	Bend	trans	-102.6	20.1	-178.9	-65.2	-34.5	0	0	0	114	Y41 A42 R47 K48 I49	Y41-N45 VanDerWaalsContact CE1-ND2 3.35Å; Y41-N45 WeakPolarHBondContact CE1-ND2 3.47Å; Y41-N45 VanDerWaalsContact CE2-ND2 3.33Å; Y41-N45 WeakPolarHBondContact CE2-ND2 3.13Å; Y41-N45 WeakPolarHBondContact O-CB 3.21Å; Y41-N45 PolarHBondContact O-N 3.16Å; Y41-N45 PolarHBondContact O-ND2 3.08Å; A42-N45 CarbonylContact O-C 3.34Å; A42-N45 PolarHBondContact O-N 2.82Å; N45-R47 PolarHBondContact O-N 3.47Å; N45-R47 VanDerWaalsContact O-N 3.08Å; N45-K48 WeakPolarHBondContact O-CA 3.17Å; N45-K48 PolarHBondContact O-N 2.81Å; N45-I49 PolarHBondContact O-N 2.86Å
46	K	65.1	Low	70.2	Confident	97 Å²	97	124.7 Å²	124.7	42%	0.422	60%	0.596	S	S	.	*	H	α-helix	trans	-52.7	-39.2	-174.5	-13.7	-166.7	-173.8	-178.8	0	112.4	A42 R43 K48 M50	A42-K46 VanDerWaalsContact O-CA 3.27Å; A42-K46 WeakPolarHBondContact O-CA 3.47Å; A42-K46 PolarHBondContact O-N 2.78Å; R43-K46 VanDerWaalsContact C-CE 3.5Å; R43-K46 HydrophobicContact CB-CD 4.47Å; R43-K46 HydrophobicContact CG-CD 4.26Å; R43-K46 VanDerWaalsContact O-CD 3.26Å; R43-K46 WeakPolarHBondContact O-CD 2.96Å; R43-K46 WeakPolarHBondContact O-CE 3.22Å; R43-K46 WeakPolarHBondContact O-CG 3.12Å; K46-K48 VanDerWaalsContact C-N 3.26Å; K46-K48 PolarHBondContact O-N 3.36Å; K46-M50 WeakPolarHBondContact O-CB 3.48Å; K46-M50 PolarHBondContact O-N 3.37Å
47	R	61.2	Low	68.1	Low	235 Å²	235	123.4 Å²	123.4	89%	0.887	60%	0.601	S	S	*	*	H	α-helix	trans	-64.7	-27.6	178.5	-64.4	-173.4	-169.5	172.1	3.2	113.2	N45	N45-R47 PolarHBondContact O-N 3.47Å; N45-R47 VanDerWaalsContact O-N 3.08Å
48	K	63.2	Low	65.8	Low	146 Å²	146	126.7 Å²	126.7	64%	0.635	61%	0.613	S	S	*	*	H	α-helix	trans	-87.8	-42.2	177.9	-70.3	-172.7	177.5	-177.3	0	112.1	N45 K46 R51 I52	N45-K48 WeakPolarHBondContact O-CA 3.17Å; N45-K48 PolarHBondContact O-N 2.81Å; K46-K48 VanDerWaalsContact C-N 3.26Å; K46-K48 PolarHBondContact O-N 3.36Å; K48-R51 VanDerWaalsContact O-CB 3.28Å; K48-R51 WeakPolarHBondContact O-CB 3.44Å; K48-R51 PolarHBondContact O-N 3.47Å; K48-I52 WeakPolarHBondContact O-CD1 3.09Å; K48-I52 WeakPolarHBondContact O-CG1 3.28Å; K48-I52 PolarHBondContact O-N 2.8Å
49	I	63.1	Low	63.7	Low	78 Å²	78	126.6 Å²	126.6	40%	0.4	63%	0.628	S	S	.	*	H	α-helix	trans	-69.1	-42.1	178	-103.5	73.3	0	0	0	111.5	N45 R51 I52 F53	N45-I49 PolarHBondContact O-N 2.86Å; I49-R51 PolarHBondContact O-N 3.36Å; I49-R51 VanDerWaalsContact O-N 3.16Å; I49-I52 PolarHBondContact O-N 3.22Å; I49-F53 PolarHBondContact O-N 2.89Å
50	M	60.1	Low	61.9	Low	133 Å²	133	124.8 Å²	124.8	66%	0.655	63%	0.632	S	S	*	*	H	α-helix	trans	-60.9	-25.2	174.2	-170.7	-178.2	-78.5	0	0	111.2	K46 A54	K46-M50 WeakPolarHBondContact O-CB 3.48Å; K46-M50 PolarHBondContact O-N 3.37Å; M50-A54 WeakPolarHBondContact O-CB 3.35Å; M50-A54 PolarHBondContact O-N 2.71Å
51	R	62.7	Low	59.8	Low	202 Å²	202	122.6 Å²	122.6	76%	0.762	64%	0.637	S	S	*	*	H	α-helix	trans	-76.4	-20.5	176.6	-156	-178.5	-164.7	146.9	4	114	K48 I49	K48-R51 VanDerWaalsContact O-CB 3.28Å; K48-R51 WeakPolarHBondContact O-CB 3.44Å; K48-R51 PolarHBondContact O-N 3.47Å; I49-R51 PolarHBondContact O-N 3.36Å; I49-R51 VanDerWaalsContact O-N 3.16Å
