A0A060Y2Q6_ONCMY Loading...

Small vasohibin-binding protein

AlphaFold DB , UniProt , Accession A0A060Y2Q6, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110528040, Length 66 aa.

						>A0A060Y2Q6_ONCMY|A0A060Y2Q6|LOC110528040
MEPTCRKDKVKLNSTPTRGDRAKQKSAQQELKQRQRAEIYALNKVMTELEQQQFEAFCKQMQSQGE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.9	Very low	48.8	Very low	241 Å²	241	163.8 Å²	163.8	100%	1.187	82%	0.815	S	S	*	*				0	121.8	0	-76.9	-178.1	177.9	0	0	107
2	E	42.8	Very low	48.6	Very low	174 Å²	174	162.3 Å²	162.3	81%	0.813	81%	0.811	S	S	*	*			cis	-146.8	154	-3.3	-103.5	-84.3	116.4	0	0	105.5
3	P	66	Low	48.6	Very low	100 Å²	100	161.3 Å²	161.3	65%	0.649	81%	0.81	S	S	*	*			trans	-90.9	150.9	-171.9	35.4	-27.2	0	0	0	111.7
4	T	48.1	Very low	48.6	Very low	133 Å²	133	156.4 Å²	156.4	82%	0.816	80%	0.799	S	S	*	*			trans	-134.1	98.8	171.7	-20.9	0	0	0	0	113
5	C	39.5	Very low	48.7	Very low	115 Å²	115	153.3 Å²	153.3	78%	0.777	79%	0.79	S	S	*	*			trans	64	104.5	132.3	-60.1	0	0	0	0	121.1
6	R	59.7	Low	49.1	Very low	251 Å²	251	147.7 Å²	147.7	95%	0.947	77%	0.767	S	S	*	*			trans	-40.4	123.3	145.2	-62	170	176.1	170.6	-1.2	113.3
7	K	51.4	Low	49.8	Very low	183 Å²	183	145 Å²	145	80%	0.796	76%	0.758	S	S	*	*			trans	-155.9	139.1	146	-80.2	-174.1	88.8	168	0	105.6
8	D	40.7	Very low	50.4	Low	128 Å²	128	149.5 Å²	149.5	68%	0.684	76%	0.763	S	S	*	*			cis	-161.3	153.9	-3.4	-110.1	-53	0	0	0	105.8	V10	D8-V10 PolarHBondContact O-N 2.77Å
9	K	54.1	Low	50.9	Low	176 Å²	176	143.8 Å²	143.8	77%	0.765	75%	0.746	S	S	*	*			trans	-65.2	116.3	175.5	-64	-166.2	176.1	-175.1	0	110.3
10	V	47.6	Very low	51.5	Low	131 Å²	131	141.1 Å²	141.1	79%	0.794	73%	0.732	S	S	*	*			trans	-99.1	88.2	145.5	-176.9	0	0	0	0	107.1	D8 L12	D8-V10 PolarHBondContact O-N 2.77Å; V10-L12 HydrophobicContact CG1-CD1 4.42Å; V10-L12 PolarHBondContact O-N 3.44Å; V10-L12 VanDerWaalsContact O-N 3.1Å
11	K	52.4	Low	52.1	Low	170 Å²	170	140.8 Å²	140.8	74%	0.739	72%	0.722	S	S	*	*			trans	-60.5	104.6	154.4	-77.2	178.8	172.1	-177.6	0	106.5
12	L	46.2	Very low	53.7	Low	146 Å²	146	132.2 Å²	132.2	76%	0.764	69%	0.689	S	S	*	*			trans	-121.2	98.9	146.7	-126.1	99.3	0	0	0	106.9	V10 S14	V10-L12 HydrophobicContact CG1-CD1 4.42Å; V10-L12 PolarHBondContact O-N 3.44Å; V10-L12 VanDerWaalsContact O-N 3.1Å; L12-S14 PolarHBondContact O-N 3.47Å
13	N	48.9	Very low	55	Low	149 Å²	149	131.2 Å²	131.2	80%	0.797	68%	0.682	S	S	*	*			trans	-56.2	88.3	159.6	-77.9	-8.1	0	0	0	107.5	T15	N13-T15 VanDerWaalsContact C-N 3.25Å; N13-T15 PolarHBondContact O-N 3.28Å
14	S	47.5	Very low	55.5	Low	93 Å²	93	133.3 Å²	133.3	65%	0.65	68%	0.683	S	S	*	*			trans	-82.9	85.4	158.5	-172.8	0	0	0	0	105.8	L12 P16	L12-S14 PolarHBondContact O-N 3.47Å; S14-P16 VanDerWaalsContact O-CD 3.24Å; S14-P16 WeakPolarHBondContact O-CD 3.32Å
15	T	50.2	Low	57	Low	109 Å²	109	133.6 Å²	133.6	67%	0.669	67%	0.673	S	S	*	*			trans	-56.4	118.3	160.4	30.7	0	0	0	0	106.1	N13 T17	N13-T15 VanDerWaalsContact C-N 3.25Å; N13-T15 PolarHBondContact O-N 3.28Å; T15-T17 PolarHBondContact O-N 3.31Å
16	P	55.5	Low	59.2	Low	64 Å²	64	131.4 Å²	131.4	42%	0.416	66%	0.659	S	S	.	*			trans	-62.6	105.4	178.1	-16.1	28.4	0	0	0	107.1	S14 R18 R21	S14-P16 VanDerWaalsContact O-CD 3.24Å; S14-P16 WeakPolarHBondContact O-CD 3.32Å; P16-R18 PolarHBondContact O-N 3.05Å; P16-R21 HydrophobicContact CB-CG 4.13Å; P16-R21 PolarHBondContact O-NE 3.48Å; P16-R21 PolarHBondContact O-NH2 3.05Å
