A0A060Y8I4_ONCMY Loading...

Intraflagellar transport protein 20 homolog

AlphaFold DB , UniProt , Accession A0A060Y8I4, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 132 aa.

						>A0A060Y8I4_ONCMY|A0A060Y8I4
MAKDPLAEAGLHFDELNKLRVLEPEVDQKTRELKEECEDFVDKIGQFQKIVGGLIELVDELAKEAETEKMKAIGARNLLKSVAKQREAQQQQLQALIAEKKMQLERYRIEYEALSKVEAEQNEFIEQFILQK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	70.7	Confident	241 Å²	241	98.5 Å²	98.5	100%	1.187	58%	0.58	S	S	*	*				0	123.8	0	-66.4	-177.9	176.2	0	0	106.3	K3	M1-K3 PolarHBondContact O-N 3.43Å
2	A	55	Low	71.8	Confident	107 Å²	107	94.4 Å²	94.4	88%	0.884	55%	0.551	S	S	*	*			trans	-59.5	126.1	-178.3	0	0	0	0	0	108.4	D4	A2-D4 PolarHBondContact O-N 3.47Å
3	K	56.9	Low	72.7	Confident	156 Å²	156	95.7 Å²	95.7	68%	0.678	55%	0.546	S	S	*	.			trans	-63.5	134.8	172.2	-69.6	179.3	175.2	-177.5	0	107.5	M1 P5 E8	M1-K3 PolarHBondContact O-N 3.43Å; K3-P5 VanDerWaalsContact O-CD 3.23Å; K3-P5 WeakPolarHBondContact O-CD 3.3Å; K3-E8 HydrophobicContact CB-CG 4.22Å; K3-E8 WeakPolarHBondContact CB-OE1 3.43Å; K3-E8 WeakPolarHBondContact CD-OE1 3.37Å; K3-E8 IonicContact NZ-OE1 3.97Å
4	D	73.4	Confident	73.4	Confident	85 Å²	85	90.3 Å²	90.3	46%	0.455	51%	0.514	S	S	.	.			trans	-62	114.8	177.9	-176.7	-7.7	0	0	0	108.6	A2 L6 A7 E8	A2-D4 PolarHBondContact O-N 3.47Å; D4-L6 PolarHBondContact O-N 3.43Å; D4-L6 VanDerWaalsContact O-N 3.11Å; D4-L6 WeakPolarHBondContact OD1-CB 3.39Å; D4-L6 PolarHBondContact OD1-N 3.21Å; D4-A7 HydrophobicContact CB-CB 3.92Å; D4-A7 WeakPolarHBondContact O-CB 3.45Å; D4-A7 PolarHBondContact O-N 2.98Å; D4-E8 PolarHBondContact O-N 3.42Å; D4-E8 VanDerWaalsContact O-N 3.07Å
5	P	76.1	Confident	74	Confident	100 Å²	100	96.6 Å²	96.6	65%	0.649	54%	0.538	S	S	*	.	H	α-helix	trans	-58.2	-26	-178.3	-21.7	32.2	0	0	0	112.8	K3 A9	K3-P5 VanDerWaalsContact O-CD 3.23Å; K3-P5 WeakPolarHBondContact O-CD 3.3Å; P5-A9 PolarHBondContact O-N 3.3Å
6	L	73.3	Confident	74.7	Confident	60 Å²	60	98.4 Å²	98.4	31%	0.314	55%	0.545	S	S	.	.	H	α-helix	trans	-73.2	-42.9	176.9	-68.5	157.4	0	0	0	111	D4 E8 A9 G10 L11 F13 L19	D4-L6 PolarHBondContact O-N 3.43Å; D4-L6 VanDerWaalsContact O-N 3.11Å; D4-L6 WeakPolarHBondContact OD1-CB 3.39Å; D4-L6 PolarHBondContact OD1-N 3.21Å; L6-E8 VanDerWaalsContact C-N 3.31Å; L6-E8 PolarHBondContact O-N 2.9Å; L6-A9 CarbonylContact O-C 3.22Å; L6-A9 WeakPolarHBondContact O-CA 3.4Å; L6-A9 PolarHBondContact O-N 2.9Å; L6-G10 PolarHBondContact O-N 3.19Å; L6-L11 CarbonylContact C-O 3.59Å; L6-L11 VanDerWaalsContact C-O 3.22Å; L6-L11 HydrophobicContact CB-CB 4.32Å; L6-L11 HydrophobicContact CD2-CB 4.24Å; L6-L11 HydrophobicContact CD2-CD1 4.14Å; L6-L11 PolarHBondContact O-N 2.97Å; L6-L11 VanDerWaalsContact O-O 3.11Å; L6-F13 HydrophobicContact CD1-CD2 4.37Å; L6-F13 HydrophobicContact CD1-CE2 3.56Å; L6-F13 HydrophobicContact CD1-CZ 4.31Å; L6-L19 HydrophobicContact CD2-CD1 4.26Å
7	A	72.1	Confident	75.1	Confident	53 Å²	53	100.6 Å²	100.6	44%	0.438	56%	0.556	S	S	.	*	H	α-helix	trans	-64.2	-35.7	175	0	0	0	0	0	111.9	D4 A9 G10	D4-A7 HydrophobicContact CB-CB 3.92Å; D4-A7 WeakPolarHBondContact O-CB 3.45Å; D4-A7 PolarHBondContact O-N 2.98Å; A7-A9 VanDerWaalsContact C-N 3.27Å; A7-A9 PolarHBondContact O-N 2.98Å; A7-G10 PolarHBondContact O-N 3.44Å; A7-G10 VanDerWaalsContact O-N 3.17Å
8	E	77.3	Confident	75.7	Confident	131 Å²	131	101.6 Å²	101.6	61%	0.612	55%	0.553	S	S	*	*	H	α-helix	trans	-66.9	-26.8	173	-70.3	-168.1	157	0	0	113.1	K3 D4 L6 G10	K3-E8 HydrophobicContact CB-CG 4.22Å; K3-E8 WeakPolarHBondContact CB-OE1 3.43Å; K3-E8 WeakPolarHBondContact CD-OE1 3.37Å; K3-E8 IonicContact NZ-OE1 3.97Å; D4-E8 PolarHBondContact O-N 3.42Å; D4-E8 VanDerWaalsContact O-N 3.07Å; L6-E8 VanDerWaalsContact C-N 3.31Å; L6-E8 PolarHBondContact O-N 2.9Å; E8-G10 VanDerWaalsContact C-N 3.33Å
9	A	81.3	Confident	76.3	Confident	71 Å²	71	101.3 Å²	101.3	59%	0.587	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	1.6	174.1	0	0	0	0	0	113.6	P5 L6 A7 L11	P5-A9 PolarHBondContact O-N 3.3Å; L6-A9 CarbonylContact O-C 3.22Å; L6-A9 WeakPolarHBondContact O-CA 3.4Å; L6-A9 PolarHBondContact O-N 2.9Å; A7-A9 VanDerWaalsContact C-N 3.27Å; A7-A9 PolarHBondContact O-N 2.98Å; A9-L11 VanDerWaalsContact C-N 3.32Å; A9-L11 HydrophobicContact CB-CD1 4.29Å; A9-L11 HydrophobicContact CB-CG 4.4Å
10	G	80.3	Confident	76.5	Confident	31 Å²	31	101.3 Å²	101.3	32%	0.32	54%	0.542	S	S	.	.	T	Hydrogen-bonded Turn	trans	71.5	24.3	-176.2	0	0	0	0	0	113.8	L6 A7 E8	L6-G10 PolarHBondContact O-N 3.19Å; A7-G10 PolarHBondContact O-N 3.44Å; A7-G10 VanDerWaalsContact O-N 3.17Å; E8-G10 VanDerWaalsContact C-N 3.33Å
11	L	84.4	Confident	77	Confident	49 Å²	49	102.4 Å²	102.4	26%	0.257	55%	0.553	S	S	.	*			trans	-107	130.7	178.3	-63.2	171.7	0	0	0	110	L6 A9 L19 R20 V21	L6-L11 CarbonylContact C-O 3.59Å; L6-L11 VanDerWaalsContact C-O 3.22Å; L6-L11 HydrophobicContact CB-CB 4.32Å; L6-L11 HydrophobicContact CD2-CB 4.24Å; L6-L11 HydrophobicContact CD2-CD1 4.14Å; L6-L11 PolarHBondContact O-N 2.97Å; L6-L11 VanDerWaalsContact O-O 3.11Å; A9-L11 VanDerWaalsContact C-N 3.32Å; A9-L11 HydrophobicContact CB-CD1 4.29Å; A9-L11 HydrophobicContact CB-CG 4.4Å; L11-L19 HydrophobicContact CB-CD1 4.14Å; L11-L19 HydrophobicContact CB-CG 4.47Å; L11-L19 HydrophobicContact CD1-CD2 4.25Å; L11-L19 HydrophobicContact CD2-CD2 4.17Å; L11-L19 HydrophobicContact CD2-CG 4.34Å; L11-R20 CarbonylContact C-O 3.55Å; L11-R20 WeakPolarHBondContact CA-O 3.29Å; L11-V21 HydrophobicContact CD2-CG2 4.23Å
12	H	84.4	Confident	78.7	Confident	49 Å²	49	95.2 Å²	95.2	23%	0.227	52%	0.519	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	146.6	-175.1	-55.4	-92.9	0	0	0	109.8	L19 R20	H12-L19 CarbonylContact O-C 3.49Å; H12-R20 PolarHBondContact N-O 3.06Å; H12-R20 WeakPolarHBondContact O-CA 3.49Å; H12-R20 WeakPolarHBondContact O-CB 3.46Å; H12-R20 PolarHBondContact O-N 3.31Å
13	F	83.1	Confident	80.2	Confident	111 Å²	111	94.4 Å²	94.4	49%	0.487	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.1	136.4	168.4	-75.5	-71	0	0	0	110.1	L6 K18 L19	L6-F13 HydrophobicContact CD1-CD2 4.37Å; L6-F13 HydrophobicContact CD1-CE2 3.56Å; L6-F13 HydrophobicContact CD1-CZ 4.31Å; F13-K18 WeakPolarHBondContact CA-O 3.5Å; F13-L19 HydrophobicContact CD1-CD1 4.28Å; F13-L19 HydrophobicContact CE1-CB 4.3Å; F13-L19 HydrophobicContact CE1-CD1 3.76Å; F13-L19 HydrophobicContact CE2-CD1 4.34Å; F13-L19 HydrophobicContact CZ-CD1 3.79Å
14	D	82.1	Confident	81.5	Confident	20 Å²	20	88.9 Å²	88.9	11%	0.107	48%	0.477	C	S	.	.			trans	-84.4	174.8	169.1	70.3	15	0	0	0	112.5	L16 N17 K18 R20 P24	D14-L16 PolarHBondContact O-N 3.49Å; D14-L16 WeakPolarHBondContact OD1-CA 3.3Å; D14-L16 WeakPolarHBondContact OD1-CB 3.49Å; D14-L16 PolarHBondContact OD1-N 3.38Å; D14-N17 PolarHBondContact O-N 3.19Å; D14-N17 PolarHBondContact OD1-N 2.96Å; D14-K18 PolarHBondContact N-O 3.4Å; D14-K18 WeakPolarHBondContact OD1-CB 3.29Å; D14-K18 PolarHBondContact OD1-N 3.47Å; D14-R20 HydrophobicContact CB-CG 4.08Å; D14-R20 IonicContact OD2-CZ 3.34Å; D14-R20 IonicContact OD2-NE 3.03Å; D14-R20 PolarHBondContact OD2-NE 2.95Å; D14-R20 IonicContact OD2-NH2 3.41Å; D14-R20 PolarHBondContact OD2-NH2 3.25Å; D14-P24 HydrophobicContact CB-CB 4.28Å; D14-P24 HydrophobicContact CB-CG 3.89Å
15	E	82.3	Confident	82.1	Confident	185 Å²	185	90 Å²	90	86%	0.864	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	-11.9	179.5	-59	-176.4	166.1	0	0	114
16	L	85.3	Confident	82.6	Confident	126 Å²	126	88.2 Å²	88.2	66%	0.66	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	-105	15.1	176.8	-58.8	176.7	0	0	0	112.3	D14 K18	D14-L16 PolarHBondContact O-N 3.49Å; D14-L16 WeakPolarHBondContact OD1-CA 3.3Å; D14-L16 WeakPolarHBondContact OD1-CB 3.49Å; D14-L16 PolarHBondContact OD1-N 3.38Å; L16-K18 HydrophobicContact CB-CG 4.33Å; L16-K18 PolarHBondContact O-N 3.4Å
17	N	82.7	Confident	83.3	Confident	136 Å²	136	87.5 Å²	87.5	73%	0.727	46%	0.462	S	S	*	.	S	Bend	trans	57.4	27	-175.9	-60.5	-52.9	0	0	0	114	D14	D14-N17 PolarHBondContact O-N 3.19Å; D14-N17 PolarHBondContact OD1-N 2.96Å
18	K	84.7	Confident	84.1	Confident	117 Å²	117	89.9 Å²	89.9	51%	0.509	47%	0.465	S	S	.	.			trans	-90.4	137.6	173.9	-57.8	-179.4	179.8	178	0	109.8	F13 D14 L16	F13-K18 WeakPolarHBondContact CA-O 3.5Å; D14-K18 PolarHBondContact N-O 3.4Å; D14-K18 WeakPolarHBondContact OD1-CB 3.29Å; D14-K18 PolarHBondContact OD1-N 3.47Å; L16-K18 HydrophobicContact CB-CG 4.33Å; L16-K18 PolarHBondContact O-N 3.4Å