52	I	67	Low	57.8	Low	134 Å²	134	119.7 Å²	119.7	69%	0.687	64%	0.635	S	S	*	*	H	α-helix	trans	-101.9	-32.9	-175.8	-59.2	159.4	0	0	0	110.9	K48 I49	K48-I52 WeakPolarHBondContact O-CD1 3.09Å; K48-I52 WeakPolarHBondContact O-CG1 3.28Å; K48-I52 PolarHBondContact O-N 2.8Å; I49-I52 PolarHBondContact O-N 3.22Å
53	F	57.6	Low	56.3	Low	183 Å²	183	124.4 Å²	124.4	80%	0.803	66%	0.66	S	S	*	*	H	α-helix	trans	-96.7	-23.3	177.9	-93.4	-82	0	0	0	114.6	I49 L55	I49-F53 PolarHBondContact O-N 2.89Å; F53-L55 PolarHBondContact O-N 3.12Å
54	A	55.4	Low	54.8	Low	54 Å²	54	122.4 Å²	122.4	45%	0.446	66%	0.658	S	S	.	*	S	Bend	trans	-70.3	130.1	158.9	0	0	0	0	0	106.2	M50	M50-A54 WeakPolarHBondContact O-CB 3.35Å; M50-A54 PolarHBondContact O-N 2.71Å
55	L	50.1	Low	53.8	Low	136 Å²	136	118.8 Å²	118.8	71%	0.712	65%	0.653	S	S	*	*			trans	-27.8	151	165.2	-83.6	63.2	0	0	0	112.2	F53	F53-L55 PolarHBondContact O-N 3.12Å
56	P	51.2	Low	53.3	Low	114 Å²	114	120.5 Å²	120.5	74%	0.74	66%	0.662	S	S	*	*	S	Bend	trans	-38.8	123.5	172.2	19.5	-33.6	0	0	0	106.9	T58	P56-T58 PolarHBondContact O-N 2.85Å
57	P	51.2	Low	52.7	Low	109 Å²	109	121.2 Å²	121.2	71%	0.708	67%	0.665	S	S	*	*			trans	-42.7	111.7	-164.3	17.4	-31.9	0	0	0	106.1	A59	P57-A59 VanDerWaalsContact C-N 3.31Å; P57-A59 PolarHBondContact O-N 3.38Å
58	T	43.4	Very low	52.2	Low	111 Å²	111	118.4 Å²	118.4	68%	0.681	66%	0.656	S	S	*	*			trans	-43.5	114	165.2	31.5	0	0	0	0	103.5	P56 G60 A61	P56-T58 PolarHBondContact O-N 2.85Å; T58-G60 WeakPolarHBondContact O-CA 3.33Å; T58-G60 PolarHBondContact O-N 3.36Å; T58-A61 PolarHBondContact O-N 2.82Å
59	A	44.9	Very low	51.9	Low	109 Å²	109	114.7 Å²	114.7	90%	0.901	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.7	88.2	177.8	0	0	0	0	0	106.6	P57	P57-A59 VanDerWaalsContact C-N 3.31Å; P57-A59 PolarHBondContact O-N 3.38Å
60	G	45.3	Very low	51.7	Low	56 Å²	56	113.5 Å²	113.5	58%	0.577	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	172.6	-14.9	-157.7	0	0	0	0	0	115	T58 T62	T58-G60 WeakPolarHBondContact O-CA 3.33Å; T58-G60 PolarHBondContact O-N 3.36Å; G60-T62 VanDerWaalsContact C-N 3.33Å
61	A	41.3	Very low	51.6	Low	93 Å²	93	111 Å²	111	77%	0.769	63%	0.63	S	S	*	*			trans	-104.6	43.7	149.4	0	0	0	0	0	109.7	T58 T63	T58-A61 PolarHBondContact O-N 2.82Å; A61-T63 PolarHBondContact O-N 3.39Å
62	T	40.6	Very low	51.3	Low	94 Å²	94	107.1 Å²	107.1	58%	0.577	62%	0.621	S	S	*	*	S	Bend	trans	-51.5	119.7	135	49.4	0	0	0	0	103.8	G60 E64	G60-T62 VanDerWaalsContact C-N 3.33Å; T62-E64 PolarHBondContact O-N 3.46Å
63	T	44.3	Very low	50.8	Low	139 Å²	139	106.8 Å²	106.8	85%	0.853	61%	0.614	S	S	*	*			trans	-44.7	97.8	145.8	-1	0	0	0	0	103.4	A61 P65	A61-T63 PolarHBondContact O-N 3.39Å; T63-P65 WeakPolarHBondContact O-CD 3.35Å