17	T	61.4	Low	60.6	Low	102 Å²	102	122.2 Å²	122.2	63%	0.626	64%	0.636	S	S	*	*			trans	-52.6	140.1	176	-47.7	0	0	0	0	107.2	T15 G19 D20	T15-T17 PolarHBondContact O-N 3.31Å; T17-G19 PolarHBondContact O-N 3.44Å; T17-D20 PolarHBondContact O-N 3.24Å
18	R	60.2	Low	62.6	Low	226 Å²	226	120.2 Å²	120.2	85%	0.853	63%	0.63	S	S	*	*	H	α-helix	trans	-49.2	-29.8	-172.8	-172.7	179.3	177.7	-164.9	0.1	113.6	P16	P16-R18 PolarHBondContact O-N 3.05Å
19	G	60.5	Low	65.2	Low	41 Å²	41	120.1 Å²	120.1	42%	0.423	63%	0.625	S	S	.	*	H	α-helix	trans	-67.1	-35.1	174.9	0	0	0	0	0	115.6	T17 A22 K23	T17-G19 PolarHBondContact O-N 3.44Å; G19-A22 PolarHBondContact O-N 3.4Å; G19-K23 PolarHBondContact O-N 3Å; G19-K23 VanDerWaalsContact O-N 3.17Å
20	D	62.5	Low	67.2	Low	89 Å²	89	118.1 Å²	118.1	48%	0.476	62%	0.619	S	S	.	*	H	α-helix	trans	-68.9	-37.1	178.9	-89.1	-34.3	0	0	0	112	T17 A22 K23 Q24	T17-D20 PolarHBondContact O-N 3.24Å; D20-A22 VanDerWaalsContact C-N 3.27Å; D20-A22 PolarHBondContact O-N 3.33Å; D20-K23 PolarHBondContact O-N 3.41Å; D20-Q24 WeakPolarHBondContact O-CB 3.39Å; D20-Q24 PolarHBondContact O-N 3.3Å
21	R	64	Low	69.5	Low	136 Å²	136	116.4 Å²	116.4	51%	0.513	60%	0.604	S	S	.	*	H	α-helix	trans	-65.5	-31.1	175.1	-74.2	-174.9	-96.7	-158.2	-6.6	112.5	P16 K25	P16-R21 HydrophobicContact CB-CG 4.13Å; P16-R21 PolarHBondContact O-NE 3.48Å; P16-R21 PolarHBondContact O-NH2 3.05Å; R21-K25 WeakPolarHBondContact O-CB 3.4Å; R21-K25 WeakPolarHBondContact O-CG 3.43Å; R21-K25 PolarHBondContact O-N 3Å
22	A	67.7	Low	71.7	Confident	60 Å²	60	115.6 Å²	115.6	50%	0.496	60%	0.601	S	S	.	*	H	α-helix	trans	-72.3	-44	176.1	0	0	0	0	0	111.6	G19 D20 K25 S26	G19-A22 PolarHBondContact O-N 3.4Å; D20-A22 VanDerWaalsContact C-N 3.27Å; D20-A22 PolarHBondContact O-N 3.33Å; A22-K25 PolarHBondContact O-N 3.46Å; A22-S26 PolarHBondContact O-N 3.43Å
23	K	71	Confident	74.1	Confident	154 Å²	154	115.1 Å²	115.1	67%	0.67	60%	0.595	S	S	*	*	H	α-helix	trans	-64.1	-43.3	176.1	-69.8	179.6	178.5	-177.4	0	112.3	G19 D20 K25 S26 A27	G19-K23 PolarHBondContact O-N 3Å; G19-K23 VanDerWaalsContact O-N 3.17Å; D20-K23 PolarHBondContact O-N 3.41Å; K23-K25 VanDerWaalsContact C-N 3.34Å; K23-K25 PolarHBondContact O-N 3.17Å; K23-S26 PolarHBondContact O-N 3.05Å; K23-A27 PolarHBondContact O-N 3.46Å
24	Q	76.1	Confident	76.5	Confident	144 Å²	144	116 Å²	116	67%	0.673	59%	0.587	S	S	*	*	H	α-helix	trans	-62.1	-40.4	176.5	-168.7	-178.7	15.3	0	0	112.1	D20 Q28	D20-Q24 WeakPolarHBondContact O-CB 3.39Å; D20-Q24 PolarHBondContact O-N 3.3Å; Q24-Q28 WeakPolarHBondContact O-CB 3.31Å; Q24-Q28 PolarHBondContact O-N 3.44Å
25	K	80.8	Confident	78.9	Confident	139 Å²	139	116.3 Å²	116.3	60%	0.604	58%	0.578	S	S	*	*	H	α-helix	trans	-64.6	-40.8	175.1	-76.7	175.5	-177.8	-169.5	0	112.4	R21 A22 K23 Q28 Q29	R21-K25 WeakPolarHBondContact O-CB 3.4Å; R21-K25 WeakPolarHBondContact O-CG 3.43Å; R21-K25 PolarHBondContact O-N 3Å; A22-K25 PolarHBondContact O-N 3.46Å; K23-K25 VanDerWaalsContact C-N 3.34Å; K23-K25 PolarHBondContact O-N 3.17Å; K25-Q28 PolarHBondContact O-N 3.01Å; K25-Q29 WeakPolarHBondContact O-CG 3.4Å; K25-Q29 PolarHBondContact O-N 3.27Å