19	L	86.9	Confident	84.7	Confident	96 Å²	96	89.1 Å²	89.1	50%	0.503	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.5	129.5	175.1	-160.9	79.1	0	0	0	110	L6 L11 H12 F13	L6-L19 HydrophobicContact CD2-CD1 4.26Å; L11-L19 HydrophobicContact CB-CD1 4.14Å; L11-L19 HydrophobicContact CB-CG 4.47Å; L11-L19 HydrophobicContact CD1-CD2 4.25Å; L11-L19 HydrophobicContact CD2-CD2 4.17Å; L11-L19 HydrophobicContact CD2-CG 4.34Å; H12-L19 CarbonylContact O-C 3.49Å; F13-L19 HydrophobicContact CD1-CD1 4.28Å; F13-L19 HydrophobicContact CE1-CB 4.3Å; F13-L19 HydrophobicContact CE1-CD1 3.76Å; F13-L19 HydrophobicContact CE2-CD1 4.34Å; F13-L19 HydrophobicContact CZ-CD1 3.79Å
20	R	82	Confident	85.2	Confident	101 Å²	101	89.6 Å²	89.6	38%	0.381	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	149.2	-178.8	-60.7	-69.3	-177.5	170.5	2.6	109.7	L11 H12 D14 L22	L11-R20 CarbonylContact C-O 3.55Å; L11-R20 WeakPolarHBondContact CA-O 3.29Å; H12-R20 PolarHBondContact N-O 3.06Å; H12-R20 WeakPolarHBondContact O-CA 3.49Å; H12-R20 WeakPolarHBondContact O-CB 3.46Å; H12-R20 PolarHBondContact O-N 3.31Å; D14-R20 HydrophobicContact CB-CG 4.08Å; D14-R20 IonicContact OD2-CZ 3.34Å; D14-R20 IonicContact OD2-NE 3.03Å; D14-R20 PolarHBondContact OD2-NE 2.95Å; D14-R20 IonicContact OD2-NH2 3.41Å; D14-R20 PolarHBondContact OD2-NH2 3.25Å; R20-L22 WeakPolarHBondContact CB-O 3.47Å
21	V	86.6	Confident	85.8	Confident	126 Å²	126	95 Å²	95	76%	0.764	47%	0.466	S	S	*	.	S	Bend	trans	-95.3	-10.1	175.7	-170.5	0	0	0	0	111.4	L11	L11-V21 HydrophobicContact CD2-CG2 4.23Å
22	L	82.5	Confident	86.3	Confident	90 Å²	90	96.8 Å²	96.8	47%	0.471	47%	0.473	S	S	.	.	S	Bend	trans	-119.6	140.6	174.9	-176.1	63.3	0	0	0	108.4	R20 P24 V26 D27	R20-L22 WeakPolarHBondContact CB-O 3.47Å; L22-P24 WeakPolarHBondContact O-CD 3.41Å; L22-V26 HydrophobicContact CD1-CG1 4.37Å; L22-D27 HydrophobicContact CD2-CB 3.74Å; L22-D27 HydrophobicContact CG-CB 4.25Å
23	E	86.7	Confident	86.8	Confident	90 Å²	90	99.4 Å²	99.4	42%	0.421	49%	0.488	S	S	.	.			trans	-59.7	123.4	176.1	-173.6	166.2	-146.7	0	0	110.2	E25 V26 D27	E23-E25 VanDerWaalsContact C-N 3.29Å; E23-E25 PolarHBondContact O-N 3.3Å; E23-V26 HydrophobicContact CB-CB 4.19Å; E23-V26 HydrophobicContact CB-CG2 3.93Å; E23-V26 HydrophobicContact CG-CG2 4.18Å; E23-V26 WeakPolarHBondContact O-CB 3.31Å; E23-V26 PolarHBondContact O-N 2.86Å; E23-V26 WeakPolarHBondContact OE2-CG2 3.36Å; E23-D27 PolarHBondContact O-N 2.94Å
24	P	84.8	Confident	87.4	Confident	40 Å²	40	100.2 Å²	100.2	26%	0.26	49%	0.491	S	S	.	.	H	α-helix	trans	-56.6	-38.1	-173	-27.3	33.4	0	0	0	114.2	D14 L22 V26 D27 Q28	D14-P24 HydrophobicContact CB-CB 4.28Å; D14-P24 HydrophobicContact CB-CG 3.89Å; L22-P24 WeakPolarHBondContact O-CD 3.41Å; P24-V26 VanDerWaalsContact C-N 3.33Å; P24-V26 PolarHBondContact O-N 2.9Å; P24-D27 PolarHBondContact O-N 3.26Å; P24-Q28 WeakPolarHBondContact O-CB 3.35Å; P24-Q28 PolarHBondContact O-N 3.03Å
25	E	85.7	Confident	88.1	Confident	109 Å²	109	105.2 Å²	105.2	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-66.4	-35.7	177.6	-169.8	-179.8	170.5	0	0	111.8	E23 K29	E23-E25 VanDerWaalsContact C-N 3.29Å; E23-E25 PolarHBondContact O-N 3.3Å; E25-K29 HydrophobicContact CG-CD 4.32Å; E25-K29 WeakPolarHBondContact O-CB 3.43Å; E25-K29 VanDerWaalsContact O-CG 3.3Å; E25-K29 WeakPolarHBondContact O-CG 3.45Å; E25-K29 PolarHBondContact O-N 3Å; E25-K29 VanDerWaalsContact OE1-CE 3.31Å; E25-K29 WeakPolarHBondContact OE1-CE 3.22Å; E25-K29 IonicContact OE1-NZ 2.63Å; E25-K29 PolarHBondContact OE1-NZ 3.47Å
26	V	86.8	Confident	88.8	Confident	61 Å²	61	102.7 Å²	102.7	37%	0.37	50%	0.502	S	S	.	.	H	α-helix	trans	-72.5	-40.5	176.6	179	0	0	0	0	110.9	L22 E23 P24 T30	L22-V26 HydrophobicContact CD1-CG1 4.37Å; E23-V26 HydrophobicContact CB-CB 4.19Å; E23-V26 HydrophobicContact CB-CG2 3.93Å; E23-V26 HydrophobicContact CG-CG2 4.18Å; E23-V26 WeakPolarHBondContact O-CB 3.31Å; E23-V26 PolarHBondContact O-N 2.86Å; E23-V26 WeakPolarHBondContact OE2-CG2 3.36Å; P24-V26 VanDerWaalsContact C-N 3.33Å; P24-V26 PolarHBondContact O-N 2.9Å; V26-T30 VanDerWaalsContact O-CB 3.24Å; V26-T30 WeakPolarHBondContact O-CB 3.46Å; V26-T30 PolarHBondContact O-N 2.87Å; V26-T30 PolarHBondContact O-OG1 3.37Å
27	D	87.1	Confident	89.3	Confident	45 Å²	45	99.9 Å²	99.9	24%	0.241	49%	0.492	C	S	.	.	H	α-helix	trans	-61	-47.1	174.1	-174.9	33.6	0	0	0	110.8	L22 E23 P24 T30 R31	L22-D27 HydrophobicContact CD2-CB 3.74Å; L22-D27 HydrophobicContact CG-CB 4.25Å; E23-D27 PolarHBondContact O-N 2.94Å; P24-D27 PolarHBondContact O-N 3.26Å; D27-T30 PolarHBondContact O-N 3.18Å; D27-R31 WeakPolarHBondContact O-CG 3.48Å; D27-R31 PolarHBondContact O-N 3.42Å; D27-R31 IonicContact OD1-CZ 2.72Å; D27-R31 IonicContact OD1-NE 2.72Å; D27-R31 PolarHBondContact OD1-NE 3.12Å; D27-R31 IonicContact OD1-NH2 3.27Å; D27-R31 PolarHBondContact OD1-NH2 3.12Å; D27-R31 IonicContact OD2-CZ 2.89Å; D27-R31 VanDerWaalsContact OD2-CZ 3.27Å; D27-R31 IonicContact OD2-NE 3.59Å; D27-R31 PolarHBondContact OD2-NE 3.35Å; D27-R31 IonicContact OD2-NH2 3.72Å; D27-R31 PolarHBondContact OD2-NH2 2.96Å
28	Q	88.6	Confident	90	Very high	103 Å²	103	98.3 Å²	98.3	48%	0.481	48%	0.481	S	S	.	.	H	α-helix	trans	-61.4	-53.3	178.5	-178.6	176.8	-4.6	0	0	112	P24 T30 R31 E32	P24-Q28 WeakPolarHBondContact O-CB 3.35Å; P24-Q28 PolarHBondContact O-N 3.03Å; Q28-T30 PolarHBondContact O-N 3.39Å; Q28-R31 PolarHBondContact O-N 3.41Å; Q28-E32 HydrophobicContact CG-CG 4.45Å; Q28-E32 WeakPolarHBondContact CG-OE1 3.29Å; Q28-E32 PolarHBondContact NE2-OE1 3.48Å; Q28-E32 WeakPolarHBondContact O-CG 3.39Å; Q28-E32 PolarHBondContact O-N 3.27Å
29	K	90.9	Very high	90.6	Very high	115 Å²	115	97.1 Å²	97.1	50%	0.5	48%	0.48	S	S	.	.	H	α-helix	trans	-60.5	-34.8	179.4	-73.7	177.2	-174.8	169.8	0	112.4	E25 L33	E25-K29 HydrophobicContact CG-CD 4.32Å; E25-K29 WeakPolarHBondContact O-CB 3.43Å; E25-K29 VanDerWaalsContact O-CG 3.3Å; E25-K29 WeakPolarHBondContact O-CG 3.45Å; E25-K29 PolarHBondContact O-N 3Å; E25-K29 VanDerWaalsContact OE1-CE 3.31Å; E25-K29 WeakPolarHBondContact OE1-CE 3.22Å; E25-K29 IonicContact OE1-NZ 2.63Å; E25-K29 PolarHBondContact OE1-NZ 3.47Å; K29-L33 VanDerWaalsContact O-CB 3.24Å; K29-L33 WeakPolarHBondContact O-CB 3.45Å; K29-L33 PolarHBondContact O-N 2.95Å
30	T	92.6	Very high	91.1	Very high	82 Å²	82	98.6 Å²	98.6	50%	0.503	48%	0.482	S	S	.	.	H	α-helix	trans	-68.7	-36.3	177.3	-58	0	0	0	0	111.5	V26 D27 Q28 K34	V26-T30 VanDerWaalsContact O-CB 3.24Å; V26-T30 WeakPolarHBondContact O-CB 3.46Å; V26-T30 PolarHBondContact O-N 2.87Å; V26-T30 PolarHBondContact O-OG1 3.37Å; D27-T30 PolarHBondContact O-N 3.18Å; Q28-T30 PolarHBondContact O-N 3.39Å; T30-K34 WeakPolarHBondContact O-CB 3.47Å; T30-K34 PolarHBondContact O-N 3.41Å
31	R	92.1	Very high	91.8	Very high	143 Å²	143	98.4 Å²	98.4	54%	0.54	49%	0.492	S	S	.	.	H	α-helix	trans	-70.5	-45.6	174.9	-69.7	175.1	-167.5	-164.4	5.9	112.2	D27 Q28 L33 K34 E35	D27-R31 WeakPolarHBondContact O-CG 3.48Å; D27-R31 PolarHBondContact O-N 3.42Å; D27-R31 IonicContact OD1-CZ 2.72Å; D27-R31 IonicContact OD1-NE 2.72Å; D27-R31 PolarHBondContact OD1-NE 3.12Å; D27-R31 IonicContact OD1-NH2 3.27Å; D27-R31 PolarHBondContact OD1-NH2 3.12Å; D27-R31 IonicContact OD2-CZ 2.89Å; D27-R31 VanDerWaalsContact OD2-CZ 3.27Å; D27-R31 IonicContact OD2-NE 3.59Å; D27-R31 PolarHBondContact OD2-NE 3.35Å; D27-R31 IonicContact OD2-NH2 3.72Å; D27-R31 PolarHBondContact OD2-NH2 2.96Å; Q28-R31 PolarHBondContact O-N 3.41Å; R31-L33 VanDerWaalsContact C-N 3.32Å; R31-L33 PolarHBondContact O-N 3.25Å; R31-K34 WeakPolarHBondContact O-CB 3.11Å; R31-K34 PolarHBondContact O-N 3.29Å; R31-K34 VanDerWaalsContact O-N 3.11Å; R31-E35 PolarHBondContact O-N 3.45Å
32	E	94.9	Very high	92.3	Very high	88 Å²	88	97.3 Å²	97.3	41%	0.411	48%	0.482	S	S	.	.	H	α-helix	trans	-57.7	-47.1	175.2	-71.2	171.5	-176	0	0	110.7	Q28 K34 E35 E36	Q28-E32 HydrophobicContact CG-CG 4.45Å; Q28-E32 WeakPolarHBondContact CG-OE1 3.29Å; Q28-E32 PolarHBondContact NE2-OE1 3.48Å; Q28-E32 WeakPolarHBondContact O-CG 3.39Å; Q28-E32 PolarHBondContact O-N 3.27Å; E32-K34 VanDerWaalsContact C-N 3.29Å; E32-K34 PolarHBondContact O-N 3.32Å; E32-E35 PolarHBondContact O-N 2.98Å; E32-E36 WeakPolarHBondContact O-CG 3.43Å; E32-E36 PolarHBondContact O-N 2.89Å