64	E	42.7	Very low	50.8	Low	121 Å²	121	102 Å²	102	57%	0.565	60%	0.6	S	S	*	*			trans	-45.7	117.1	179.2	-171.1	178.4	173.1	0	0	103.1	T62 N66 F67	T62-E64 PolarHBondContact O-N 3.46Å; E64-N66 PolarHBondContact O-N 2.77Å; E64-F67 HydrophobicContact CG-CB 3.98Å; E64-F67 HydrophobicContact CG-CD2 3.67Å; E64-F67 HydrophobicContact CG-CG 4.26Å; E64-F67 WeakPolarHBondContact OE1-CB 3.46Å; E64-F67 VanDerWaalsContact OE1-CD2 3.31Å; E64-F67 WeakPolarHBondContact OE1-CD2 2.8Å; E64-F67 VanDerWaalsContact OE1-CG 3.31Å; E64-F67 WeakPolarHBondContact OE1-CG 3.26Å
65	P	51.5	Low	50.9	Low	108 Å²	108	107.9 Å²	107.9	70%	0.701	61%	0.611	S	S	*	*			trans	-65.7	86	-176.7	23.8	-30.5	0	0	0	105.9	T63 F67	T63-P65 WeakPolarHBondContact O-CD 3.35Å; P65-F67 VanDerWaalsContact C-N 3.34Å; P65-F67 PolarHBondContact O-N 2.82Å
66	N	56.5	Low	51.3	Low	78 Å²	78	106.2 Å²	106.2	42%	0.417	60%	0.602	S	S	.	*			trans	19.6	71.1	179.8	-156.8	-23.2	0	0	0	112.4	E64 Y68 D69 S70	E64-N66 PolarHBondContact O-N 2.77Å; N66-Y68 PolarHBondContact O-N 2.82Å; N66-Y68 VanDerWaalsContact O-N 3.16Å; N66-D69 HydrophobicContact CB-CB 3.72Å; N66-D69 VanDerWaalsContact CG-OD2 3.3Å; N66-D69 PolarHBondContact ND2-OD1 3.3Å; N66-D69 PolarHBondContact ND2-OD2 3.3Å; N66-D69 CarbonylContact O-C 3.58Å; N66-D69 WeakPolarHBondContact O-CA 3.2Å; N66-D69 WeakPolarHBondContact O-CB 3.4Å; N66-D69 PolarHBondContact O-N 2.87Å; N66-D69 WeakPolarHBondContact OD1-CB 3.28Å; N66-D69 PolarHBondContact OD1-N 2.76Å; N66-S70 PolarHBondContact O-N 3.46Å
67	F	53.3	Low	51.6	Low	112 Å²	112	109.1 Å²	109.1	49%	0.491	60%	0.598	S	S	.	*	H	α-helix	trans	-57.5	-27.2	177.2	-121.8	-89.7	0	0	0	110.8	E64 P65 S70 L71	E64-F67 HydrophobicContact CG-CB 3.98Å; E64-F67 HydrophobicContact CG-CD2 3.67Å; E64-F67 HydrophobicContact CG-CG 4.26Å; E64-F67 WeakPolarHBondContact OE1-CB 3.46Å; E64-F67 VanDerWaalsContact OE1-CD2 3.31Å; E64-F67 WeakPolarHBondContact OE1-CD2 2.8Å; E64-F67 VanDerWaalsContact OE1-CG 3.31Å; E64-F67 WeakPolarHBondContact OE1-CG 3.26Å; P65-F67 VanDerWaalsContact C-N 3.34Å; P65-F67 PolarHBondContact O-N 2.82Å; F67-S70 WeakPolarHBondContact CA-OG 2.68Å; F67-S70 PolarHBondContact O-OG 3.41Å; F67-L71 HydrophobicContact CD1-CD1 4.33Å; F67-L71 WeakPolarHBondContact O-CB 3.27Å; F67-L71 WeakPolarHBondContact O-CD1 3.44Å; F67-L71 WeakPolarHBondContact O-CG 3.25Å; F67-L71 PolarHBondContact O-N 3.4Å
68	Y	50.6	Low	52.1	Low	177 Å²	177	109.8 Å²	109.8	69%	0.694	59%	0.592	S	S	*	*	H	α-helix	trans	-69.6	-42.8	170.7	-93.7	-90.8	0	0	0	112.8	N66 L71 Q72	N66-Y68 PolarHBondContact O-N 2.82Å; N66-Y68 VanDerWaalsContact O-N 3.16Å; Y68-L71 PolarHBondContact O-N 2.85Å; Y68-Q72 WeakPolarHBondContact O-CB 3.4Å; Y68-Q72 WeakPolarHBondContact O-CG 3.21Å; Y68-Q72 PolarHBondContact O-N 3.48Å
69	D	57.2	Low	52.7	Low	68 Å²	68	110.2 Å²	110.2	36%	0.364	59%	0.586	S	S	.	*	H	α-helix	trans	-66	-36.9	171.8	-84.7	-1.1	0	0	0	111.9	N66 K73	N66-D69 HydrophobicContact CB-CB 3.72Å; N66-D69 VanDerWaalsContact CG-OD2 3.3Å; N66-D69 PolarHBondContact ND2-OD1 3.3Å; N66-D69 PolarHBondContact ND2-OD2 3.3Å; N66-D69 CarbonylContact O-C 3.58Å; N66-D69 WeakPolarHBondContact O-CA 3.2Å; N66-D69 WeakPolarHBondContact O-CB 3.4Å; N66-D69 PolarHBondContact O-N 2.87Å; N66-D69 WeakPolarHBondContact OD1-CB 3.28Å; N66-D69 PolarHBondContact OD1-N 2.76Å; D69-K73 WeakPolarHBondContact O-CB 3.34Å; D69-K73 WeakPolarHBondContact O-CG 3.38Å; D69-K73 PolarHBondContact O-N 2.87Å