26	S	84.8	Confident	81.2	Confident	68 Å²	68	118.1 Å²	118.1	48%	0.476	57%	0.573	S	S	.	*	H	α-helix	trans	-62.6	-48.6	176.2	161.4	0	0	0	0	111.5	A22 K23 Q28 Q29 E30	A22-S26 PolarHBondContact O-N 3.43Å; K23-S26 PolarHBondContact O-N 3.05Å; S26-Q28 VanDerWaalsContact C-N 3.28Å; S26-Q28 PolarHBondContact O-N 3.48Å; S26-Q29 PolarHBondContact O-N 2.87Å; S26-Q29 VanDerWaalsContact O-N 3.14Å; S26-E30 PolarHBondContact O-N 3.48Å
27	A	88.1	Confident	83.3	Confident	58 Å²	58	118 Å²	118	48%	0.479	58%	0.578	S	S	.	*	H	α-helix	trans	-59.9	-38.8	177.1	0	0	0	0	0	112.2	K23 L31	K23-A27 PolarHBondContact O-N 3.46Å; A27-L31 WeakPolarHBondContact O-CB 3.35Å; A27-L31 PolarHBondContact O-N 2.9Å
28	Q	93.8	Very high	85	Confident	141 Å²	141	118.3 Å²	118.3	66%	0.659	57%	0.572	S	S	*	*	H	α-helix	trans	-68	-37.8	176.3	-170.1	176.4	40	0	0	112.7	Q24 K25 S26 K32	Q24-Q28 WeakPolarHBondContact O-CB 3.31Å; Q24-Q28 PolarHBondContact O-N 3.44Å; K25-Q28 PolarHBondContact O-N 3.01Å; S26-Q28 VanDerWaalsContact C-N 3.28Å; S26-Q28 PolarHBondContact O-N 3.48Å; Q28-K32 WeakPolarHBondContact O-CB 3.45Å; Q28-K32 PolarHBondContact O-N 3.28Å
29	Q	95.8	Very high	86.9	Confident	127 Å²	127	112.1 Å²	112.1	59%	0.593	56%	0.555	S	S	*	*	H	α-helix	trans	-66.9	-43.1	176	-77.6	-178.6	-11.3	0	0	111.8	K25 S26 K32 Q33	K25-Q29 WeakPolarHBondContact O-CG 3.4Å; K25-Q29 PolarHBondContact O-N 3.27Å; S26-Q29 PolarHBondContact O-N 2.87Å; S26-Q29 VanDerWaalsContact O-N 3.14Å; Q29-K32 PolarHBondContact O-N 3.12Å; Q29-Q33 WeakPolarHBondContact O-CG 3.5Å; Q29-Q33 PolarHBondContact O-N 3.38Å
30	E	95.6	Very high	88.7	Confident	134 Å²	134	116.3 Å²	116.3	63%	0.626	56%	0.558	S	S	*	*	H	α-helix	trans	-61.8	-46.7	176.4	-172.1	-179.8	170.5	0	0	111.1	S26 K32 Q33 R34	S26-E30 PolarHBondContact O-N 3.48Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.01Å; E30-Q33 PolarHBondContact O-N 3.45Å; E30-R34 WeakPolarHBondContact O-CB 3.36Å; E30-R34 PolarHBondContact O-N 2.88Å
31	L	96.4	Very high	90.4	Very high	94 Å²	94	114.9 Å²	114.9	49%	0.492	56%	0.559	S	S	.	*	H	α-helix	trans	-57.7	-45.2	174.9	-179.9	61.8	0	0	0	111.6	A27 Q33 R34 Q35	A27-L31 WeakPolarHBondContact O-CB 3.35Å; A27-L31 PolarHBondContact O-N 2.9Å; L31-Q33 PolarHBondContact O-N 3.19Å; L31-R34 PolarHBondContact O-N 3.11Å; L31-Q35 HydrophobicContact CD1-CG 4.25Å; L31-Q35 HydrophobicContact CG-CG 4.47Å; L31-Q35 WeakPolarHBondContact O-CB 3.48Å; L31-Q35 VanDerWaalsContact O-CG 3.29Å; L31-Q35 WeakPolarHBondContact O-CG 3.44Å; L31-Q35 PolarHBondContact O-N 3.45Å
32	K	98	Very high	92.1	Very high	153 Å²	153	113.4 Å²	113.4	67%	0.665	56%	0.561	S	S	*	*	H	α-helix	trans	-63.4	-40.3	178.3	-174.2	-179.7	178.7	-178.9	0	112.1	Q28 Q29 E30 R36	Q28-K32 WeakPolarHBondContact O-CB 3.45Å; Q28-K32 PolarHBondContact O-N 3.28Å; Q29-K32 PolarHBondContact O-N 3.12Å; E30-K32 VanDerWaalsContact C-N 3.32Å; E30-K32 PolarHBondContact O-N 3.01Å; K32-R36 VanDerWaalsContact O-CB 3.31Å; K32-R36 WeakPolarHBondContact O-CB 3.37Å; K32-R36 PolarHBondContact O-N 2.95Å
33	Q	98.3	Very high	93.5	Very high	137 Å²	137	114.6 Å²	114.6	64%	0.64	56%	0.559	S	S	*	*	H	α-helix	trans	-66.2	-42.7	177.1	-73.6	177.3	14.4	0	0	111.3	Q29 E30 L31 R36 A37	Q29-Q33 WeakPolarHBondContact O-CG 3.5Å; Q29-Q33 PolarHBondContact O-N 3.38Å; E30-Q33 PolarHBondContact O-N 3.45Å; L31-Q33 PolarHBondContact O-N 3.19Å; Q33-R36 WeakPolarHBondContact O-CB 2.85Å; Q33-R36 PolarHBondContact O-N 3.48Å; Q33-A37 PolarHBondContact O-N 2.92Å