33	L	95.1	Very high	93	Very high	103 Å²	103	99.2 Å²	99.2	54%	0.539	49%	0.487	S	S	.	.	H	α-helix	trans	-59.6	-40.1	175.5	-179.4	63	0	0	0	112.1	K29 R31 E36 C37	K29-L33 VanDerWaalsContact O-CB 3.24Å; K29-L33 WeakPolarHBondContact O-CB 3.45Å; K29-L33 PolarHBondContact O-N 2.95Å; R31-L33 VanDerWaalsContact C-N 3.32Å; R31-L33 PolarHBondContact O-N 3.25Å; L33-E36 PolarHBondContact O-N 3Å; L33-C37 WeakPolarHBondContact O-CB 3.24Å; L33-C37 PolarHBondContact O-N 3.41Å; L33-C37 PolarHBondContact O-SG 3.05Å
34	K	95.8	Very high	93.5	Very high	129 Å²	129	98 Å²	98	56%	0.561	48%	0.482	S	S	*	.	H	α-helix	trans	-62.2	-46.8	177.1	-177.4	-170.7	167.1	-163.5	0	111.2	T30 R31 E32 C37 E38	T30-K34 WeakPolarHBondContact O-CB 3.47Å; T30-K34 PolarHBondContact O-N 3.41Å; R31-K34 WeakPolarHBondContact O-CB 3.11Å; R31-K34 PolarHBondContact O-N 3.29Å; R31-K34 VanDerWaalsContact O-N 3.11Å; E32-K34 VanDerWaalsContact C-N 3.29Å; E32-K34 PolarHBondContact O-N 3.32Å; K34-C37 PolarHBondContact O-N 3.23Å; K34-E38 WeakPolarHBondContact CE-OE1 3.48Å; K34-E38 IonicContact NZ-OE1 2.7Å; K34-E38 WeakPolarHBondContact O-CG 3.37Å; K34-E38 PolarHBondContact O-N 2.92Å
35	E	96.6	Very high	94.2	Very high	125 Å²	125	97.4 Å²	97.4	58%	0.584	48%	0.483	S	S	*	.	H	α-helix	trans	-62.6	-45.3	178.3	-70.6	176.3	-174.8	0	0	111.2	R31 E32 C37 E38 D39	R31-E35 PolarHBondContact O-N 3.45Å; E32-E35 PolarHBondContact O-N 2.98Å; E35-C37 VanDerWaalsContact C-N 3.31Å; E35-C37 PolarHBondContact O-N 3.39Å; E35-E38 PolarHBondContact O-N 3.38Å; E35-D39 PolarHBondContact O-N 2.93Å
36	E	96.3	Very high	94.7	Very high	132 Å²	132	98 Å²	98	62%	0.617	49%	0.486	S	S	*	.	H	α-helix	trans	-61.8	-38.1	175.5	-73.2	-172.6	173.9	0	0	112.6	E32 L33 F40	E32-E36 WeakPolarHBondContact O-CG 3.43Å; E32-E36 PolarHBondContact O-N 2.89Å; L33-E36 PolarHBondContact O-N 3Å; E36-F40 VanDerWaalsContact O-CB 3.27Å; E36-F40 WeakPolarHBondContact O-CB 3.49Å; E36-F40 PolarHBondContact O-N 3.01Å
37	C	96.6	Very high	95.2	Very high	66 Å²	66	101.2 Å²	101.2	45%	0.446	50%	0.495	S	S	.	.	H	α-helix	trans	-65.2	-41.4	174.9	-76.6	0	0	0	0	112.1	L33 K34 E35 F40 V41	L33-C37 WeakPolarHBondContact O-CB 3.24Å; L33-C37 PolarHBondContact O-N 3.41Å; L33-C37 PolarHBondContact O-SG 3.05Å; K34-C37 PolarHBondContact O-N 3.23Å; E35-C37 VanDerWaalsContact C-N 3.31Å; E35-C37 PolarHBondContact O-N 3.39Å; C37-F40 PolarHBondContact O-N 3.03Å; C37-V41 VanDerWaalsContact O-CG2 3.3Å; C37-V41 WeakPolarHBondContact O-CG2 3.49Å; C37-V41 PolarHBondContact O-N 3.45Å
38	E	96.5	Very high	95.7	Very high	104 Å²	104	105.2 Å²	105.2	49%	0.486	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-49.2	175.4	-73.6	177.8	-179.6	0	0	110.6	K34 E35 F40 V41 D42	K34-E38 WeakPolarHBondContact CE-OE1 3.48Å; K34-E38 IonicContact NZ-OE1 2.7Å; K34-E38 WeakPolarHBondContact O-CG 3.37Å; K34-E38 PolarHBondContact O-N 2.92Å; E35-E38 PolarHBondContact O-N 3.38Å; E38-F40 VanDerWaalsContact C-N 3.3Å; E38-F40 PolarHBondContact O-N 3.36Å; E38-V41 PolarHBondContact O-N 3.32Å; E38-D42 PolarHBondContact O-N 3.48Å
39	D	97.1	Very high	96.1	Very high	91 Å²	91	108.2 Å²	108.2	49%	0.487	52%	0.524	S	S	.	.	H	α-helix	trans	-58.3	-39.9	175.3	-91	7.5	0	0	0	112.9	E35 D42 K43	E35-D39 PolarHBondContact O-N 2.93Å; D39-D42 PolarHBondContact O-N 3.37Å; D39-K43 WeakPolarHBondContact O-CB 3.35Å; D39-K43 VanDerWaalsContact O-CG 3.29Å; D39-K43 WeakPolarHBondContact O-CG 3.35Å; D39-K43 PolarHBondContact O-N 3.47Å
40	F	97.4	Very high	96.4	Very high	128 Å²	128	108.4 Å²	108.4	56%	0.561	53%	0.529	S	S	*	.	H	α-helix	trans	-65.5	-45.4	178.3	-179.4	-96	0	0	0	111.3	E36 C37 E38 D42 K43 I44	E36-F40 VanDerWaalsContact O-CB 3.27Å; E36-F40 WeakPolarHBondContact O-CB 3.49Å; E36-F40 PolarHBondContact O-N 3.01Å; C37-F40 PolarHBondContact O-N 3.03Å; E38-F40 VanDerWaalsContact C-N 3.3Å; E38-F40 PolarHBondContact O-N 3.36Å; F40-D42 VanDerWaalsContact C-N 3.3Å; F40-D42 PolarHBondContact O-N 2.94Å; F40-K43 PolarHBondContact O-N 3.35Å; F40-I44 HydrophobicContact CD1-CG1 4.1Å; F40-I44 HydrophobicContact CE1-CD1 4.33Å; F40-I44 HydrophobicContact CE1-CG1 3.66Å; F40-I44 HydrophobicContact CE2-CD1 4.36Å; F40-I44 HydrophobicContact CE2-CG1 4.23Å; F40-I44 HydrophobicContact CZ-CD1 3.92Å; F40-I44 HydrophobicContact CZ-CG1 3.73Å; F40-I44 WeakPolarHBondContact O-CG1 3.34Å; F40-I44 PolarHBondContact O-N 3.39Å
41	V	97.3	Very high	96.7	Very high	97 Å²	97	107 Å²	107	59%	0.588	52%	0.52	S	S	*	.	H	α-helix	trans	-60.5	-42.9	177.3	170.2	0	0	0	0	110.5	C37 E38 I44 G45	C37-V41 VanDerWaalsContact O-CG2 3.3Å; C37-V41 WeakPolarHBondContact O-CG2 3.49Å; C37-V41 PolarHBondContact O-N 3.45Å; E38-V41 PolarHBondContact O-N 3.32Å; V41-I44 PolarHBondContact O-N 3.33Å; V41-G45 PolarHBondContact O-N 3.07Å
42	D	97.8	Very high	97	Very high	102 Å²	102	101.5 Å²	101.5	55%	0.545	51%	0.508	S	S	.	.	H	α-helix	trans	-63.2	-45	177.7	-81.4	-6.5	0	0	0	112.4	E38 D39 F40 I44 G45 Q46	E38-D42 PolarHBondContact O-N 3.48Å; D39-D42 PolarHBondContact O-N 3.37Å; F40-D42 VanDerWaalsContact C-N 3.3Å; F40-D42 PolarHBondContact O-N 2.94Å; D42-I44 PolarHBondContact O-N 2.92Å; D42-G45 PolarHBondContact O-N 2.94Å; D42-Q46 WeakPolarHBondContact O-CG 3.41Å; D42-Q46 PolarHBondContact O-N 3.36Å
43	K	97.5	Very high	97.1	Very high	131 Å²	131	98.6 Å²	98.6	57%	0.57	50%	0.502	S	S	*	.	H	α-helix	trans	-61.8	-42.2	176.1	-74.7	168.8	-173.1	162.6	0	111.8	D39 F40 G45 Q46 F47	D39-K43 WeakPolarHBondContact O-CB 3.35Å; D39-K43 VanDerWaalsContact O-CG 3.29Å; D39-K43 WeakPolarHBondContact O-CG 3.35Å; D39-K43 PolarHBondContact O-N 3.47Å; F40-K43 PolarHBondContact O-N 3.35Å; K43-G45 VanDerWaalsContact C-N 3.35Å; K43-Q46 PolarHBondContact O-N 2.94Å; K43-F47 WeakPolarHBondContact O-CB 3.29Å; K43-F47 PolarHBondContact O-N 3.48Å
44	I	97.3	Very high	97.2	Very high	65 Å²	65	98.7 Å²	98.7	33%	0.333	50%	0.502	S	S	.	.	H	α-helix	trans	-64.5	-40.9	175.7	-69.4	-64.8	0	0	0	110.9	F40 V41 D42 Q46 F47 Q48	F40-I44 HydrophobicContact CD1-CG1 4.1Å; F40-I44 HydrophobicContact CE1-CD1 4.33Å; F40-I44 HydrophobicContact CE1-CG1 3.66Å; F40-I44 HydrophobicContact CE2-CD1 4.36Å; F40-I44 HydrophobicContact CE2-CG1 4.23Å; F40-I44 HydrophobicContact CZ-CD1 3.92Å; F40-I44 HydrophobicContact CZ-CG1 3.73Å; F40-I44 WeakPolarHBondContact O-CG1 3.34Å; F40-I44 PolarHBondContact O-N 3.39Å; V41-I44 PolarHBondContact O-N 3.33Å; D42-I44 PolarHBondContact O-N 2.92Å; I44-Q46 VanDerWaalsContact C-N 3.34Å; I44-Q46 PolarHBondContact O-N 3.37Å; I44-F47 PolarHBondContact O-N 3.22Å; I44-Q48 HydrophobicContact CG2-CG 4.42Å; I44-Q48 WeakPolarHBondContact O-CG 3.46Å; I44-Q48 PolarHBondContact O-N 2.89Å
45	G	97.4	Very high	97.3	Very high	26 Å²	26	97.1 Å²	97.1	27%	0.268	50%	0.499	S	S	.	.	H	α-helix	trans	-61.2	-41.1	175.4	0	0	0	0	0	112.7	V41 D42 K43 K49	V41-G45 PolarHBondContact O-N 3.07Å; D42-G45 PolarHBondContact O-N 2.94Å; K43-G45 VanDerWaalsContact C-N 3.35Å; G45-K49 WeakPolarHBondContact O-CG 3.46Å; G45-K49 PolarHBondContact O-N 3.47Å
46	Q	97.3	Very high	97.3	Very high	121 Å²	121	97.5 Å²	97.5	57%	0.565	50%	0.501	S	S	*	.	H	α-helix	trans	-65.7	-44.3	173.9	-68.7	176.1	19.1	0	0	112	D42 K43 I44 Q48 K49 I50	D42-Q46 WeakPolarHBondContact O-CG 3.41Å; D42-Q46 PolarHBondContact O-N 3.36Å; K43-Q46 PolarHBondContact O-N 2.94Å; I44-Q46 VanDerWaalsContact C-N 3.34Å; I44-Q46 PolarHBondContact O-N 3.37Å; Q46-Q48 VanDerWaalsContact C-N 3.35Å; Q46-Q48 PolarHBondContact O-N 3.49Å; Q46-K49 WeakPolarHBondContact O-CB 3.49Å; Q46-K49 PolarHBondContact O-N 3.33Å; Q46-I50 WeakPolarHBondContact O-CG1 3.49Å; Q46-I50 PolarHBondContact O-N 2.99Å
47	F	97.6	Very high	97.4	Very high	130 Å²	130	96.5 Å²	96.5	57%	0.57	50%	0.499	S	S	*	.	H	α-helix	trans	-59.2	-45.7	177.2	178.5	-100.8	0	0	0	111.8	K43 I44 K49 I50 V51	K43-F47 WeakPolarHBondContact O-CB 3.29Å; K43-F47 PolarHBondContact O-N 3.48Å; I44-F47 PolarHBondContact O-N 3.22Å; F47-K49 VanDerWaalsContact C-N 3.31Å; F47-K49 PolarHBondContact O-N 2.93Å; F47-I50 PolarHBondContact O-N 3.01Å; F47-V51 HydrophobicContact CD1-CG2 4.16Å; F47-V51 HydrophobicContact CD2-CG2 4.35Å; F47-V51 HydrophobicContact CE1-CG2 3.7Å; F47-V51 HydrophobicContact CE2-CG2 3.92Å; F47-V51 HydrophobicContact CG-CG2 4.47Å; F47-V51 HydrophobicContact CZ-CG2 3.57Å; F47-V51 WeakPolarHBondContact O-CG2 3.32Å; F47-V51 PolarHBondContact O-N 3.21Å
48	Q	97.3	Very high	97.5	Very high	129 Å²	129	97.3 Å²	97.3	60%	0.603	50%	0.502	S	S	*	.	H	α-helix	trans	-59.4	-40.4	176.3	-74.8	177.2	-18.8	0	0	112.3	I44 Q46 V51 G52	I44-Q48 HydrophobicContact CG2-CG 4.42Å; I44-Q48 WeakPolarHBondContact O-CG 3.46Å; I44-Q48 PolarHBondContact O-N 2.89Å; Q46-Q48 VanDerWaalsContact C-N 3.35Å; Q46-Q48 PolarHBondContact O-N 3.49Å; Q48-V51 PolarHBondContact O-N 2.91Å; Q48-G52 PolarHBondContact O-N 3.47Å