70	S	58.8	Low	53.4	Low	52 Å²	52	110.3 Å²	110.3	36%	0.364	57%	0.571	S	S	.	*	H	α-helix	trans	-69.3	-43.6	177.5	73.8	0	0	0	0	110.4	N66 F67 K73 V74	N66-S70 PolarHBondContact O-N 3.46Å; F67-S70 WeakPolarHBondContact CA-OG 2.68Å; F67-S70 PolarHBondContact O-OG 3.41Å; S70-K73 PolarHBondContact O-N 3Å; S70-V74 WeakPolarHBondContact O-CB 3.47Å; S70-V74 WeakPolarHBondContact O-CG2 3.34Å; S70-V74 PolarHBondContact O-N 3.27Å
71	L	57	Low	54	Low	80 Å²	80	113.4 Å²	113.4	42%	0.419	57%	0.57	S	S	.	*	H	α-helix	trans	-65.8	-40.6	173.8	-74.7	170.3	0	0	0	112.7	F67 Y68 V74 R75	F67-L71 HydrophobicContact CD1-CD1 4.33Å; F67-L71 WeakPolarHBondContact O-CB 3.27Å; F67-L71 WeakPolarHBondContact O-CD1 3.44Å; F67-L71 WeakPolarHBondContact O-CG 3.25Å; F67-L71 PolarHBondContact O-N 3.4Å; Y68-L71 PolarHBondContact O-N 2.85Å; L71-V74 PolarHBondContact O-N 3.34Å; L71-R75 WeakPolarHBondContact O-CG 3.27Å; L71-R75 PolarHBondContact O-N 3.43Å
72	Q	57.4	Low	54.8	Low	122 Å²	122	116 Å²	116	57%	0.57	57%	0.568	S	S	*	*	H	α-helix	trans	-67.2	-40.8	174.8	-77.6	-178.3	-27.4	0	0	111.2	Y68 V74 R75 L76	Y68-Q72 WeakPolarHBondContact O-CB 3.4Å; Y68-Q72 WeakPolarHBondContact O-CG 3.21Å; Y68-Q72 PolarHBondContact O-N 3.48Å; Q72-V74 VanDerWaalsContact C-N 3.34Å; Q72-R75 PolarHBondContact O-N 2.91Å; Q72-L76 WeakPolarHBondContact O-CB 3.38Å; Q72-L76 PolarHBondContact O-N 2.82Å
73	K	55.7	Low	55.6	Low	127 Å²	127	120.3 Å²	120.3	55%	0.552	58%	0.575	S	S	*	*	H	α-helix	trans	-64.8	-36.3	172.7	-81.1	174.2	178.8	168.5	0	112.2	D69 S70 R77	D69-K73 WeakPolarHBondContact O-CB 3.34Å; D69-K73 WeakPolarHBondContact O-CG 3.38Å; D69-K73 PolarHBondContact O-N 2.87Å; S70-K73 PolarHBondContact O-N 3Å; K73-R77 WeakPolarHBondContact O-CB 3.46Å; K73-R77 VanDerWaalsContact O-CG 3.29Å; K73-R77 WeakPolarHBondContact O-CG 3.45Å; K73-R77 PolarHBondContact O-N 3.3Å
74	V	57.7	Low	56.3	Low	83 Å²	83	116.8 Å²	116.8	50%	0.503	56%	0.556	S	S	.	*	H	α-helix	trans	-69.4	-45.5	177.3	169	0	0	0	0	110.7	S70 L71 Q72 Q78	S70-V74 WeakPolarHBondContact O-CB 3.47Å; S70-V74 WeakPolarHBondContact O-CG2 3.34Å; S70-V74 PolarHBondContact O-N 3.27Å; L71-V74 PolarHBondContact O-N 3.34Å; Q72-V74 VanDerWaalsContact C-N 3.34Å; V74-Q78 WeakPolarHBondContact O-CB 3.5Å; V74-Q78 PolarHBondContact O-N 3.48Å
75	R	58.6	Low	57	Low	177 Å²	177	115.6 Å²	115.6	67%	0.668	55%	0.553	S	S	*	*	H	α-helix	trans	-66.7	-41.2	176.7	-70.3	-179.6	-177.7	176.9	1.3	112.4	L71 Q72 Q78 Q79	L71-R75 WeakPolarHBondContact O-CG 3.27Å; L71-R75 PolarHBondContact O-N 3.43Å; Q72-R75 PolarHBondContact O-N 2.91Å; R75-Q78 PolarHBondContact O-N 2.99Å; R75-Q79 WeakPolarHBondContact O-CB 3.21Å; R75-Q79 PolarHBondContact O-N 3.11Å
76	L	58.7	Low	57.3	Low	100 Å²	100	113.1 Å²	113.1	52%	0.524	54%	0.542	S	S	.	.	H	α-helix	trans	-69.1	-40	177.8	-175	65.2	0	0	0	111.7	Q72 Q79 L80	Q72-L76 WeakPolarHBondContact O-CB 3.38Å; Q72-L76 PolarHBondContact O-N 2.82Å; L76-Q79 PolarHBondContact O-N 3.08Å; L76-L80 HydrophobicContact CD1-CD1 4.15Å; L76-L80 HydrophobicContact CG-CD1 4.05Å; L76-L80 WeakPolarHBondContact O-CB 2.9Å; L76-L80 PolarHBondContact O-N 3.3Å