34	R	98.1	Very high	94.9	Very high	168 Å²	168	113.7 Å²	113.7	63%	0.634	56%	0.555	S	S	*	*	H	α-helix	trans	-62	-48.9	175.5	-176.8	176.6	175.7	159.3	3.9	111.8	E30 L31 R36 A37 E38	E30-R34 WeakPolarHBondContact O-CB 3.36Å; E30-R34 PolarHBondContact O-N 2.88Å; L31-R34 PolarHBondContact O-N 3.11Å; R34-R36 VanDerWaalsContact C-N 3.28Å; R34-R36 PolarHBondContact O-N 3.3Å; R34-A37 WeakPolarHBondContact O-CB 3.44Å; R34-A37 PolarHBondContact O-N 3.37Å; R34-A37 VanDerWaalsContact O-N 3.1Å; R34-E38 WeakPolarHBondContact CG-OE1 3.36Å; R34-E38 IonicContact NE-OE1 3.89Å; R34-E38 PolarHBondContact NE-OE1 3.33Å; R34-E38 VanDerWaalsContact NE-OE1 3.1Å; R34-E38 WeakPolarHBondContact O-CG 3.49Å; R34-E38 PolarHBondContact O-N 2.97Å
35	Q	98.6	Very high	95.9	Very high	99 Å²	99	111 Å²	111	46%	0.463	55%	0.548	S	S	.	.	H	α-helix	trans	-58.3	-40.9	174.5	-74	176.2	-18.4	0	0	111.7	L31 E38 I39	L31-Q35 HydrophobicContact CD1-CG 4.25Å; L31-Q35 HydrophobicContact CG-CG 4.47Å; L31-Q35 WeakPolarHBondContact O-CB 3.48Å; L31-Q35 VanDerWaalsContact O-CG 3.29Å; L31-Q35 WeakPolarHBondContact O-CG 3.44Å; L31-Q35 PolarHBondContact O-N 3.45Å; Q35-E38 PolarHBondContact O-N 3.39Å; Q35-I39 VanDerWaalsContact O-CG1 3.27Å; Q35-I39 WeakPolarHBondContact O-CG1 3.41Å; Q35-I39 PolarHBondContact O-N 3.27Å
36	R	98.6	Very high	96.8	Very high	147 Å²	147	109.2 Å²	109.2	56%	0.555	54%	0.543	S	S	*	.	H	α-helix	trans	-61.6	-44.6	175.2	-174.3	177.2	-175	-85.8	-2	111.2	K32 Q33 R34 E38 I39 Y40	K32-R36 VanDerWaalsContact O-CB 3.31Å; K32-R36 WeakPolarHBondContact O-CB 3.37Å; K32-R36 PolarHBondContact O-N 2.95Å; Q33-R36 WeakPolarHBondContact O-CB 2.85Å; Q33-R36 PolarHBondContact O-N 3.48Å; R34-R36 VanDerWaalsContact C-N 3.28Å; R34-R36 PolarHBondContact O-N 3.3Å; R36-E38 VanDerWaalsContact C-N 3.35Å; R36-I39 PolarHBondContact O-N 3.03Å; R36-Y40 HydrophobicContact CG-CD2 3.9Å; R36-Y40 HydrophobicContact CG-CE2 3.67Å; R36-Y40 PolarHBondContact NH2-OH 2.98Å; R36-Y40 WeakPolarHBondContact O-CD2 3.4Å; R36-Y40 PolarHBondContact O-N 3.48Å
37	A	98.5	Very high	97.4	Very high	62 Å²	62	110.2 Å²	110.2	51%	0.512	55%	0.547	S	S	.	.	H	α-helix	trans	-61.8	-42.9	177	0	0	0	0	0	111.8	Q33 R34 I39 Y40 A41	Q33-A37 PolarHBondContact O-N 2.92Å; R34-A37 WeakPolarHBondContact O-CB 3.44Å; R34-A37 PolarHBondContact O-N 3.37Å; R34-A37 VanDerWaalsContact O-N 3.1Å; A37-I39 PolarHBondContact O-N 3.45Å; A37-Y40 PolarHBondContact O-N 3.41Å; A37-A41 PolarHBondContact O-N 2.93Å
38	E	98.5	Very high	97.9	Very high	107 Å²	107	111.8 Å²	111.8	50%	0.5	54%	0.544	S	S	.	.	H	α-helix	trans	-62.1	-41.6	176.1	-70.4	171.9	-164.4	0	0	111.7	R34 Q35 R36 Y40 A41 L42	R34-E38 WeakPolarHBondContact CG-OE1 3.36Å; R34-E38 IonicContact NE-OE1 3.89Å; R34-E38 PolarHBondContact NE-OE1 3.33Å; R34-E38 VanDerWaalsContact NE-OE1 3.1Å; R34-E38 WeakPolarHBondContact O-CG 3.49Å; R34-E38 PolarHBondContact O-N 2.97Å; Q35-E38 PolarHBondContact O-N 3.39Å; R36-E38 VanDerWaalsContact C-N 3.35Å; E38-Y40 PolarHBondContact O-N 2.9Å; E38-A41 PolarHBondContact O-N 3.33Å; E38-L42 WeakPolarHBondContact O-CB 3.48Å; E38-L42 PolarHBondContact O-N 3.25Å
39	I	98.8	Very high	98.2	Very high	97 Å²	97	108.7 Å²	108.7	50%	0.497	53%	0.532	S	S	.	.	H	α-helix	trans	-61.2	-43.4	174.4	-69.7	163.7	0	0	0	111.4	Q35 R36 A37 L42 N43	Q35-I39 VanDerWaalsContact O-CG1 3.27Å; Q35-I39 WeakPolarHBondContact O-CG1 3.41Å; Q35-I39 PolarHBondContact O-N 3.27Å; R36-I39 PolarHBondContact O-N 3.03Å; A37-I39 PolarHBondContact O-N 3.45Å; I39-L42 PolarHBondContact O-N 3.49Å; I39-N43 WeakPolarHBondContact O-CB 3.37Å; I39-N43 PolarHBondContact O-N 3.47Å