49	K	97.6	Very high	97.5	Very high	165 Å²	165	96.6 Å²	96.6	72%	0.717	50%	0.501	S	S	*	.	H	α-helix	trans	-62.7	-43.8	175	-72.8	172.7	-178	177.4	0	112.2	G45 Q46 F47 G52 G53	G45-K49 WeakPolarHBondContact O-CG 3.46Å; G45-K49 PolarHBondContact O-N 3.47Å; Q46-K49 WeakPolarHBondContact O-CB 3.49Å; Q46-K49 PolarHBondContact O-N 3.33Å; F47-K49 VanDerWaalsContact C-N 3.31Å; F47-K49 PolarHBondContact O-N 2.93Å; K49-G52 PolarHBondContact O-N 3.46Å; K49-G53 PolarHBondContact O-N 2.91Å
50	I	97.4	Very high	97.6	Very high	120 Å²	120	97.7 Å²	97.7	62%	0.615	50%	0.504	S	S	*	.	H	α-helix	trans	-63.9	-46.8	178.8	-66.5	167.1	0	0	0	110.4	Q46 F47 G52 G53 L54	Q46-I50 WeakPolarHBondContact O-CG1 3.49Å; Q46-I50 PolarHBondContact O-N 2.99Å; F47-I50 PolarHBondContact O-N 3.01Å; I50-G52 VanDerWaalsContact C-N 3.33Å; I50-G52 PolarHBondContact O-N 3.23Å; I50-G53 PolarHBondContact O-N 2.96Å; I50-L54 WeakPolarHBondContact O-CB 3.48Å; I50-L54 PolarHBondContact O-N 3.5Å
51	V	97.8	Very high	97.6	Very high	51 Å²	51	97 Å²	97	31%	0.309	51%	0.505	S	S	.	.	H	α-helix	trans	-63.8	-40.6	178.3	173.8	0	0	0	0	111	F47 Q48 L54 I55	F47-V51 HydrophobicContact CD1-CG2 4.16Å; F47-V51 HydrophobicContact CD2-CG2 4.35Å; F47-V51 HydrophobicContact CE1-CG2 3.7Å; F47-V51 HydrophobicContact CE2-CG2 3.92Å; F47-V51 HydrophobicContact CG-CG2 4.47Å; F47-V51 HydrophobicContact CZ-CG2 3.57Å; F47-V51 WeakPolarHBondContact O-CG2 3.32Å; F47-V51 PolarHBondContact O-N 3.21Å; Q48-V51 PolarHBondContact O-N 2.91Å; V51-L54 PolarHBondContact O-N 3.36Å; V51-I55 HydrophobicContact CG1-CD1 3.94Å; V51-I55 HydrophobicContact CG1-CG1 4.44Å; V51-I55 VanDerWaalsContact O-CG1 3.31Å; V51-I55 WeakPolarHBondContact O-CG1 3.44Å; V51-I55 PolarHBondContact O-N 3.34Å
52	G	97.8	Very high	97.6	Very high	29 Å²	29	95 Å²	95	30%	0.299	50%	0.499	S	S	.	.	H	α-helix	trans	-57.3	-50.3	173.9	0	0	0	0	0	112.1	Q48 K49 I50 L54 I55 E56	Q48-G52 PolarHBondContact O-N 3.47Å; K49-G52 PolarHBondContact O-N 3.46Å; I50-G52 VanDerWaalsContact C-N 3.33Å; I50-G52 PolarHBondContact O-N 3.23Å; G52-L54 VanDerWaalsContact C-N 3.32Å; G52-L54 PolarHBondContact O-N 2.91Å; G52-I55 PolarHBondContact O-N 3.4Å; G52-E56 PolarHBondContact O-N 3.34Å; G52-E56 VanDerWaalsContact O-N 3.1Å
53	G	97.6	Very high	97.6	Very high	27 Å²	27	96.9 Å²	96.9	28%	0.278	50%	0.502	S	S	.	.	H	α-helix	trans	-63.3	-35.7	176.4	0	0	0	0	0	113.4	K49 I50 E56 L57	K49-G53 PolarHBondContact O-N 2.91Å; I50-G53 PolarHBondContact O-N 2.96Å; G53-E56 PolarHBondContact O-N 3.32Å; G53-L57 WeakPolarHBondContact O-CG 3.44Å; G53-L57 PolarHBondContact O-N 2.94Å
54	L	97.3	Very high	97.6	Very high	104 Å²	104	96.9 Å²	96.9	55%	0.545	50%	0.504	S	S	.	.	H	α-helix	trans	-64.9	-42.2	175	179.3	62.9	0	0	0	111.9	I50 V51 G52 E56 L57 V58	I50-L54 WeakPolarHBondContact O-CB 3.48Å; I50-L54 PolarHBondContact O-N 3.5Å; V51-L54 PolarHBondContact O-N 3.36Å; G52-L54 VanDerWaalsContact C-N 3.32Å; G52-L54 PolarHBondContact O-N 2.91Å; L54-E56 VanDerWaalsContact C-N 3.33Å; L54-L57 PolarHBondContact O-N 2.96Å; L54-V58 HydrophobicContact CD1-CG2 4.2Å; L54-V58 HydrophobicContact CG-CG2 4.45Å; L54-V58 WeakPolarHBondContact O-CB 3.44Å; L54-V58 VanDerWaalsContact O-CG2 3.27Å; L54-V58 WeakPolarHBondContact O-CG2 3.38Å; L54-V58 PolarHBondContact O-N 2.92Å
55	I	97.6	Very high	97.7	Very high	96 Å²	96	96.5 Å²	96.5	49%	0.492	51%	0.511	S	S	.	.	H	α-helix	trans	-60.4	-46.1	176.9	-69.8	165.5	0	0	0	109.9	V51 G52 L57 V58 D59	V51-I55 HydrophobicContact CG1-CD1 3.94Å; V51-I55 HydrophobicContact CG1-CG1 4.44Å; V51-I55 VanDerWaalsContact O-CG1 3.31Å; V51-I55 WeakPolarHBondContact O-CG1 3.44Å; V51-I55 PolarHBondContact O-N 3.34Å; G52-I55 PolarHBondContact O-N 3.4Å; I55-L57 PolarHBondContact O-N 2.97Å; I55-V58 PolarHBondContact O-N 3.34Å; I55-D59 PolarHBondContact O-N 3.31Å
56	E	97.9	Very high	97.7	Very high	133 Å²	133	99.8 Å²	99.8	62%	0.621	52%	0.519	S	S	*	.	H	α-helix	trans	-59.4	-46.8	177.7	-70.5	174.9	179.2	0	0	112.1	G52 G53 L54 V58 D59 E60	G52-E56 PolarHBondContact O-N 3.34Å; G52-E56 VanDerWaalsContact O-N 3.1Å; G53-E56 PolarHBondContact O-N 3.32Å; L54-E56 VanDerWaalsContact C-N 3.33Å; E56-V58 VanDerWaalsContact C-N 3.34Å; E56-V58 PolarHBondContact O-N 2.86Å; E56-D59 PolarHBondContact O-N 2.86Å; E56-E60 WeakPolarHBondContact O-CG 3.44Å; E56-E60 PolarHBondContact O-N 2.97Å
57	L	97.8	Very high	97.7	Very high	111 Å²	111	97.6 Å²	97.6	58%	0.581	51%	0.514	S	S	*	.	H	α-helix	trans	-61.9	-40.5	177.5	-73.2	170.8	0	0	0	112.5	G53 L54 I55 E60 L61	G53-L57 WeakPolarHBondContact O-CG 3.44Å; G53-L57 PolarHBondContact O-N 2.94Å; L54-L57 PolarHBondContact O-N 2.96Å; I55-L57 PolarHBondContact O-N 2.97Å; L57-E60 PolarHBondContact O-N 3.46Å; L57-L61 WeakPolarHBondContact O-CB 3.42Å; L57-L61 PolarHBondContact O-N 3.49Å
58	V	97.8	Very high	97.7	Very high	83 Å²	83	96.5 Å²	96.5	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-66.2	-40.5	177.4	169.9	0	0	0	0	110.8	L54 I55 E56 L61 A62	L54-V58 HydrophobicContact CD1-CG2 4.2Å; L54-V58 HydrophobicContact CG-CG2 4.45Å; L54-V58 WeakPolarHBondContact O-CB 3.44Å; L54-V58 VanDerWaalsContact O-CG2 3.27Å; L54-V58 WeakPolarHBondContact O-CG2 3.38Å; L54-V58 PolarHBondContact O-N 2.92Å; I55-V58 PolarHBondContact O-N 3.34Å; E56-V58 VanDerWaalsContact C-N 3.34Å; E56-V58 PolarHBondContact O-N 2.86Å; V58-L61 PolarHBondContact O-N 2.96Å; V58-A62 WeakPolarHBondContact O-CB 3.36Å; V58-A62 PolarHBondContact O-N 3.01Å
59	D	98.1	Very high	97.7	Very high	89 Å²	89	95.4 Å²	95.4	48%	0.476	50%	0.504	S	S	.	.	H	α-helix	trans	-65.4	-40.5	176.8	-84.4	-9.8	0	0	0	112.3	I55 E56 A62 K63	I55-D59 PolarHBondContact O-N 3.31Å; E56-D59 PolarHBondContact O-N 2.86Å; D59-A62 PolarHBondContact O-N 2.97Å; D59-K63 WeakPolarHBondContact O-CG 3.45Å; D59-K63 PolarHBondContact O-N 3.34Å; D59-K63 VanDerWaalsContact O-N 3.12Å
60	E	97.9	Very high	97.7	Very high	115 Å²	115	93.4 Å²	93.4	54%	0.537	50%	0.499	S	S	.	.	H	α-helix	trans	-62.9	-48.4	173.7	-74.5	-175.6	167.9	0	0	111.4	E56 L57 A62 K63 E64	E56-E60 WeakPolarHBondContact O-CG 3.44Å; E56-E60 PolarHBondContact O-N 2.97Å; L57-E60 PolarHBondContact O-N 3.46Å; E60-A62 VanDerWaalsContact C-N 3.28Å; E60-A62 PolarHBondContact O-N 3.43Å; E60-K63 WeakPolarHBondContact O-CB 3.28Å; E60-K63 PolarHBondContact O-N 2.7Å; E60-K63 VanDerWaalsContact O-N 3.11Å; E60-E64 PolarHBondContact O-N 2.88Å
61	L	97.7	Very high	97.7	Very high	114 Å²	114	93.5 Å²	93.5	60%	0.597	50%	0.495	S	S	*	.	H	α-helix	trans	-59.7	-39.7	178	-176.9	62.2	0	0	0	111.9	L57 V58 E64 A65	L57-L61 WeakPolarHBondContact O-CB 3.42Å; L57-L61 PolarHBondContact O-N 3.49Å; V58-L61 PolarHBondContact O-N 2.96Å; L61-E64 PolarHBondContact O-N 3.46Å; L61-A65 WeakPolarHBondContact O-CB 3.42Å; L61-A65 PolarHBondContact O-N 3.36Å
62	A	97.9	Very high	97.7	Very high	54 Å²	54	94 Å²	94	45%	0.446	50%	0.504	S	S	.	.	H	α-helix	trans	-63	-41.7	176.2	0	0	0	0	0	112.1	V58 D59 E60 A65 E66	V58-A62 WeakPolarHBondContact O-CB 3.36Å; V58-A62 PolarHBondContact O-N 3.01Å; D59-A62 PolarHBondContact O-N 2.97Å; E60-A62 VanDerWaalsContact C-N 3.28Å; E60-A62 PolarHBondContact O-N 3.43Å; A62-A65 PolarHBondContact O-N 3.21Å; A62-E66 PolarHBondContact O-N 3.41Å
63	K	97.8	Very high	97.6	Very high	142 Å²	142	95.8 Å²	95.8	62%	0.617	51%	0.506	S	S	*	.	H	α-helix	trans	-65.4	-42.2	176.5	-71.9	170.1	-172.6	167.1	0	112.1	D59 E60 T67	D59-K63 WeakPolarHBondContact O-CG 3.45Å; D59-K63 PolarHBondContact O-N 3.34Å; D59-K63 VanDerWaalsContact O-N 3.12Å; E60-K63 WeakPolarHBondContact O-CB 3.28Å; E60-K63 PolarHBondContact O-N 2.7Å; E60-K63 VanDerWaalsContact O-N 3.11Å; K63-T67 WeakPolarHBondContact O-CB 3.47Å; K63-T67 PolarHBondContact O-N 3.02Å; K63-T67 PolarHBondContact O-OG1 3.34Å
64	E	97.8	Very high	97.6	Very high	130 Å²	130	96.3 Å²	96.3	61%	0.607	51%	0.512	S	S	*	.	H	α-helix	trans	-63.8	-44.8	176.4	-72.3	-172	176	0	0	111.4	E60 L61 E66 T67 E68	E60-E64 PolarHBondContact O-N 2.88Å; L61-E64 PolarHBondContact O-N 3.46Å; E64-E66 PolarHBondContact O-N 3.47Å; E64-T67 WeakPolarHBondContact O-CB 3.3Å; E64-T67 PolarHBondContact O-N 3.49Å; E64-T67 VanDerWaalsContact O-N 3.15Å; E64-E68 PolarHBondContact O-N 3.42Å