77	R	57.9	Low	57.3	Low	175 Å²	175	118.9 Å²	118.9	66%	0.66	56%	0.558	S	S	*	*	H	α-helix	trans	-66	-42.3	173	-81.6	-170.1	175.1	156.4	-1.8	112	K73 Q79 L80 E81	K73-R77 WeakPolarHBondContact O-CB 3.46Å; K73-R77 VanDerWaalsContact O-CG 3.29Å; K73-R77 WeakPolarHBondContact O-CG 3.45Å; K73-R77 PolarHBondContact O-N 3.3Å; R77-Q79 VanDerWaalsContact C-N 3.33Å; R77-Q79 PolarHBondContact O-N 3.42Å; R77-L80 PolarHBondContact O-N 2.84Å; R77-E81 WeakPolarHBondContact O-CB 3.18Å; R77-E81 WeakPolarHBondContact O-CG 3.43Å; R77-E81 PolarHBondContact O-N 2.98Å
78	Q	60	Low	57.4	Low	124 Å²	124	120 Å²	120	58%	0.579	56%	0.562	S	S	*	*	H	α-helix	trans	-62.2	-40.5	174.3	-100.7	177.2	-31.9	0	0	112.2	V74 R75 E81 M82	V74-Q78 WeakPolarHBondContact O-CB 3.5Å; V74-Q78 PolarHBondContact O-N 3.48Å; R75-Q78 PolarHBondContact O-N 2.99Å; Q78-E81 PolarHBondContact O-N 3.46Å; Q78-M82 WeakPolarHBondContact O-CB 3.44Å; Q78-M82 PolarHBondContact O-N 3.25Å
79	Q	57.6	Low	57.7	Low	120 Å²	120	117.9 Å²	117.9	56%	0.561	56%	0.557	S	S	*	*	H	α-helix	trans	-64.4	-44.1	174	-81.2	-179.6	-22.9	0	0	111.6	R75 L76 R77 M82 Y83	R75-Q79 WeakPolarHBondContact O-CB 3.21Å; R75-Q79 PolarHBondContact O-N 3.11Å; L76-Q79 PolarHBondContact O-N 3.08Å; R77-Q79 VanDerWaalsContact C-N 3.33Å; R77-Q79 PolarHBondContact O-N 3.42Å; Q79-M82 PolarHBondContact O-N 2.81Å; Q79-Y83 WeakPolarHBondContact O-CB 3.3Å; Q79-Y83 VanDerWaalsContact O-CD2 3.27Å; Q79-Y83 WeakPolarHBondContact O-CD2 3.5Å; Q79-Y83 PolarHBondContact O-N 2.82Å
80	L	58.4	Low	57.6	Low	110 Å²	110	119 Å²	119	58%	0.576	56%	0.563	S	S	*	*	H	α-helix	trans	-66.5	-35.5	176.3	-103	127.3	0	0	0	113.2	L76 R77 S84	L76-L80 HydrophobicContact CD1-CD1 4.15Å; L76-L80 HydrophobicContact CG-CD1 4.05Å; L76-L80 WeakPolarHBondContact O-CB 2.9Å; L76-L80 PolarHBondContact O-N 3.3Å; R77-L80 PolarHBondContact O-N 2.84Å; L80-S84 VanDerWaalsContact O-CB 3.24Å; L80-S84 WeakPolarHBondContact O-CB 3.27Å; L80-S84 PolarHBondContact O-N 3.45Å; L80-S84 PolarHBondContact O-OG 3.36Å
81	E	58	Low	57.4	Low	122 Å²	122	122.9 Å²	122.9	57%	0.57	58%	0.575	S	S	*	*	H	α-helix	trans	-66.7	-41.3	172.3	-76.6	178.8	-174.1	0	0	110.6	R77 Q78 S84 L85	R77-E81 WeakPolarHBondContact O-CB 3.18Å; R77-E81 WeakPolarHBondContact O-CG 3.43Å; R77-E81 PolarHBondContact O-N 2.98Å; Q78-E81 PolarHBondContact O-N 3.46Å; E81-S84 WeakPolarHBondContact CA-OG 3.42Å; E81-S84 PolarHBondContact O-N 3.3Å; E81-S84 PolarHBondContact O-OG 2.99Å; E81-L85 WeakPolarHBondContact O-CB 3.28Å; E81-L85 PolarHBondContact O-N 2.66Å
82	M	59	Low	57.2	Low	148 Å²	148	125.3 Å²	125.3	73%	0.729	59%	0.585	S	S	*	*	H	α-helix	trans	-65.2	-43.4	173.2	-115.4	-125.2	177	0	0	112.3	Q78 Q79 A86	Q78-M82 WeakPolarHBondContact O-CB 3.44Å; Q78-M82 PolarHBondContact O-N 3.25Å; Q79-M82 PolarHBondContact O-N 2.81Å; M82-A86 WeakPolarHBondContact O-CB 3.38Å; M82-A86 PolarHBondContact O-N 2.83Å