40	Y	98.8	Very high	98.3	Very high	128 Å²	128	109 Å²	109	50%	0.502	53%	0.533	S	S	.	.	H	α-helix	trans	-68.9	-36.8	178.2	-82.7	-71.5	0	0	0	112.8	R36 A37 E38 L42 N43 K44	R36-Y40 HydrophobicContact CG-CD2 3.9Å; R36-Y40 HydrophobicContact CG-CE2 3.67Å; R36-Y40 PolarHBondContact NH2-OH 2.98Å; R36-Y40 WeakPolarHBondContact O-CD2 3.4Å; R36-Y40 PolarHBondContact O-N 3.48Å; A37-Y40 PolarHBondContact O-N 3.41Å; E38-Y40 PolarHBondContact O-N 2.9Å; Y40-L42 VanDerWaalsContact C-N 3.33Å; Y40-N43 PolarHBondContact O-N 3.01Å; Y40-K44 WeakPolarHBondContact O-CB 3.45Å; Y40-K44 PolarHBondContact O-N 2.85Å
41	A	98.7	Very high	98.4	Very high	60 Å²	60	107.1 Å²	107.1	50%	0.496	52%	0.524	S	S	.	.	H	α-helix	trans	-61.5	-45.3	173.9	0	0	0	0	0	110.8	A37 E38 K44 V45	A37-A41 PolarHBondContact O-N 2.93Å; E38-A41 PolarHBondContact O-N 3.33Å; A41-K44 PolarHBondContact O-N 2.9Å; A41-V45 PolarHBondContact O-N 3.05Å
42	L	98.7	Very high	98.5	Very high	105 Å²	105	108.6 Å²	108.6	55%	0.55	53%	0.529	S	S	.	.	H	α-helix	trans	-62.7	-49.5	175.5	179.4	62.6	0	0	0	111.8	E38 I39 Y40 K44 V45 M46	E38-L42 WeakPolarHBondContact O-CB 3.48Å; E38-L42 PolarHBondContact O-N 3.25Å; I39-L42 PolarHBondContact O-N 3.49Å; Y40-L42 VanDerWaalsContact C-N 3.33Å; L42-K44 PolarHBondContact O-N 3.39Å; L42-V45 PolarHBondContact O-N 3.1Å; L42-V45 VanDerWaalsContact O-N 3.11Å; L42-M46 HydrophobicContact CD1-CG 4.1Å; L42-M46 HydrophobicContact CD1-SD 4.48Å; L42-M46 HydrophobicContact CG-CG 4.21Å; L42-M46 WeakPolarHBondContact O-CG 3.27Å; L42-M46 PolarHBondContact O-N 3.27Å
43	N	98.6	Very high	98.5	Very high	85 Å²	85	107.1 Å²	107.1	46%	0.455	52%	0.524	S	S	.	.	H	α-helix	trans	-57.4	-40.1	-179.5	-80.4	-4.6	0	0	0	111.8	I39 Y40 M46 T47	I39-N43 WeakPolarHBondContact O-CB 3.37Å; I39-N43 PolarHBondContact O-N 3.47Å; Y40-N43 PolarHBondContact O-N 3.01Å; N43-M46 PolarHBondContact O-N 2.92Å; N43-T47 WeakPolarHBondContact O-CB 3.41Å; N43-T47 PolarHBondContact O-N 3.34Å; N43-T47 PolarHBondContact O-OG1 3.46Å; N43-T47 VanDerWaalsContact O-OG1 3.05Å
44	K	98.6	Very high	98.5	Very high	134 Å²	134	106.3 Å²	106.3	58%	0.583	52%	0.519	S	S	*	.	H	α-helix	trans	-59.3	-49.2	176.4	-177.8	177.3	172.7	-178.9	0	111.5	Y40 A41 L42 M46 T47 E48	Y40-K44 WeakPolarHBondContact O-CB 3.45Å; Y40-K44 PolarHBondContact O-N 2.85Å; A41-K44 PolarHBondContact O-N 2.9Å; L42-K44 PolarHBondContact O-N 3.39Å; K44-M46 VanDerWaalsContact C-N 3.32Å; K44-M46 PolarHBondContact O-N 2.95Å; K44-T47 PolarHBondContact O-N 2.88Å; K44-E48 WeakPolarHBondContact CE-OE1 3.41Å; K44-E48 WeakPolarHBondContact CG-OE1 3.2Å; K44-E48 IonicContact NZ-OE1 3.1Å; K44-E48 WeakPolarHBondContact O-CG 3.45Å; K44-E48 PolarHBondContact O-N 3.31Å
45	V	98.6	Very high	98.5	Very high	88 Å²	88	102.4 Å²	102.4	53%	0.533	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-41.5	178.3	174.7	0	0	0	0	111.1	A41 L42 E48 L49	A41-V45 PolarHBondContact O-N 3.05Å; L42-V45 PolarHBondContact O-N 3.1Å; L42-V45 VanDerWaalsContact O-N 3.11Å; V45-E48 PolarHBondContact O-N 3.35Å; V45-L49 WeakPolarHBondContact O-CB 3.29Å; V45-L49 PolarHBondContact O-N 2.89Å