65	A	97.9	Very high	97.5	Very high	58 Å²	58	94 Å²	94	48%	0.479	51%	0.507	S	S	.	.	H	α-helix	trans	-59.9	-44.5	177.7	0	0	0	0	0	112.3	L61 A62 T67 E68 K69	L61-A65 WeakPolarHBondContact O-CB 3.42Å; L61-A65 PolarHBondContact O-N 3.36Å; A62-A65 PolarHBondContact O-N 3.21Å; A65-T67 VanDerWaalsContact C-N 3.34Å; A65-E68 PolarHBondContact O-N 2.95Å; A65-K69 VanDerWaalsContact O-CB 3.25Å; A65-K69 WeakPolarHBondContact O-CB 3.48Å; A65-K69 PolarHBondContact O-N 2.94Å
66	E	97.1	Very high	97.4	Very high	94 Å²	94	98 Å²	98	44%	0.439	52%	0.516	S	S	.	.	H	α-helix	trans	-66.3	-36.3	175.4	-80.2	-59.9	154.9	0	0	112.5	A62 E64 K69 M70	A62-E66 PolarHBondContact O-N 3.41Å; E64-E66 PolarHBondContact O-N 3.47Å; E66-K69 PolarHBondContact O-N 3.37Å; E66-K69 IonicContact OE1-NZ 3.27Å; E66-K69 PolarHBondContact OE1-NZ 3.33Å; E66-K69 WeakPolarHBondContact OE2-CD 3.25Å; E66-K69 IonicContact OE2-NZ 2.81Å; E66-K69 PolarHBondContact OE2-NZ 2.97Å; E66-M70 WeakPolarHBondContact O-CB 3.48Å; E66-M70 VanDerWaalsContact O-CG 3.3Å; E66-M70 WeakPolarHBondContact O-CG 3.35Å; E66-M70 PolarHBondContact O-N 2.86Å
67	T	97.7	Very high	97.4	Very high	75 Å²	75	95.8 Å²	95.8	46%	0.46	51%	0.509	S	S	.	.	H	α-helix	trans	-61.7	-49.2	175.9	-61.5	0	0	0	0	111.2	K63 E64 A65 M70 K71	K63-T67 WeakPolarHBondContact O-CB 3.47Å; K63-T67 PolarHBondContact O-N 3.02Å; K63-T67 PolarHBondContact O-OG1 3.34Å; E64-T67 WeakPolarHBondContact O-CB 3.3Å; E64-T67 PolarHBondContact O-N 3.49Å; E64-T67 VanDerWaalsContact O-N 3.15Å; A65-T67 VanDerWaalsContact C-N 3.34Å; T67-M70 PolarHBondContact O-N 3.13Å; T67-K71 WeakPolarHBondContact O-CG 3.48Å; T67-K71 PolarHBondContact O-N 3.28Å
68	E	97.6	Very high	97.2	Very high	107 Å²	107	96 Å²	96	50%	0.5	51%	0.51	S	S	.	.	H	α-helix	trans	-66.8	-38.8	178.1	-73.4	-53.8	131.8	0	0	112.3	E64 A65 M70 K71 A72	E64-E68 PolarHBondContact O-N 3.42Å; A65-E68 PolarHBondContact O-N 2.95Å; E68-M70 VanDerWaalsContact C-N 3.32Å; E68-M70 PolarHBondContact O-N 3.48Å; E68-K71 PolarHBondContact O-N 3.34Å; E68-K71 WeakPolarHBondContact OE1-CD 3.46Å; E68-K71 IonicContact OE1-NZ 3.84Å; E68-K71 PolarHBondContact OE1-NZ 3.48Å; E68-A72 WeakPolarHBondContact O-CB 3.32Å; E68-A72 PolarHBondContact O-N 3.22Å
69	K	98.1	Very high	97.1	Very high	107 Å²	107	98 Å²	98	47%	0.465	52%	0.517	S	S	.	.	H	α-helix	trans	-57.3	-45.3	172.9	174.1	176.5	152.9	-146.5	0	111.6	A65 E66 A72 I73	A65-K69 VanDerWaalsContact O-CB 3.25Å; A65-K69 WeakPolarHBondContact O-CB 3.48Å; A65-K69 PolarHBondContact O-N 2.94Å; E66-K69 PolarHBondContact O-N 3.37Å; E66-K69 IonicContact OE1-NZ 3.27Å; E66-K69 PolarHBondContact OE1-NZ 3.33Å; E66-K69 WeakPolarHBondContact OE2-CD 3.25Å; E66-K69 IonicContact OE2-NZ 2.81Å; E66-K69 PolarHBondContact OE2-NZ 2.97Å; K69-A72 PolarHBondContact O-N 3.44Å; K69-I73 HydrophobicContact CG-CD1 3.99Å; K69-I73 VanDerWaalsContact O-CG1 3.28Å; K69-I73 WeakPolarHBondContact O-CG1 3.37Å; K69-I73 PolarHBondContact O-N 3.42Å
70	M	97.1	Very high	97	Very high	123 Å²	123	101.5 Å²	101.5	61%	0.606	53%	0.528	S	S	*	.	H	α-helix	trans	-65.3	-41.3	177.9	-72.2	-64.2	-83.8	0	0	112.2	E66 T67 E68 A72 I73 G74	E66-M70 WeakPolarHBondContact O-CB 3.48Å; E66-M70 VanDerWaalsContact O-CG 3.3Å; E66-M70 WeakPolarHBondContact O-CG 3.35Å; E66-M70 PolarHBondContact O-N 2.86Å; T67-M70 PolarHBondContact O-N 3.13Å; E68-M70 VanDerWaalsContact C-N 3.32Å; E68-M70 PolarHBondContact O-N 3.48Å; M70-A72 PolarHBondContact O-N 3.15Å; M70-I73 PolarHBondContact O-N 2.92Å; M70-I73 HydrophobicContact SD-CD1 4.48Å; M70-G74 PolarHBondContact O-N 3.24Å
71	K	97.4	Very high	96.8	Very high	122 Å²	122	98.9 Å²	98.9	53%	0.53	52%	0.523	S	S	.	.	H	α-helix	trans	-59.8	-45.6	173.4	-70.9	175.6	-172	167.9	0	111.8	T67 E68 I73 G74 A75	T67-K71 WeakPolarHBondContact O-CG 3.48Å; T67-K71 PolarHBondContact O-N 3.28Å; E68-K71 PolarHBondContact O-N 3.34Å; E68-K71 WeakPolarHBondContact OE1-CD 3.46Å; E68-K71 IonicContact OE1-NZ 3.84Å; E68-K71 PolarHBondContact OE1-NZ 3.48Å; K71-I73 PolarHBondContact O-N 2.99Å; K71-G74 PolarHBondContact O-N 2.93Å; K71-A75 PolarHBondContact O-N 3.4Å
72	A	97.4	Very high	96.7	Very high	61 Å²	61	97.1 Å²	97.1	50%	0.504	52%	0.516	S	S	.	.	H	α-helix	trans	-62.7	-42.9	179	0	0	0	0	0	112.2	E68 K69 M70 G74 A75 R76	E68-A72 WeakPolarHBondContact O-CB 3.32Å; E68-A72 PolarHBondContact O-N 3.22Å; K69-A72 PolarHBondContact O-N 3.44Å; M70-A72 PolarHBondContact O-N 3.15Å; A72-G74 VanDerWaalsContact C-N 3.35Å; A72-A75 PolarHBondContact O-N 2.88Å; A72-R76 WeakPolarHBondContact O-CB 3.33Å; A72-R76 PolarHBondContact O-N 3.35Å
73	I	96.7	Very high	96.5	Very high	67 Å²	67	97.3 Å²	97.3	34%	0.344	52%	0.518	S	S	.	.	H	α-helix	trans	-61	-45.1	173.8	-68.7	166.6	0	0	0	110.5	K69 M70 K71 R76 N77	K69-I73 HydrophobicContact CG-CD1 3.99Å; K69-I73 VanDerWaalsContact O-CG1 3.28Å; K69-I73 WeakPolarHBondContact O-CG1 3.37Å; K69-I73 PolarHBondContact O-N 3.42Å; M70-I73 PolarHBondContact O-N 2.92Å; M70-I73 HydrophobicContact SD-CD1 4.48Å; K71-I73 PolarHBondContact O-N 2.99Å; I73-R76 PolarHBondContact O-N 3.5Å; I73-N77 WeakPolarHBondContact O-CB 3.49Å; I73-N77 VanDerWaalsContact O-CG 3.27Å; I73-N77 PolarHBondContact O-N 2.84Å
74	G	96.6	Very high	96.4	Very high	38 Å²	38	98 Å²	98	39%	0.392	52%	0.521	S	S	.	.	H	α-helix	trans	-58.5	-50.8	177.1	0	0	0	0	0	112.5	M70 K71 A72 R76 N77 L78	M70-G74 PolarHBondContact O-N 3.24Å; K71-G74 PolarHBondContact O-N 2.93Å; A72-G74 VanDerWaalsContact C-N 3.35Å; G74-R76 VanDerWaalsContact C-N 3.34Å; G74-R76 PolarHBondContact O-N 2.94Å; G74-N77 PolarHBondContact O-N 3.01Å; G74-L78 PolarHBondContact O-N 3.04Å
75	A	95.9	Very high	96.3	Very high	55 Å²	55	97.2 Å²	97.2	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-60.1	-42.4	177.2	0	0	0	0	0	112.1	K71 A72 N77 L78 L79	K71-A75 PolarHBondContact O-N 3.4Å; A72-A75 PolarHBondContact O-N 2.88Å; A75-N77 PolarHBondContact O-N 2.97Å; A75-L78 PolarHBondContact O-N 3.4Å; A75-L79 PolarHBondContact O-N 2.93Å
76	R	96.2	Very high	96.2	Very high	180 Å²	180	103.1 Å²	103.1	68%	0.679	53%	0.527	S	S	*	.	H	α-helix	trans	-62.5	-42.5	176.6	-168	-178.9	80	166.3	2.7	112.1	A72 I73 G74 L79 K80	A72-R76 WeakPolarHBondContact O-CB 3.33Å; A72-R76 PolarHBondContact O-N 3.35Å; I73-R76 PolarHBondContact O-N 3.5Å; G74-R76 VanDerWaalsContact C-N 3.34Å; G74-R76 PolarHBondContact O-N 2.94Å; R76-L79 PolarHBondContact O-N 2.93Å; R76-K80 PolarHBondContact O-N 3.24Å
77	N	96.1	Very high	96.2	Very high	86 Å²	86	104.1 Å²	104.1	46%	0.46	53%	0.532	S	S	.	.	H	α-helix	trans	-65.7	-40.2	178.5	-73.2	-14.1	0	0	0	111.6	I73 G74 A75 K80 S81	I73-N77 WeakPolarHBondContact O-CB 3.49Å; I73-N77 VanDerWaalsContact O-CG 3.27Å; I73-N77 PolarHBondContact O-N 2.84Å; G74-N77 PolarHBondContact O-N 3.01Å; A75-N77 PolarHBondContact O-N 2.97Å; N77-K80 PolarHBondContact O-N 3.42Å; N77-S81 PolarHBondContact O-N 3.42Å
78	L	95	Very high	96.2	Very high	116 Å²	116	102.8 Å²	102.8	61%	0.607	53%	0.528	S	S	*	.	H	α-helix	trans	-62.6	-45.9	174.7	-175.7	65.5	0	0	0	111.6	G74 A75 K80 S81 V82	G74-L78 PolarHBondContact O-N 3.04Å; A75-L78 PolarHBondContact O-N 3.4Å; L78-K80 VanDerWaalsContact C-N 3.29Å; L78-K80 PolarHBondContact O-N 2.93Å; L78-S81 PolarHBondContact O-N 2.98Å; L78-S81 PolarHBondContact O-OG 3.32Å; L78-V82 HydrophobicContact CD1-CG2 4.46Å; L78-V82 HydrophobicContact CG-CG2 4.5Å; L78-V82 VanDerWaalsContact O-CG2 3.29Å; L78-V82 WeakPolarHBondContact O-CG2 3.39Å; L78-V82 PolarHBondContact O-N 3.47Å
79	L	95.4	Very high	96.1	Very high	126 Å²	126	102.3 Å²	102.3	66%	0.66	53%	0.526	S	S	*	.	H	α-helix	trans	-59.2	-42.2	176	-78.8	167.3	0	0	0	111.9	A75 R76 V82 A83	A75-L79 PolarHBondContact O-N 2.93Å; R76-L79 PolarHBondContact O-N 2.93Å; L79-V82 PolarHBondContact O-N 2.94Å; L79-A83 WeakPolarHBondContact O-CB 3.27Å; L79-A83 PolarHBondContact O-N 3.11Å
80	K	95.3	Very high	96.1	Very high	161 Å²	161	102.4 Å²	102.4	70%	0.7	53%	0.528	S	S	*	.	H	α-helix	trans	-64.6	-40.4	177.2	-168.9	178.1	-178.3	-179.6	0	112.1	R76 N77 L78 K84	R76-K80 PolarHBondContact O-N 3.24Å; N77-K80 PolarHBondContact O-N 3.42Å; L78-K80 VanDerWaalsContact C-N 3.29Å; L78-K80 PolarHBondContact O-N 2.93Å; K80-K84 PolarHBondContact O-N 2.89Å; K80-K84 VanDerWaalsContact O-N 3.13Å
81	S	94.9	Very high	96.1	Very high	61 Å²	61	101.9 Å²	101.9	43%	0.427	52%	0.524	S	S	.	.	H	α-helix	trans	-68.4	-41.7	177.9	68.1	0	0	0	0	111.7	N77 L78 A83 K84 Q85	N77-S81 PolarHBondContact O-N 3.42Å; L78-S81 PolarHBondContact O-N 2.98Å; L78-S81 PolarHBondContact O-OG 3.32Å; S81-A83 PolarHBondContact O-N 3.12Å; S81-K84 PolarHBondContact O-N 3.26Å; S81-Q85 WeakPolarHBondContact O-CB 3.47Å; S81-Q85 PolarHBondContact O-N 3.4Å