83	Y	57.1	Low	56.9	Low	184 Å²	184	125.3 Å²	125.3	72%	0.722	59%	0.585	S	S	*	*	H	α-helix	trans	-67.4	-38.6	177.8	-91.1	-80.1	0	0	0	112.2	Q79 R87	Q79-Y83 WeakPolarHBondContact O-CB 3.3Å; Q79-Y83 VanDerWaalsContact O-CD2 3.27Å; Q79-Y83 WeakPolarHBondContact O-CD2 3.5Å; Q79-Y83 PolarHBondContact O-N 2.82Å; Y83-R87 WeakPolarHBondContact O-CB 3.44Å; Y83-R87 PolarHBondContact O-N 3.42Å
84	S	59.3	Low	56.6	Low	64 Å²	64	125.2 Å²	125.2	45%	0.448	59%	0.586	S	S	.	*	H	α-helix	trans	-74.4	-36.1	176.8	62.2	0	0	0	0	112.6	L80 E81 R87 K88	L80-S84 VanDerWaalsContact O-CB 3.24Å; L80-S84 WeakPolarHBondContact O-CB 3.27Å; L80-S84 PolarHBondContact O-N 3.45Å; L80-S84 PolarHBondContact O-OG 3.36Å; E81-S84 WeakPolarHBondContact CA-OG 3.42Å; E81-S84 PolarHBondContact O-N 3.3Å; E81-S84 PolarHBondContact O-OG 2.99Å; S84-R87 PolarHBondContact O-N 3.41Å; S84-K88 WeakPolarHBondContact O-CG 3.47Å; S84-K88 PolarHBondContact O-N 2.95Å
85	L	56.7	Low	56.1	Low	96 Å²	96	127 Å²	127	50%	0.503	59%	0.589	S	S	.	*	H	α-helix	trans	-67.7	-43.8	173	-169.1	64.7	0	0	0	110.6	E81 R87 K88 F89	E81-L85 WeakPolarHBondContact O-CB 3.28Å; E81-L85 PolarHBondContact O-N 2.66Å; L85-R87 VanDerWaalsContact C-N 3.32Å; L85-R87 PolarHBondContact O-N 2.86Å; L85-K88 PolarHBondContact O-N 2.86Å; L85-F89 HydrophobicContact CD1-CD2 4.15Å; L85-F89 HydrophobicContact CD1-CE2 3.86Å; L85-F89 HydrophobicContact CD2-CE2 4.26Å; L85-F89 HydrophobicContact CG-CD2 3.87Å; L85-F89 HydrophobicContact CG-CE2 3.79Å; L85-F89 VanDerWaalsContact O-CD2 3.31Å; L85-F89 WeakPolarHBondContact O-CD2 3.27Å; L85-F89 PolarHBondContact O-N 3.25Å
86	A	57.8	Low	55.5	Low	57 Å²	57	120.5 Å²	120.5	47%	0.471	58%	0.577	S	S	.	*	H	α-helix	trans	-59.1	-43	174	0	0	0	0	0	111.5	M82 K88 F89 D90	M82-A86 WeakPolarHBondContact O-CB 3.38Å; M82-A86 PolarHBondContact O-N 2.83Å; A86-K88 PolarHBondContact O-N 2.85Å; A86-F89 PolarHBondContact O-N 2.99Å; A86-D90 WeakPolarHBondContact O-CB 3.19Å; A86-D90 PolarHBondContact O-N 3.36Å
87	R	56.2	Low	54.9	Low	198 Å²	198	121 Å²	121	75%	0.747	58%	0.576	S	S	*	*	H	α-helix	trans	-66.9	-34.7	176.6	-145.3	-174.2	-152.5	164.8	6	112.9	Y83 S84 L85 Q91	Y83-R87 WeakPolarHBondContact O-CB 3.44Å; Y83-R87 PolarHBondContact O-N 3.42Å; S84-R87 PolarHBondContact O-N 3.41Å; L85-R87 VanDerWaalsContact C-N 3.32Å; L85-R87 PolarHBondContact O-N 2.86Å; R87-Q91 WeakPolarHBondContact O-CB 3.27Å; R87-Q91 PolarHBondContact O-N 3.25Å
88	K	56.7	Low	54.3	Low	135 Å²	135	115.6 Å²	115.6	59%	0.587	57%	0.565	S	S	*	*	H	α-helix	trans	-69.9	-37.6	173.1	-77.9	-174.3	176.9	-169.4	0	112.2	S84 L85 A86 Q91 H92	S84-K88 WeakPolarHBondContact O-CG 3.47Å; S84-K88 PolarHBondContact O-N 2.95Å; L85-K88 PolarHBondContact O-N 2.86Å; A86-K88 PolarHBondContact O-N 2.85Å; K88-Q91 PolarHBondContact O-N 3.44Å; K88-H92 WeakPolarHBondContact O-CB 3.26Å; K88-H92 PolarHBondContact O-N 3.41Å