46	M	98.7	Very high	98.4	Very high	102 Å²	102	100.4 Å²	100.4	50%	0.502	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-43.7	177.9	-68.6	-57.7	-59.2	0	0	112.1	L42 N43 K44 L49 E50	L42-M46 HydrophobicContact CD1-CG 4.1Å; L42-M46 HydrophobicContact CD1-SD 4.48Å; L42-M46 HydrophobicContact CG-CG 4.21Å; L42-M46 WeakPolarHBondContact O-CG 3.27Å; L42-M46 PolarHBondContact O-N 3.27Å; N43-M46 PolarHBondContact O-N 2.92Å; K44-M46 VanDerWaalsContact C-N 3.32Å; K44-M46 PolarHBondContact O-N 2.95Å; M46-L49 PolarHBondContact O-N 3.47Å; M46-E50 PolarHBondContact O-N 2.92Å
47	T	98.6	Very high	98.3	Very high	88 Å²	88	99 Å²	99	54%	0.54	51%	0.506	S	S	.	.	H	α-helix	trans	-64.9	-42.3	176.3	-60.9	0	0	0	0	111.8	N43 K44 L49 E50 Q51	N43-T47 WeakPolarHBondContact O-CB 3.41Å; N43-T47 PolarHBondContact O-N 3.34Å; N43-T47 PolarHBondContact O-OG1 3.46Å; N43-T47 VanDerWaalsContact O-OG1 3.05Å; K44-T47 PolarHBondContact O-N 2.88Å; T47-L49 VanDerWaalsContact C-N 3.32Å; T47-L49 PolarHBondContact O-N 3.06Å; T47-E50 PolarHBondContact O-N 3.1Å; T47-Q51 WeakPolarHBondContact O-CB 3.48Å; T47-Q51 PolarHBondContact O-N 2.91Å
48	E	98.4	Very high	98.1	Very high	91 Å²	91	98.1 Å²	98.1	43%	0.425	50%	0.496	S	S	.	.	H	α-helix	trans	-63.1	-40.1	176.2	-73.8	172.9	-174.9	0	0	111.6	K44 V45 Q51 Q52	K44-E48 WeakPolarHBondContact CE-OE1 3.41Å; K44-E48 WeakPolarHBondContact CG-OE1 3.2Å; K44-E48 IonicContact NZ-OE1 3.1Å; K44-E48 WeakPolarHBondContact O-CG 3.45Å; K44-E48 PolarHBondContact O-N 3.31Å; V45-E48 PolarHBondContact O-N 3.35Å; E48-Q51 PolarHBondContact O-N 3.34Å; E48-Q52 VanDerWaalsContact O-CG 3.31Å; E48-Q52 WeakPolarHBondContact O-CG 3.36Å; E48-Q52 PolarHBondContact O-N 3.01Å
49	L	98.6	Very high	98	Very high	76 Å²	76	99.3 Å²	99.3	40%	0.398	50%	0.499	S	S	.	.	H	α-helix	trans	-63.3	-46.6	176.1	178.6	63.5	0	0	0	111.8	V45 M46 T47 Q51 Q52 Q53	V45-L49 WeakPolarHBondContact O-CB 3.29Å; V45-L49 PolarHBondContact O-N 2.89Å; M46-L49 PolarHBondContact O-N 3.47Å; T47-L49 VanDerWaalsContact C-N 3.32Å; T47-L49 PolarHBondContact O-N 3.06Å; L49-Q51 VanDerWaalsContact C-N 3.33Å; L49-Q51 PolarHBondContact O-N 3.01Å; L49-Q52 PolarHBondContact O-N 3.2Å; L49-Q53 WeakPolarHBondContact O-CG 3.4Å; L49-Q53 PolarHBondContact O-N 2.91Å
50	E	98.5	Very high	97.7	Very high	135 Å²	135	100.5 Å²	100.5	63%	0.631	50%	0.503	S	S	*	.	H	α-helix	trans	-61.5	-43.2	178	-174.8	176.4	-161.8	0	0	111.2	M46 T47 Q52 Q53 F54	M46-E50 PolarHBondContact O-N 2.92Å; T47-E50 PolarHBondContact O-N 3.1Å; E50-Q52 PolarHBondContact O-N 2.95Å; E50-Q53 PolarHBondContact O-N 3.27Å; E50-F54 WeakPolarHBondContact O-CB 3.41Å; E50-F54 PolarHBondContact O-N 3.33Å
51	Q	98.4	Very high	97.3	Very high	93 Å²	93	99.3 Å²	99.3	44%	0.435	50%	0.503	S	S	.	.	H	α-helix	trans	-60.7	-44.2	176.2	-177.4	63.1	42.5	0	0	111.7	T47 E48 L49 Q53 F54 E55	T47-Q51 WeakPolarHBondContact O-CB 3.48Å; T47-Q51 PolarHBondContact O-N 2.91Å; E48-Q51 PolarHBondContact O-N 3.34Å; L49-Q51 VanDerWaalsContact C-N 3.33Å; L49-Q51 PolarHBondContact O-N 3.01Å; Q51-Q53 VanDerWaalsContact C-N 3.35Å; Q51-Q53 PolarHBondContact O-N 3.38Å; Q51-F54 PolarHBondContact O-N 3Å; Q51-E55 WeakPolarHBondContact CG-OE1 3.35Å; Q51-E55 PolarHBondContact NE2-OE1 2.99Å; Q51-E55 WeakPolarHBondContact O-CG 3.31Å; Q51-E55 PolarHBondContact O-N 3.28Å