82	V	95.6	Very high	96.2	Very high	76 Å²	76	102.8 Å²	102.8	46%	0.461	53%	0.53	S	S	.	.	H	α-helix	trans	-61.5	-43.9	175.5	170.9	0	0	0	0	111.2	L78 L79 K84 Q85 R86	L78-V82 HydrophobicContact CD1-CG2 4.46Å; L78-V82 HydrophobicContact CG-CG2 4.5Å; L78-V82 VanDerWaalsContact O-CG2 3.29Å; L78-V82 WeakPolarHBondContact O-CG2 3.39Å; L78-V82 PolarHBondContact O-N 3.47Å; L79-V82 PolarHBondContact O-N 2.94Å; V82-K84 PolarHBondContact O-N 2.96Å; V82-Q85 PolarHBondContact O-N 2.9Å; V82-R86 VanDerWaalsContact O-CB 3.32Å; V82-R86 WeakPolarHBondContact O-CB 3.4Å; V82-R86 PolarHBondContact O-N 3.43Å
83	A	93.9	Very high	96.2	Very high	58 Å²	58	104.9 Å²	104.9	48%	0.479	53%	0.532	S	S	.	.	H	α-helix	trans	-59.5	-46	176.2	0	0	0	0	0	111.8	L79 S81 R86 E87	L79-A83 WeakPolarHBondContact O-CB 3.27Å; L79-A83 PolarHBondContact O-N 3.11Å; S81-A83 PolarHBondContact O-N 3.12Å; A83-R86 PolarHBondContact O-N 3.03Å; A83-E87 PolarHBondContact O-N 3.06Å
84	K	95.5	Very high	96.3	Very high	157 Å²	157	107 Å²	107	68%	0.683	54%	0.541	S	S	*	.	H	α-helix	trans	-63.7	-42.1	177	-173.2	178.6	-179.9	-178.3	0	112.2	K80 S81 V82 R86 E87 A88	K80-K84 PolarHBondContact O-N 2.89Å; K80-K84 VanDerWaalsContact O-N 3.13Å; S81-K84 PolarHBondContact O-N 3.26Å; V82-K84 PolarHBondContact O-N 2.96Å; K84-R86 VanDerWaalsContact C-N 3.35Å; K84-E87 PolarHBondContact O-N 2.96Å; K84-A88 WeakPolarHBondContact O-CB 3.41Å; K84-A88 PolarHBondContact O-N 3.27Å
85	Q	95.4	Very high	96.3	Very high	113 Å²	113	108.1 Å²	108.1	53%	0.528	55%	0.546	S	S	.	.	H	α-helix	trans	-63.8	-42.6	177	-175.7	177.8	5.9	0	0	111.2	S81 V82 A88 Q89	S81-Q85 WeakPolarHBondContact O-CB 3.47Å; S81-Q85 PolarHBondContact O-N 3.4Å; V82-Q85 PolarHBondContact O-N 2.9Å; Q85-A88 PolarHBondContact O-N 3.48Å; Q85-Q89 WeakPolarHBondContact O-CB 3.39Å; Q85-Q89 WeakPolarHBondContact O-CG 3.31Å; Q85-Q89 PolarHBondContact O-N 3.38Å
86	R	96.1	Very high	96.5	Very high	183 Å²	183	109.6 Å²	109.6	69%	0.691	55%	0.546	S	S	*	.	H	α-helix	trans	-62.2	-44.1	177.1	-173.7	-179.3	-179.5	-168.3	0.6	111.7	V82 A83 K84 Q89 Q90	V82-R86 VanDerWaalsContact O-CB 3.32Å; V82-R86 WeakPolarHBondContact O-CB 3.4Å; V82-R86 PolarHBondContact O-N 3.43Å; A83-R86 PolarHBondContact O-N 3.03Å; K84-R86 VanDerWaalsContact C-N 3.35Å; R86-Q89 PolarHBondContact O-N 3.47Å; R86-Q90 WeakPolarHBondContact O-CB 3.29Å; R86-Q90 PolarHBondContact O-N 3.32Å
87	E	96.6	Very high	96.6	Very high	115 Å²	115	105.5 Å²	105.5	54%	0.537	54%	0.537	S	S	.	.	H	α-helix	trans	-61.6	-46.3	176.2	-172.7	-178.2	179.1	0	0	111.5	A83 K84 Q89 Q90 Q91	A83-E87 PolarHBondContact O-N 3.06Å; K84-E87 PolarHBondContact O-N 2.96Å; E87-Q89 PolarHBondContact O-N 2.93Å; E87-Q90 WeakPolarHBondContact O-CB 3.47Å; E87-Q90 PolarHBondContact O-N 3.47Å; E87-Q91 WeakPolarHBondContact O-CG 3.48Å; E87-Q91 PolarHBondContact O-N 3.43Å
88	A	96.6	Very high	96.7	Very high	46 Å²	46	104.2 Å²	104.2	38%	0.38	54%	0.538	S	S	.	.	H	α-helix	trans	-61.2	-43.9	176.7	0	0	0	0	0	112.2	K84 Q85 Q90 Q91 Q92	K84-A88 WeakPolarHBondContact O-CB 3.41Å; K84-A88 PolarHBondContact O-N 3.27Å; Q85-A88 PolarHBondContact O-N 3.48Å; A88-Q90 VanDerWaalsContact C-N 3.33Å; A88-Q90 PolarHBondContact O-N 2.98Å; A88-Q91 PolarHBondContact O-N 3.1Å; A88-Q92 WeakPolarHBondContact O-CG 3.4Å; A88-Q92 PolarHBondContact O-N 3.25Å
89	Q	97.3	Very high	96.8	Very high	98 Å²	98	103.1 Å²	103.1	46%	0.458	53%	0.53	S	S	.	.	H	α-helix	trans	-61.7	-41.1	175.1	-77.1	178.2	-17.6	0	0	111.8	Q85 R86 E87 Q92 L93	Q85-Q89 WeakPolarHBondContact O-CB 3.39Å; Q85-Q89 WeakPolarHBondContact O-CG 3.31Å; Q85-Q89 PolarHBondContact O-N 3.38Å; R86-Q89 PolarHBondContact O-N 3.47Å; E87-Q89 PolarHBondContact O-N 2.93Å; Q89-Q92 PolarHBondContact O-N 2.93Å; Q89-L93 WeakPolarHBondContact O-CB 3.45Å; Q89-L93 WeakPolarHBondContact O-CG 3.35Å; Q89-L93 PolarHBondContact O-N 3.45Å
90	Q	97.6	Very high	97	Very high	108 Å²	108	102.4 Å²	102.4	51%	0.505	52%	0.521	S	S	.	.	H	α-helix	trans	-62.7	-44.4	177.1	-176.8	176.5	-12.6	0	0	111.5	R86 E87 A88 L93 Q94	R86-Q90 WeakPolarHBondContact O-CB 3.29Å; R86-Q90 PolarHBondContact O-N 3.32Å; E87-Q90 WeakPolarHBondContact O-CB 3.47Å; E87-Q90 PolarHBondContact O-N 3.47Å; A88-Q90 VanDerWaalsContact C-N 3.33Å; A88-Q90 PolarHBondContact O-N 2.98Å; Q90-L93 PolarHBondContact O-N 3.2Å; Q90-Q94 WeakPolarHBondContact O-CG 3.27Å; Q90-Q94 PolarHBondContact O-N 3.34Å
91	Q	97.7	Very high	97.1	Very high	112 Å²	112	101.6 Å²	101.6	52%	0.523	52%	0.518	S	S	.	.	H	α-helix	trans	-62.4	-43	175.8	-70.7	177.1	3.2	0	0	111.8	E87 A88 L93 Q94 A95	E87-Q91 WeakPolarHBondContact O-CG 3.48Å; E87-Q91 PolarHBondContact O-N 3.43Å; A88-Q91 PolarHBondContact O-N 3.1Å; Q91-L93 PolarHBondContact O-N 3.02Å; Q91-Q94 PolarHBondContact O-N 3.45Å; Q91-A95 PolarHBondContact O-N 3.23Å
92	Q	97.8	Very high	97.3	Very high	141 Å²	141	105.2 Å²	105.2	66%	0.659	53%	0.53	S	S	*	.	H	α-helix	trans	-60.7	-45	175.4	-75.7	179.8	-24.7	0	0	112.2	A88 Q89 A95 L96	A88-Q92 WeakPolarHBondContact O-CG 3.4Å; A88-Q92 PolarHBondContact O-N 3.25Å; Q89-Q92 PolarHBondContact O-N 2.93Å; Q92-A95 PolarHBondContact O-N 2.72Å; Q92-L96 PolarHBondContact O-N 2.95Å
93	L	98.1	Very high	97.4	Very high	105 Å²	105	103.8 Å²	103.8	55%	0.55	52%	0.518	S	S	.	.	H	α-helix	trans	-64.1	-40.4	177	-72.9	171.7	0	0	0	111.9	Q89 Q90 Q91 L96 I97	Q89-L93 WeakPolarHBondContact O-CB 3.45Å; Q89-L93 WeakPolarHBondContact O-CG 3.35Å; Q89-L93 PolarHBondContact O-N 3.45Å; Q90-L93 PolarHBondContact O-N 3.2Å; Q91-L93 PolarHBondContact O-N 3.02Å; L93-L96 PolarHBondContact O-N 2.92Å; L93-I97 WeakPolarHBondContact O-CB 3.33Å; L93-I97 VanDerWaalsContact O-CG1 3.24Å; L93-I97 WeakPolarHBondContact O-CG1 3.04Å; L93-I97 PolarHBondContact O-N 3.18Å
94	Q	98.2	Very high	97.6	Very high	111 Å²	111	106.7 Å²	106.7	52%	0.519	53%	0.525	S	S	.	.	H	α-helix	trans	-62.8	-42.3	175.7	-76.1	177.7	-11	0	0	112.1	Q90 Q91 I97 A98	Q90-Q94 WeakPolarHBondContact O-CG 3.27Å; Q90-Q94 PolarHBondContact O-N 3.34Å; Q91-Q94 PolarHBondContact O-N 3.45Å; Q94-I97 PolarHBondContact O-N 3.38Å; Q94-A98 PolarHBondContact O-N 2.87Å
95	A	98.1	Very high	97.7	Very high	62 Å²	62	103.9 Å²	103.9	51%	0.512	51%	0.514	S	S	.	.	H	α-helix	trans	-61.5	-44.7	175	0	0	0	0	0	111.5	Q91 Q92 I97 A98 E99	Q91-A95 PolarHBondContact O-N 3.23Å; Q92-A95 PolarHBondContact O-N 2.72Å; A95-I97 PolarHBondContact O-N 3.18Å; A95-A98 PolarHBondContact O-N 2.94Å; A95-E99 PolarHBondContact O-N 3Å
96	L	98.4	Very high	97.9	Very high	86 Å²	86	105 Å²	105	45%	0.45	51%	0.514	S	S	.	.	H	α-helix	trans	-63.1	-41.7	177.1	-174.7	66.7	0	0	0	112	Q92 L93 A98 E99 K100	Q92-L96 PolarHBondContact O-N 2.95Å; L93-L96 PolarHBondContact O-N 2.92Å; L96-A98 VanDerWaalsContact C-N 3.33Å; L96-A98 PolarHBondContact O-N 3.49Å; L96-E99 PolarHBondContact O-N 3.48Å; L96-K100 WeakPolarHBondContact O-CB 3.45Å; L96-K100 VanDerWaalsContact O-CG 3.29Å; L96-K100 WeakPolarHBondContact O-CG 3.3Å; L96-K100 PolarHBondContact O-N 3.33Å
97	I	98.3	Very high	98	Very high	95 Å²	95	102.2 Å²	102.2	49%	0.487	50%	0.504	S	S	.	.	H	α-helix	trans	-61.1	-44.1	175.2	-71.4	165.1	0	0	0	110.4	L93 Q94 A95 K100 K101	L93-I97 WeakPolarHBondContact O-CB 3.33Å; L93-I97 VanDerWaalsContact O-CG1 3.24Å; L93-I97 WeakPolarHBondContact O-CG1 3.04Å; L93-I97 PolarHBondContact O-N 3.18Å; Q94-I97 PolarHBondContact O-N 3.38Å; A95-I97 PolarHBondContact O-N 3.18Å; I97-K100 PolarHBondContact O-N 3.4Å; I97-K101 HydrophobicContact CG2-CD 4.23Å; I97-K101 HydrophobicContact CG2-CG 4.5Å; I97-K101 WeakPolarHBondContact O-CB 3.48Å; I97-K101 WeakPolarHBondContact O-CG 3.49Å; I97-K101 PolarHBondContact O-N 2.94Å
98	A	98.3	Very high	98	Very high	59 Å²	59	103.6 Å²	103.6	49%	0.488	50%	0.504	S	S	.	.	H	α-helix	trans	-62.3	-44.9	178	0	0	0	0	0	111.7	Q94 A95 L96 K100 K101 M102	Q94-A98 PolarHBondContact O-N 2.87Å; A95-A98 PolarHBondContact O-N 2.94Å; L96-A98 VanDerWaalsContact C-N 3.33Å; L96-A98 PolarHBondContact O-N 3.49Å; A98-K100 PolarHBondContact O-N 3.47Å; A98-K101 PolarHBondContact O-N 3.34Å; A98-M102 PolarHBondContact O-N 3.32Å
99	E	98.3	Very high	98.1	Very high	92 Å²	92	106.3 Å²	106.3	43%	0.43	51%	0.511	S	S	.	.	H	α-helix	trans	-59	-47.4	175.7	-169.8	-163.2	147.7	0	0	111.6	A95 L96 K101 M102 Q103	A95-E99 PolarHBondContact O-N 3Å; L96-E99 PolarHBondContact O-N 3.48Å; E99-K101 PolarHBondContact O-N 3.21Å; E99-M102 PolarHBondContact O-N 3.23Å; E99-Q103 WeakPolarHBondContact O-CG 3.38Å; E99-Q103 PolarHBondContact O-N 2.9Å; E99-Q103 PolarHBondContact OE1-NE2 3.38Å