89	F	55.7	Low	53.6	Low	134 Å²	134	116.3 Å²	116.3	59%	0.588	57%	0.569	S	S	*	*	H	α-helix	trans	-65.7	-41.1	172.7	-89.9	-75.8	0	0	0	111.6	L85 A86 Q91 H92 Q93	L85-F89 HydrophobicContact CD1-CD2 4.15Å; L85-F89 HydrophobicContact CD1-CE2 3.86Å; L85-F89 HydrophobicContact CD2-CE2 4.26Å; L85-F89 HydrophobicContact CG-CD2 3.87Å; L85-F89 HydrophobicContact CG-CE2 3.79Å; L85-F89 VanDerWaalsContact O-CD2 3.31Å; L85-F89 WeakPolarHBondContact O-CD2 3.27Å; L85-F89 PolarHBondContact O-N 3.25Å; A86-F89 PolarHBondContact O-N 2.99Å; F89-Q91 VanDerWaalsContact C-N 3.35Å; F89-Q91 PolarHBondContact O-N 2.93Å; F89-H92 PolarHBondContact O-N 3.45Å; F89-Q93 VanDerWaalsContact O-CB 3.28Å; F89-Q93 WeakPolarHBondContact O-CB 3.39Å; F89-Q93 PolarHBondContact O-N 3.42Å
90	D	55.8	Low	53.1	Low	90 Å²	90	114 Å²	114	48%	0.481	57%	0.565	S	S	.	*	H	α-helix	trans	-63.1	-41.9	174.9	-152.4	53	0	0	0	111.2	A86 Q93 H94	A86-D90 WeakPolarHBondContact O-CB 3.19Å; A86-D90 PolarHBondContact O-N 3.36Å; D90-Q93 PolarHBondContact O-N 2.78Å; D90-H94 PolarHBondContact O-CD2 3.03Å; D90-H94 VanDerWaalsContact O-CD2 3.23Å; D90-H94 PolarHBondContact O-N 3.48Å
91	Q	54.1	Low	52.5	Low	134 Å²	134	113.2 Å²	113.2	63%	0.626	57%	0.565	S	S	*	*	H	α-helix	trans	-68	-37.4	176.2	-159.8	174.6	1.7	0	0	113	R87 K88 F89 Q95	R87-Q91 WeakPolarHBondContact O-CB 3.27Å; R87-Q91 PolarHBondContact O-N 3.25Å; K88-Q91 PolarHBondContact O-N 3.44Å; F89-Q91 VanDerWaalsContact C-N 3.35Å; F89-Q91 PolarHBondContact O-N 2.93Å; Q91-Q95 PolarHBondContact O-N 3.1Å
92	H	52.5	Low	51.8	Low	132 Å²	132	114.6 Å²	114.6	61%	0.611	57%	0.572	S	S	*	*	H	α-helix	trans	-71.6	-31.9	172.2	-82.2	-163.9	0	0	0	112.6	K88 F89 H94 Q95 G96	K88-H92 WeakPolarHBondContact O-CB 3.26Å; K88-H92 PolarHBondContact O-N 3.41Å; F89-H92 PolarHBondContact O-N 3.45Å; H92-H94 VanDerWaalsContact C-N 3.33Å; H92-Q95 PolarHBondContact O-N 3.28Å; H92-G96 PolarHBondContact O-N 3.46Å
93	Q	52.1	Low	51	Low	122 Å²	122	114.5 Å²	114.5	57%	0.57	57%	0.573	S	S	*	*	H	α-helix	trans	-69.1	-34.6	176.2	-160.9	179.3	-32.3	0	0	111.1	F89 D90 Q97	F89-Q93 VanDerWaalsContact O-CB 3.28Å; F89-Q93 WeakPolarHBondContact O-CB 3.39Å; F89-Q93 PolarHBondContact O-N 3.42Å; D90-Q93 PolarHBondContact O-N 2.78Å; Q93-Q97 WeakPolarHBondContact O-CB 3.42Å; Q93-Q97 PolarHBondContact O-N 2.92Å; Q93-Q97 VanDerWaalsContact O-N 3.07Å
94	H	48.3	Very low	50.3	Low	124 Å²	124	110.5 Å²	110.5	57%	0.574	57%	0.573	S	S	*	*	H	α-helix	trans	-71.9	-30.4	172.5	-82.7	-68.9	0	0	0	114	D90 H92 S98	D90-H94 PolarHBondContact O-CD2 3.03Å; D90-H94 VanDerWaalsContact O-CD2 3.23Å; D90-H94 PolarHBondContact O-N 3.48Å; H92-H94 VanDerWaalsContact C-N 3.33Å; H94-S98 PolarHBondContact O-N 3.43Å; H94-S98 PolarHBondContact O-OG 3.46Å
95	Q	47.4	Very low	49.8	Very low	121 Å²	121	115.7 Å²	115.7	57%	0.565	59%	0.592	S	S	*	*	H	α-helix	trans	-78.6	-36	175.3	-156.9	165.4	18.3	0	0	112.2	Q91 H92 S98 E99	Q91-Q95 PolarHBondContact O-N 3.1Å; H92-Q95 PolarHBondContact O-N 3.28Å; Q95-S98 WeakPolarHBondContact CA-OG 3.46Å; Q95-S98 PolarHBondContact O-OG 2.99Å; Q95-S98 VanDerWaalsContact O-OG 3.13Å; Q95-E99 PolarHBondContact O-N 3.36Å