52	Q	98.4	Very high	96.6	Very high	125 Å²	125	103.3 Å²	103.3	58%	0.584	51%	0.511	S	S	*	.	H	α-helix	trans	-61.6	-42.6	176.8	-74.2	174.4	12.7	0	0	112.2	E48 L49 E50 F54 E55 A56	E48-Q52 VanDerWaalsContact O-CG 3.31Å; E48-Q52 WeakPolarHBondContact O-CG 3.36Å; E48-Q52 PolarHBondContact O-N 3.01Å; L49-Q52 PolarHBondContact O-N 3.2Å; E50-Q52 PolarHBondContact O-N 2.95Å; Q52-F54 VanDerWaalsContact C-N 3.34Å; Q52-E55 PolarHBondContact O-N 3.44Å; Q52-A56 WeakPolarHBondContact O-CB 3.19Å; Q52-A56 PolarHBondContact O-N 3.33Å
53	Q	97.8	Very high	95.6	Very high	123 Å²	123	101.9 Å²	101.9	58%	0.575	51%	0.51	S	S	*	.	H	α-helix	trans	-63.2	-42.5	176.4	-71.2	177	-9.8	0	0	111.3	L49 E50 Q51 A56 F57	L49-Q53 WeakPolarHBondContact O-CG 3.4Å; L49-Q53 PolarHBondContact O-N 2.91Å; E50-Q53 PolarHBondContact O-N 3.27Å; Q51-Q53 VanDerWaalsContact C-N 3.35Å; Q51-Q53 PolarHBondContact O-N 3.38Å; Q53-A56 PolarHBondContact O-N 3.05Å; Q53-F57 WeakPolarHBondContact O-CB 3.45Å; Q53-F57 PolarHBondContact O-N 3.14Å
54	F	98	Very high	94.4	Very high	119 Å²	119	104.3 Å²	104.3	52%	0.522	52%	0.519	S	S	.	.	H	α-helix	trans	-64.9	-45.5	177.4	-178.5	-106.6	0	0	0	112.3	E50 Q51 Q52 A56 F57 C58	E50-F54 WeakPolarHBondContact O-CB 3.41Å; E50-F54 PolarHBondContact O-N 3.33Å; Q51-F54 PolarHBondContact O-N 3Å; Q52-F54 VanDerWaalsContact C-N 3.34Å; F54-A56 VanDerWaalsContact C-N 3.35Å; F54-A56 PolarHBondContact O-N 3.4Å; F54-F57 WeakPolarHBondContact O-CB 3.39Å; F54-F57 PolarHBondContact O-N 2.87Å; F54-C58 VanDerWaalsContact CZ-SG 3.52Å; F54-C58 PolarHBondContact O-N 3.47Å; F54-C58 PolarHBondContact O-SG 2.92Å
55	E	97.4	Very high	92.7	Very high	87 Å²	87	101.3 Å²	101.3	41%	0.407	53%	0.526	S	S	.	.	H	α-helix	trans	-62.6	-41	177.2	-75.6	176.6	-162.3	0	0	112.5	Q51 Q52 F57 C58 K59	Q51-E55 WeakPolarHBondContact CG-OE1 3.35Å; Q51-E55 PolarHBondContact NE2-OE1 2.99Å; Q51-E55 WeakPolarHBondContact O-CG 3.31Å; Q51-E55 PolarHBondContact O-N 3.28Å; Q52-E55 PolarHBondContact O-N 3.44Å; E55-F57 VanDerWaalsContact C-N 3.31Å; E55-C58 PolarHBondContact O-N 3.25Å; E55-K59 WeakPolarHBondContact O-CG 3.24Å; E55-K59 PolarHBondContact O-N 2.86Å
56	A	96.8	Very high	90.5	Very high	57 Å²	57	108.4 Å²	108.4	47%	0.471	55%	0.553	S	S	.	*	H	α-helix	trans	-60.9	-43.5	174.6	0	0	0	0	0	111.1	Q52 Q53 F54 K59 Q60	Q52-A56 WeakPolarHBondContact O-CB 3.19Å; Q52-A56 PolarHBondContact O-N 3.33Å; Q53-A56 PolarHBondContact O-N 3.05Å; F54-A56 VanDerWaalsContact C-N 3.35Å; F54-A56 PolarHBondContact O-N 3.4Å; A56-K59 PolarHBondContact O-N 3.27Å; A56-Q60 PolarHBondContact O-N 3.2Å
57	F	96.2	Very high	90	Very high	117 Å²	117	108.7 Å²	108.7	51%	0.513	56%	0.556	S	S	.	*	H	α-helix	trans	-60.8	-47.3	175.6	175.7	-97.8	0	0	0	112.2	Q53 F54 E55 K59 Q60 M61	Q53-F57 WeakPolarHBondContact O-CB 3.45Å; Q53-F57 PolarHBondContact O-N 3.14Å; F54-F57 WeakPolarHBondContact O-CB 3.39Å; F54-F57 PolarHBondContact O-N 2.87Å; E55-F57 VanDerWaalsContact C-N 3.31Å; F57-K59 PolarHBondContact O-N 3.17Å; F57-Q60 PolarHBondContact O-N 3.37Å; F57-M61 HydrophobicContact CE1-CG 4.1Å; F57-M61 HydrophobicContact CE1-SD 4.3Å; F57-M61 HydrophobicContact CE2-CG 4.35Å; F57-M61 HydrophobicContact CZ-CG 3.97Å; F57-M61 HydrophobicContact CZ-SD 3.89Å; F57-M61 PolarHBondContact O-N 3.04Å; F57-M61 VanDerWaalsContact O-N 3.12Å