100	K	98.3	Very high	98.1	Very high	111 Å²	111	106.5 Å²	106.5	48%	0.483	51%	0.512	S	S	.	.	H	α-helix	trans	-65.3	-38.1	179.7	-68.8	-70.1	162.8	-157.2	0	112.6	L96 I97 A98 Q103 L104	L96-K100 WeakPolarHBondContact O-CB 3.45Å; L96-K100 VanDerWaalsContact O-CG 3.29Å; L96-K100 WeakPolarHBondContact O-CG 3.3Å; L96-K100 PolarHBondContact O-N 3.33Å; I97-K100 PolarHBondContact O-N 3.4Å; A98-K100 PolarHBondContact O-N 3.47Å; K100-Q103 PolarHBondContact O-N 2.92Å; K100-L104 WeakPolarHBondContact O-CB 3.33Å; K100-L104 PolarHBondContact O-N 3.27Å
101	K	98.3	Very high	98.2	Very high	145 Å²	145	109.1 Å²	109.1	63%	0.63	52%	0.519	S	S	*	.	H	α-helix	trans	-62	-42.8	173.1	-77.8	-178.6	176.4	-174.5	0	111.8	I97 A98 E99 L104 E105	I97-K101 HydrophobicContact CG2-CD 4.23Å; I97-K101 HydrophobicContact CG2-CG 4.5Å; I97-K101 WeakPolarHBondContact O-CB 3.48Å; I97-K101 WeakPolarHBondContact O-CG 3.49Å; I97-K101 PolarHBondContact O-N 2.94Å; A98-K101 PolarHBondContact O-N 3.34Å; E99-K101 PolarHBondContact O-N 3.21Å; K101-L104 PolarHBondContact O-N 3.01Å; K101-E105 PolarHBondContact O-N 3.37Å
102	M	98.1	Very high	98.2	Very high	137 Å²	137	108.8 Å²	108.8	68%	0.675	52%	0.517	S	S	*	.	H	α-helix	trans	-64.3	-42.2	176.9	-169.6	-176.5	77.4	0	0	111.8	A98 E99 L104 E105 R106	A98-M102 PolarHBondContact O-N 3.32Å; E99-M102 PolarHBondContact O-N 3.23Å; M102-L104 VanDerWaalsContact C-N 3.35Å; M102-E105 PolarHBondContact O-N 3.32Å; M102-R106 PolarHBondContact O-N 2.88Å
103	Q	98.2	Very high	98.2	Very high	45 Å²	45	104.7 Å²	104.7	21%	0.21	51%	0.508	C	S	.	.	H	α-helix	trans	-60.9	-44	174.7	-74.8	171.6	0.4	0	0	111.6	E99 K100 R106 Y107	E99-Q103 WeakPolarHBondContact O-CG 3.38Å; E99-Q103 PolarHBondContact O-N 2.9Å; E99-Q103 PolarHBondContact OE1-NE2 3.38Å; K100-Q103 PolarHBondContact O-N 2.92Å; Q103-R106 PolarHBondContact O-N 2.96Å; Q103-Y107 HydrophobicContact CB-CE2 4.36Å; Q103-Y107 WeakPolarHBondContact O-CD2 3.34Å; Q103-Y107 PolarHBondContact O-N 2.89Å
104	L	98.3	Very high	98.2	Very high	119 Å²	119	105 Å²	105	62%	0.623	51%	0.509	S	S	*	.	H	α-helix	trans	-60.9	-46	177.8	-177	67.5	0	0	0	111.8	K100 K101 M102 R106 Y107 R108	K100-L104 WeakPolarHBondContact O-CB 3.33Å; K100-L104 PolarHBondContact O-N 3.27Å; K101-L104 PolarHBondContact O-N 3.01Å; M102-L104 VanDerWaalsContact C-N 3.35Å; L104-R106 VanDerWaalsContact C-N 3.32Å; L104-R106 PolarHBondContact O-N 3.19Å; L104-Y107 PolarHBondContact O-N 3.44Å; L104-R108 PolarHBondContact O-N 3Å
105	E	98.1	Very high	98.2	Very high	98 Å²	98	102 Å²	102	46%	0.458	50%	0.5	S	S	.	.	H	α-helix	trans	-63.2	-40.4	179.3	-166.5	61.6	-161.9	0	0	111.6	K101 M102 Y107 R108 I109	K101-E105 PolarHBondContact O-N 3.37Å; M102-E105 PolarHBondContact O-N 3.32Å; E105-Y107 PolarHBondContact O-N 3.48Å; E105-R108 WeakPolarHBondContact O-CB 3.46Å; E105-R108 PolarHBondContact O-N 3.22Å; E105-I109 HydrophobicContact CG-CD1 4.4Å; E105-I109 WeakPolarHBondContact O-CG1 3.42Å; E105-I109 PolarHBondContact O-N 3.34Å
106	R	98.4	Very high	98.1	Very high	137 Å²	137	105.5 Å²	105.5	52%	0.517	50%	0.504	S	S	.	.	H	α-helix	trans	-58.6	-48.6	173.5	-173.6	-172	69.2	-173.6	-0.7	111.6	M102 Q103 L104 R108 I109 E110	M102-R106 PolarHBondContact O-N 2.88Å; Q103-R106 PolarHBondContact O-N 2.96Å; L104-R106 VanDerWaalsContact C-N 3.32Å; L104-R106 PolarHBondContact O-N 3.19Å; R106-R108 VanDerWaalsContact C-N 3.27Å; R106-R108 PolarHBondContact O-N 2.97Å; R106-I109 PolarHBondContact O-N 2.92Å; R106-E110 WeakPolarHBondContact O-CB 3.32Å; R106-E110 PolarHBondContact O-N 2.93Å
107	Y	98.3	Very high	98.1	Very high	124 Å²	124	104.5 Å²	104.5	49%	0.486	50%	0.501	S	S	.	.	H	α-helix	trans	-64	-34.5	179	-69	-46.4	0	0	0	112.6	Q103 L104 E105 E110 Y111	Q103-Y107 HydrophobicContact CB-CE2 4.36Å; Q103-Y107 WeakPolarHBondContact O-CD2 3.34Å; Q103-Y107 PolarHBondContact O-N 2.89Å; L104-Y107 PolarHBondContact O-N 3.44Å; E105-Y107 PolarHBondContact O-N 3.48Å; Y107-E110 PolarHBondContact O-N 2.98Å; Y107-Y111 VanDerWaalsContact O-CB 3.31Å; Y107-Y111 WeakPolarHBondContact O-CB 3.38Å; Y107-Y111 PolarHBondContact O-N 3.11Å
108	R	98.4	Very high	98	Very high	145 Å²	145	105.3 Å²	105.3	55%	0.547	50%	0.503	S	S	.	.	H	α-helix	trans	-62.9	-47.8	175.5	-173.1	-176.3	179.9	164.8	6.1	111.6	L104 E105 R106 E110 Y111 E112	L104-R108 PolarHBondContact O-N 3Å; E105-R108 WeakPolarHBondContact O-CB 3.46Å; E105-R108 PolarHBondContact O-N 3.22Å; R106-R108 VanDerWaalsContact C-N 3.27Å; R106-R108 PolarHBondContact O-N 2.97Å; R108-E110 VanDerWaalsContact C-N 3.33Å; R108-E110 PolarHBondContact O-N 3.45Å; R108-Y111 PolarHBondContact O-N 2.91Å; R108-E112 IonicContact NE-OE1 2.74Å; R108-E112 PolarHBondContact NE-OE1 3.34Å; R108-E112 WeakPolarHBondContact O-CG 3.43Å; R108-E112 PolarHBondContact O-N 2.93Å
109	I	98.2	Very high	98	Very high	102 Å²	102	104.7 Å²	104.7	52%	0.523	50%	0.498	S	S	.	.	H	α-helix	trans	-61.9	-43.6	177.4	-66	166.8	0	0	0	110.7	E105 R106 E112 A113	E105-I109 HydrophobicContact CG-CD1 4.4Å; E105-I109 WeakPolarHBondContact O-CG1 3.42Å; E105-I109 PolarHBondContact O-N 3.34Å; R106-I109 PolarHBondContact O-N 2.92Å; I109-E112 PolarHBondContact O-N 2.72Å; I109-A113 WeakPolarHBondContact O-CB 3.39Å; I109-A113 PolarHBondContact O-N 3.41Å
110	E	97.8	Very high	97.9	Very high	103 Å²	103	105.1 Å²	105.1	48%	0.481	50%	0.5	S	S	.	.	H	α-helix	trans	-62	-43.3	177.8	-172.9	175.4	-175.1	0	0	111.7	R106 Y107 R108 A113 L114	R106-E110 WeakPolarHBondContact O-CB 3.32Å; R106-E110 PolarHBondContact O-N 2.93Å; Y107-E110 PolarHBondContact O-N 2.98Å; R108-E110 VanDerWaalsContact C-N 3.33Å; R108-E110 PolarHBondContact O-N 3.45Å; E110-A113 PolarHBondContact O-N 3.03Å; E110-L114 HydrophobicContact CG-CD1 4.28Å; E110-L114 WeakPolarHBondContact O-CG 3.41Å; E110-L114 PolarHBondContact O-N 3.04Å
111	Y	98.3	Very high	97.7	Very high	163 Å²	163	105.3 Å²	105.3	64%	0.639	50%	0.503	S	S	*	.	H	α-helix	trans	-61.6	-47.3	175.2	175.7	-93.7	0	0	0	112.2	Y107 R108 A113 L114 S115	Y107-Y111 VanDerWaalsContact O-CB 3.31Å; Y107-Y111 WeakPolarHBondContact O-CB 3.38Å; Y107-Y111 PolarHBondContact O-N 3.11Å; R108-Y111 PolarHBondContact O-N 2.91Å; Y111-A113 VanDerWaalsContact C-N 3.31Å; Y111-A113 PolarHBondContact O-N 3.3Å; Y111-L114 PolarHBondContact O-N 3.49Å; Y111-S115 WeakPolarHBondContact O-CB 3.24Å; Y111-S115 PolarHBondContact O-N 3.27Å
112	E	98	Very high	97.5	Very high	104 Å²	104	102.2 Å²	102.2	49%	0.486	49%	0.493	S	S	.	.	H	α-helix	trans	-61.1	-40.3	178.2	-74.3	174.7	-167.6	0	0	111.4	R108 I109 K116	R108-E112 IonicContact NE-OE1 2.74Å; R108-E112 PolarHBondContact NE-OE1 3.34Å; R108-E112 WeakPolarHBondContact O-CG 3.43Å; R108-E112 PolarHBondContact O-N 2.93Å; I109-E112 PolarHBondContact O-N 2.72Å; E112-K116 PolarHBondContact O-N 2.98Å; E112-K116 VanDerWaalsContact O-N 3.12Å
113	A	97.8	Very high	97.3	Very high	56 Å²	56	101.1 Å²	101.1	46%	0.463	49%	0.486	S	S	.	.	H	α-helix	trans	-64.3	-46.2	175.5	0	0	0	0	0	112.4	I109 E110 Y111 K116 V117	I109-A113 WeakPolarHBondContact O-CB 3.39Å; I109-A113 PolarHBondContact O-N 3.41Å; E110-A113 PolarHBondContact O-N 3.03Å; Y111-A113 VanDerWaalsContact C-N 3.31Å; Y111-A113 PolarHBondContact O-N 3.3Å; A113-K116 PolarHBondContact O-N 3Å; A113-V117 WeakPolarHBondContact O-CG2 3.24Å; A113-V117 PolarHBondContact O-N 2.85Å; A113-V117 VanDerWaalsContact O-N 3.12Å
114	L	97.7	Very high	97.1	Very high	110 Å²	110	105.2 Å²	105.2	58%	0.576	50%	0.503	S	S	*	.	H	α-helix	trans	-64.4	-42.3	178	-73.9	170.9	0	0	0	112	E110 Y111 K116 V117 E118	E110-L114 HydrophobicContact CG-CD1 4.28Å; E110-L114 WeakPolarHBondContact O-CG 3.41Å; E110-L114 PolarHBondContact O-N 3.04Å; Y111-L114 PolarHBondContact O-N 3.49Å; L114-K116 VanDerWaalsContact C-N 3.27Å; L114-K116 PolarHBondContact O-N 3.04Å; L114-V117 PolarHBondContact O-N 3.23Å; L114-E118 WeakPolarHBondContact O-CB 3.37Å; L114-E118 PolarHBondContact O-N 2.81Å
115	S	98	Very high	96.9	Very high	48 Å²	48	103.7 Å²	103.7	34%	0.336	50%	0.495	S	S	.	.	H	α-helix	trans	-62.4	-35.7	178	-175.7	0	0	0	0	111.9	Y111 A119	Y111-S115 WeakPolarHBondContact O-CB 3.24Å; Y111-S115 PolarHBondContact O-N 3.27Å; S115-A119 PolarHBondContact O-N 2.95Å