96	G	46.4	Very low	49	Very low	41 Å²	41	122.6 Å²	122.6	42%	0.423	62%	0.622	S	S	.	*	H	α-helix	trans	-70.8	-33.2	174.6	0	0	0	0	0	114.3	H92 S100	H92-G96 PolarHBondContact O-N 3.46Å; G96-S100 WeakPolarHBondContact O-CB 3.49Å; G96-S100 PolarHBondContact O-N 3.02Å; G96-S100 VanDerWaalsContact O-N 3.09Å; G96-S100 PolarHBondContact O-OG 3.12Å
97	Q	45.6	Very low	48.6	Very low	110 Å²	110	125.9 Å²	125.9	51%	0.514	63%	0.629	S	S	.	*	H	α-helix	trans	-75.6	-28.5	174.1	-90.3	-171.7	-2.6	0	0	113.6	Q93 S100 V101	Q93-Q97 WeakPolarHBondContact O-CB 3.42Å; Q93-Q97 PolarHBondContact O-N 2.92Å; Q93-Q97 VanDerWaalsContact O-N 3.07Å; Q97-S100 WeakPolarHBondContact CA-OG 3.27Å; Q97-S100 PolarHBondContact O-OG 3.4Å; Q97-V101 WeakPolarHBondContact O-CB 3.39Å; Q97-V101 WeakPolarHBondContact O-CG2 3.07Å; Q97-V101 PolarHBondContact O-N 3.44Å; Q97-V101 VanDerWaalsContact O-N 3.15Å
98	S	44.8	Very low	48.2	Very low	61 Å²	61	122.1 Å²	122.1	43%	0.427	62%	0.623	S	S	.	*	H	α-helix	trans	-74.4	-30.3	177.5	36.4	0	0	0	0	112.5	H94 Q95	H94-S98 PolarHBondContact O-N 3.43Å; H94-S98 PolarHBondContact O-OG 3.46Å; Q95-S98 WeakPolarHBondContact CA-OG 3.46Å; Q95-S98 PolarHBondContact O-OG 2.99Å; Q95-S98 VanDerWaalsContact O-OG 3.13Å
99	E	45.6	Very low	47.7	Very low	140 Å²	140	121.4 Å²	121.4	65%	0.654	63%	0.625	S	S	*	*	H	α-helix	trans	-79.3	-35.6	171.1	-69.1	-172.7	155.1	0	0	112.7	Q95 L103	Q95-E99 PolarHBondContact O-N 3.36Å; E99-L103 PolarHBondContact O-N 3.21Å
100	S	46.8	Very low	47.2	Very low	70 Å²	70	120.6 Å²	120.6	49%	0.49	63%	0.627	S	S	.	*	H	α-helix	trans	-74.4	-26	-179.6	74.6	0	0	0	0	114.2	G96 Q97	G96-S100 WeakPolarHBondContact O-CB 3.49Å; G96-S100 PolarHBondContact O-N 3.02Å; G96-S100 VanDerWaalsContact O-N 3.09Å; G96-S100 PolarHBondContact O-OG 3.12Å; Q97-S100 WeakPolarHBondContact CA-OG 3.27Å; Q97-S100 PolarHBondContact O-OG 3.4Å
101	V	47.3	Very low	46.7	Very low	94 Å²	94	122.6 Å²	122.6	57%	0.57	64%	0.636	S	S	*	*	H	α-helix	trans	-81.5	-27.8	177.9	174.9	0	0	0	0	111.8	Q97	Q97-V101 WeakPolarHBondContact O-CB 3.39Å; Q97-V101 WeakPolarHBondContact O-CG2 3.07Å; Q97-V101 PolarHBondContact O-N 3.44Å; Q97-V101 VanDerWaalsContact O-N 3.15Å
102	Q	43.3	Very low	46.2	Very low	151 Å²	151	121.8 Å²	121.8	71%	0.706	64%	0.637	S	S	*	*	H	α-helix	trans	-76	-31	175.3	-75.4	-174.1	44.5	0	0	113	S104	Q102-S104 PolarHBondContact O-N 3.24Å
103	L	41.6	Very low	45.7	Very low	146 Å²	146	121.1 Å²	121.1	76%	0.764	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.1	-4	178.9	-122.1	94.5	0	0	0	115	E99	E99-L103 PolarHBondContact O-N 3.21Å
104	S	43.2	Very low	45.2	Very low	101 Å²	101	121 Å²	121	71%	0.706	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.9	3.2	-177.9	-170.5	0	0	0	0	113.7	Q102	Q102-S104 PolarHBondContact O-N 3.24Å
105	M	47.6	Very low	45	Very low	173 Å²	173	120.8 Å²	120.8	85%	0.852	65%	0.65	S	S	*	*			trans	-112.1	14.5	179.6	-76	-155.9	174.2	0	0	114.6
106	E	40.3	Very low	44.8	Very low	241 Å²	241	120.7 Å²	120.7	100%	1.126	66%	0.657	S	S	*	*			trans	-103.6	0	169.7	-70.3	-176.6	103.8	0	0	112.2

Retrieved 106 of 106 residues in 19 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).