58	C	95.9	Very high	89.6	Confident	43 Å²	43	109.8 Å²	109.8	29%	0.291	56%	0.557	S	S	.	*	H	α-helix	trans	-60	-43.9	177.3	-72	0	0	0	0	112.5	F54 E55 Q60 M61 Q62	F54-C58 VanDerWaalsContact CZ-SG 3.52Å; F54-C58 PolarHBondContact O-N 3.47Å; F54-C58 PolarHBondContact O-SG 2.92Å; E55-C58 PolarHBondContact O-N 3.25Å; C58-Q60 VanDerWaalsContact C-N 3.34Å; C58-Q60 PolarHBondContact O-N 2.89Å; C58-M61 PolarHBondContact O-N 2.97Å; C58-Q62 WeakPolarHBondContact O-CG 3.44Å; C58-Q62 PolarHBondContact O-N 2.81Å
59	K	95	Very high	89.1	Confident	133 Å²	133	110.8 Å²	110.8	58%	0.578	56%	0.564	S	S	*	*	H	α-helix	trans	-62.1	-41.2	178	-73.7	172.5	-176.3	172.5	0	111.9	E55 A56 F57 M61 Q62 S63	E55-K59 WeakPolarHBondContact O-CG 3.24Å; E55-K59 PolarHBondContact O-N 2.86Å; A56-K59 PolarHBondContact O-N 3.27Å; F57-K59 PolarHBondContact O-N 3.17Å; K59-M61 VanDerWaalsContact C-N 3.35Å; K59-M61 PolarHBondContact O-N 2.92Å; K59-Q62 PolarHBondContact O-N 3.36Å; K59-S63 PolarHBondContact O-N 3.38Å; K59-S63 PolarHBondContact O-OG 3.46Å
60	Q	93.5	Very high	88.5	Confident	122 Å²	122	112.9 Å²	112.9	57%	0.57	57%	0.574	S	S	*	*	H	α-helix	trans	-61.4	-43.4	176.7	-176.3	179.6	-25	0	0	111.6	A56 F57 C58 S63 Q64	A56-Q60 PolarHBondContact O-N 3.2Å; F57-Q60 PolarHBondContact O-N 3.37Å; C58-Q60 VanDerWaalsContact C-N 3.34Å; C58-Q60 PolarHBondContact O-N 2.89Å; Q60-S63 PolarHBondContact O-N 3.39Å; Q60-S63 PolarHBondContact O-OG 2.8Å; Q60-Q64 PolarHBondContact O-N 3.21Å
61	M	89.7	Confident	87.9	Confident	102 Å²	102	111.5 Å²	111.5	50%	0.502	57%	0.57	S	S	.	*	H	α-helix	trans	-64.9	-38.8	177.3	-68.3	-115.1	72.3	0	0	112.5	F57 C58 K59 Q64	F57-M61 HydrophobicContact CE1-CG 4.1Å; F57-M61 HydrophobicContact CE1-SD 4.3Å; F57-M61 HydrophobicContact CE2-CG 4.35Å; F57-M61 HydrophobicContact CZ-CG 3.97Å; F57-M61 HydrophobicContact CZ-SD 3.89Å; F57-M61 PolarHBondContact O-N 3.04Å; F57-M61 VanDerWaalsContact O-N 3.12Å; C58-M61 PolarHBondContact O-N 2.97Å; K59-M61 VanDerWaalsContact C-N 3.35Å; K59-M61 PolarHBondContact O-N 2.92Å; M61-Q64 PolarHBondContact O-N 3.22Å
62	Q	85.1	Confident	87.2	Confident	144 Å²	144	112.7 Å²	112.7	67%	0.673	58%	0.579	S	S	*	*	H	α-helix	trans	-65.5	-40.1	177.3	-73.1	174.6	-15.4	0	0	112.2	C58 K59 Q64 G65	C58-Q62 WeakPolarHBondContact O-CG 3.44Å; C58-Q62 PolarHBondContact O-N 2.81Å; K59-Q62 PolarHBondContact O-N 3.36Å; Q62-Q64 PolarHBondContact O-N 3.1Å; Q62-G65 PolarHBondContact O-N 2.91Å
63	S	77.5	Confident	86.4	Confident	75 Å²	75	111.9 Å²	111.9	52%	0.524	58%	0.579	S	S	.	*	H	α-helix	trans	-67.9	-14.6	177.4	65.2	0	0	0	0	115.1	K59 Q60	K59-S63 PolarHBondContact O-N 3.38Å; K59-S63 PolarHBondContact O-OG 3.46Å; Q60-S63 PolarHBondContact O-N 3.39Å; Q60-S63 PolarHBondContact O-OG 2.8Å
64	Q	72.6	Confident	85.5	Confident	136 Å²	136	111 Å²	111	64%	0.636	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.7	-9.6	175.3	-72.8	-171.6	-13.1	0	0	113.1	Q60 M61 Q62	Q60-Q64 PolarHBondContact O-N 3.21Å; M61-Q64 PolarHBondContact O-N 3.22Å; Q62-Q64 PolarHBondContact O-N 3.1Å
65	G	63.8	Low	84.5	Confident	72 Å²	72	110.3 Å²	110.3	74%	0.742	58%	0.584	S	S	*	*			trans	-97.8	-6	-178.4	0	0	0	0	0	115.2	Q62	Q62-G65 PolarHBondContact O-N 2.91Å
66	E	50.6	Low	83.3	Confident	236 Å²	236	112.5 Å²	112.5	100%	1.103	60%	0.6	S	S	*	*			trans	-95.6	0	167.3	-70.6	-175.1	138	0	0	110.5

Retrieved 66 of 66 residues in 236.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).