116	K	97.4	Very high	96.6	Very high	136 Å²	136	105 Å²	105	59%	0.591	50%	0.501	S	S	*	.	H	α-helix	trans	-65.5	-46.2	173.1	-169.5	-175.9	178.6	-164.2	0	112	E112 A113 L114 E118 A119 E120	E112-K116 PolarHBondContact O-N 2.98Å; E112-K116 VanDerWaalsContact O-N 3.12Å; A113-K116 PolarHBondContact O-N 3Å; L114-K116 VanDerWaalsContact C-N 3.27Å; L114-K116 PolarHBondContact O-N 3.04Å; K116-E118 VanDerWaalsContact C-N 3.32Å; K116-E118 PolarHBondContact O-N 3.49Å; K116-A119 PolarHBondContact O-N 3.01Å; K116-E120 VanDerWaalsContact CE-OE1 3.22Å; K116-E120 WeakPolarHBondContact CE-OE1 3.4Å; K116-E120 IonicContact NZ-OE1 3.21Å; K116-E120 WeakPolarHBondContact O-CG 3.42Å; K116-E120 PolarHBondContact O-N 3.27Å
117	V	97.6	Very high	96.1	Very high	66 Å²	66	103.8 Å²	103.8	40%	0.4	50%	0.502	S	S	.	.	H	α-helix	trans	-62.1	-41.1	177.4	172.5	0	0	0	0	111.2	A113 L114 E120 Q121	A113-V117 WeakPolarHBondContact O-CG2 3.24Å; A113-V117 PolarHBondContact O-N 2.85Å; A113-V117 VanDerWaalsContact O-N 3.12Å; L114-V117 PolarHBondContact O-N 3.23Å; V117-E120 PolarHBondContact O-N 2.84Å; V117-Q121 HydrophobicContact CG1-CG 4.43Å; V117-Q121 WeakPolarHBondContact O-CB 3.47Å; V117-Q121 VanDerWaalsContact O-CG 3.29Å; V117-Q121 WeakPolarHBondContact O-CG 3.3Å; V117-Q121 PolarHBondContact O-N 2.74Å
118	E	97.3	Very high	95.5	Very high	111 Å²	111	103.7 Å²	103.7	52%	0.519	50%	0.504	S	S	.	.	H	α-helix	trans	-60	-45.7	175	-176.6	-171.1	-172.1	0	0	111.5	L114 K116 Q121 N122	L114-E118 WeakPolarHBondContact O-CB 3.37Å; L114-E118 PolarHBondContact O-N 2.81Å; K116-E118 VanDerWaalsContact C-N 3.32Å; K116-E118 PolarHBondContact O-N 3.49Å; E118-Q121 PolarHBondContact O-N 3.4Å; E118-N122 WeakPolarHBondContact O-CB 3.5Å; E118-N122 PolarHBondContact O-N 2.66Å; E118-N122 PolarHBondContact O-ND2 2.99Å
119	A	96.6	Very high	94.8	Very high	47 Å²	47	102.2 Å²	102.2	39%	0.388	51%	0.506	S	S	.	.	H	α-helix	trans	-60.8	-46.5	176.7	0	0	0	0	0	112	S115 K116 Q121 N122 E123	S115-A119 PolarHBondContact O-N 2.95Å; K116-A119 PolarHBondContact O-N 3.01Å; A119-Q121 VanDerWaalsContact C-N 3.32Å; A119-Q121 PolarHBondContact O-N 3.07Å; A119-N122 PolarHBondContact O-N 3.38Å; A119-E123 PolarHBondContact O-N 2.98Å
120	E	96	Very high	93.6	Very high	101 Å²	101	104.3 Å²	104.3	47%	0.472	52%	0.517	S	S	.	.	H	α-helix	trans	-60.1	-40.5	176.4	-71	172.2	-172.4	0	0	111.9	K116 V117 F124	K116-E120 VanDerWaalsContact CE-OE1 3.22Å; K116-E120 WeakPolarHBondContact CE-OE1 3.4Å; K116-E120 IonicContact NZ-OE1 3.21Å; K116-E120 WeakPolarHBondContact O-CG 3.42Å; K116-E120 PolarHBondContact O-N 3.27Å; V117-E120 PolarHBondContact O-N 2.84Å; E120-F124 WeakPolarHBondContact O-CB 3.49Å; E120-F124 PolarHBondContact O-N 3Å
121	Q	95.1	Very high	91.9	Very high	115 Å²	115	107.2 Å²	107.2	54%	0.537	53%	0.531	S	S	.	.	H	α-helix	trans	-66.7	-42.2	176	-74.1	177.6	2.9	0	0	112.3	V117 E118 A119 F124 I125	V117-Q121 HydrophobicContact CG1-CG 4.43Å; V117-Q121 WeakPolarHBondContact O-CB 3.47Å; V117-Q121 VanDerWaalsContact O-CG 3.29Å; V117-Q121 WeakPolarHBondContact O-CG 3.3Å; V117-Q121 PolarHBondContact O-N 2.74Å; E118-Q121 PolarHBondContact O-N 3.4Å; A119-Q121 VanDerWaalsContact C-N 3.32Å; A119-Q121 PolarHBondContact O-N 3.07Å; Q121-F124 WeakPolarHBondContact O-CB 3.5Å; Q121-F124 PolarHBondContact O-N 3.23Å; Q121-I125 VanDerWaalsContact O-CG1 3.29Å; Q121-I125 WeakPolarHBondContact O-CG1 3.49Å; Q121-I125 PolarHBondContact O-N 2.71Å
122	N	94.9	Very high	89.6	Confident	79 Å²	79	110.4 Å²	110.4	42%	0.422	55%	0.548	S	S	.	.	H	α-helix	trans	-63.9	-44.6	177.3	-75.8	-26.4	0	0	0	111.5	E118 A119 F124 I125 E126	E118-N122 WeakPolarHBondContact O-CB 3.5Å; E118-N122 PolarHBondContact O-N 2.66Å; E118-N122 PolarHBondContact O-ND2 2.99Å; A119-N122 PolarHBondContact O-N 3.38Å; N122-F124 VanDerWaalsContact C-N 3.31Å; N122-F124 PolarHBondContact O-N 3Å; N122-I125 PolarHBondContact O-N 2.82Å; N122-E126 WeakPolarHBondContact O-CG 3.31Å; N122-E126 PolarHBondContact O-N 2.63Å
123	E	93.9	Very high	89.2	Confident	114 Å²	114	110.8 Å²	110.8	53%	0.533	55%	0.551	S	S	.	*	H	α-helix	trans	-58.5	-43.1	174	-75.5	-177.4	-177.5	0	0	111.7	A119 I125 E126 Q127	A119-E123 PolarHBondContact O-N 2.98Å; E123-I125 PolarHBondContact O-N 2.91Å; E123-E126 PolarHBondContact O-N 3.3Å; E123-Q127 VanDerWaalsContact O-CG 3.3Å; E123-Q127 WeakPolarHBondContact O-CG 3.49Å; E123-Q127 PolarHBondContact O-N 2.85Å
124	F	93.6	Very high	88.8	Confident	131 Å²	131	113.6 Å²	113.6	58%	0.575	56%	0.556	S	S	*	*	H	α-helix	trans	-61.1	-44.2	175.9	178.4	-97.7	0	0	0	112	E120 Q121 N122 Q127 F128	E120-F124 WeakPolarHBondContact O-CB 3.49Å; E120-F124 PolarHBondContact O-N 3Å; Q121-F124 WeakPolarHBondContact O-CB 3.5Å; Q121-F124 PolarHBondContact O-N 3.23Å; N122-F124 VanDerWaalsContact C-N 3.31Å; N122-F124 PolarHBondContact O-N 3Å; F124-Q127 PolarHBondContact O-N 3.18Å; F124-F128 HydrophobicContact CZ-CD2 4.41Å; F124-F128 WeakPolarHBondContact O-CB 3.23Å; F124-F128 PolarHBondContact O-N 3.05Å
125	I	93.5	Very high	88.3	Confident	88 Å²	88	113.8 Å²	113.8	45%	0.451	56%	0.555	S	S	.	*	H	α-helix	trans	-62.4	-46.1	177.3	-69.7	165.7	0	0	0	110.6	Q121 N122 E123 Q127 F128 I129	Q121-I125 VanDerWaalsContact O-CG1 3.29Å; Q121-I125 WeakPolarHBondContact O-CG1 3.49Å; Q121-I125 PolarHBondContact O-N 2.71Å; N122-I125 PolarHBondContact O-N 2.82Å; E123-I125 PolarHBondContact O-N 2.91Å; I125-Q127 PolarHBondContact O-N 3.17Å; I125-F128 PolarHBondContact O-N 3.11Å; I125-I129 HydrophobicContact CG2-CD1 3.66Å; I125-I129 HydrophobicContact CG2-CG1 4.33Å; I125-I129 VanDerWaalsContact O-CG1 3.3Å; I125-I129 WeakPolarHBondContact O-CG1 3.5Å; I125-I129 PolarHBondContact O-N 3.07Å
126	E	91.7	Very high	87.7	Confident	124 Å²	124	117.7 Å²	117.7	58%	0.579	57%	0.567	S	S	*	*	H	α-helix	trans	-59.2	-46.3	178	-75.1	-178.8	180	0	0	111.8	N122 E123 F128 I129 L130	N122-E126 WeakPolarHBondContact O-CG 3.31Å; N122-E126 PolarHBondContact O-N 2.63Å; E123-E126 PolarHBondContact O-N 3.3Å; E126-F128 VanDerWaalsContact C-N 3.32Å; E126-F128 PolarHBondContact O-N 3.07Å; E126-I129 PolarHBondContact O-N 3.43Å; E126-L130 WeakPolarHBondContact O-CB 2.93Å; E126-L130 WeakPolarHBondContact O-CG 3.38Å; E126-L130 PolarHBondContact O-N 3.43Å
127	Q	88.6	Confident	87.1	Confident	113 Å²	113	116.6 Å²	116.6	53%	0.528	57%	0.566	S	S	.	*	H	α-helix	trans	-61.1	-40.7	175.8	-71.4	176.2	20.6	0	0	112.1	E123 F124 I125 L130 Q131	E123-Q127 VanDerWaalsContact O-CG 3.3Å; E123-Q127 WeakPolarHBondContact O-CG 3.49Å; E123-Q127 PolarHBondContact O-N 2.85Å; F124-Q127 PolarHBondContact O-N 3.18Å; I125-Q127 PolarHBondContact O-N 3.17Å; Q127-L130 PolarHBondContact O-N 3.5Å; Q127-Q131 WeakPolarHBondContact O-CG 3.39Å; Q127-Q131 PolarHBondContact O-N 3.28Å
128	F	85.9	Confident	86.4	Confident	121 Å²	121	119.9 Å²	119.9	53%	0.531	58%	0.577	S	S	.	*	H	α-helix	trans	-69.4	-33.9	179.2	-160.4	-92.1	0	0	0	112.6	F124 I125 E126	F124-F128 HydrophobicContact CZ-CD2 4.41Å; F124-F128 WeakPolarHBondContact O-CB 3.23Å; F124-F128 PolarHBondContact O-N 3.05Å; I125-F128 PolarHBondContact O-N 3.11Å; E126-F128 VanDerWaalsContact C-N 3.32Å; E126-F128 PolarHBondContact O-N 3.07Å
129	I	82.7	Confident	85.6	Confident	115 Å²	115	120.6 Å²	120.6	59%	0.59	58%	0.581	S	S	*	*	H	α-helix	trans	-70.6	-39.6	174.7	-69.3	170.3	0	0	0	110.9	I125 E126 Q131 K132	I125-I129 HydrophobicContact CG2-CD1 3.66Å; I125-I129 HydrophobicContact CG2-CG1 4.33Å; I125-I129 VanDerWaalsContact O-CG1 3.3Å; I125-I129 WeakPolarHBondContact O-CG1 3.5Å; I125-I129 PolarHBondContact O-N 3.07Å; E126-I129 PolarHBondContact O-N 3.43Å; I129-Q131 VanDerWaalsContact C-N 3.3Å; I129-Q131 PolarHBondContact O-N 3.03Å; I129-K132 PolarHBondContact O-N 3.24Å
130	L	72.4	Confident	84.8	Confident	145 Å²	145	126.2 Å²	126.2	76%	0.759	60%	0.596	S	S	*	*	H	α-helix	trans	-73	-16.7	-179.9	-75.8	163.4	0	0	0	114.3	E126 Q127	E126-L130 WeakPolarHBondContact O-CB 2.93Å; E126-L130 WeakPolarHBondContact O-CG 3.38Å; E126-L130 PolarHBondContact O-N 3.43Å; Q127-L130 PolarHBondContact O-N 3.5Å
131	Q	63.4	Low	83.8	Confident	164 Å²	164	128.3 Å²	128.3	77%	0.766	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	1.4	177.4	-75.9	-175.7	1.1	0	0	114.3	Q127 I129	Q127-Q131 WeakPolarHBondContact O-CG 3.39Å; Q127-Q131 PolarHBondContact O-N 3.28Å; I129-Q131 VanDerWaalsContact C-N 3.3Å; I129-Q131 PolarHBondContact O-N 3.03Å
132	K	50.4	Low	82.8	Confident	231 Å²	231	129.5 Å²	129.5	100%	1.004	61%	0.613	S	S	*	*			trans	-103.4	0	169	-86.3	-171.2	174.2	-177.9	0	111.3	I129	I129-K132 PolarHBondContact O-N 3.24Å

Retrieved 132 of 132 residues in 648.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).