A0A060Y8S0_ONCMY Loading...

Small ribosomal subunit protein bS6m

AlphaFold DB , UniProt , Accession A0A060Y8S0, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 118 aa.

						>A0A060Y8S0_ONCMY|A0A060Y8S0
MPRYELALIVKAMQRPETAALLRRTVETLMERGAVVRGLENLGEKLLPYKISKHNERHTRGGYFLIDFHAAPGIVTGLLDHLERDIDVVRPTVLKNDPEPSNGPCCGHPVASKHQDTV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.9	Confident	92.1	Very high	172 Å²	172	45.1 Å²	45.1	85%	0.847	22%	0.22	S	C	*	.				0	127.1	0	-72	170.6	175.6	0	0	108.2	H69	M1-H69 HydrophobicContact CB-CB 4.35Å; M1-H69 PolarHBondContact O-ND1 3.37Å
2	P	89.1	Confident	92.1	Very high	46 Å²	46	44.7 Å²	44.7	30%	0.299	23%	0.23	S	C	.	.			trans	-60.3	153.3	177.3	21.9	-28.9	0	0	0	111.5	Y4 H69 A70	P2-Y4 HydrophobicContact CB-CE2 3.95Å; P2-Y4 HydrophobicContact CG-CE2 3.67Å; P2-H69 PolarHBondContact O-ND1 3.5Å; P2-H69 VanDerWaalsContact O-ND1 3.1Å; P2-A70 WeakPolarHBondContact CD-O 3.5Å; P2-A70 WeakPolarHBondContact CG-O 3.28Å; P2-A70 PolarHBondContact O-N 2.71Å
3	R	91.1	Very high	92.1	Very high	96 Å²	96	43.7 Å²	43.7	36%	0.362	22%	0.224	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-97.8	135.2	175.8	-168.6	180	176.2	-167.5	-3.4	108.3	D67 N96	R3-D67 VanDerWaalsContact CG-OD1 3.31Å; R3-D67 WeakPolarHBondContact CG-OD1 3.26Å; R3-D67 IonicContact CZ-OD1 3.2Å; R3-D67 IonicContact CZ-OD2 3.27Å; R3-D67 VanDerWaalsContact NE-CG 3.29Å; R3-D67 IonicContact NE-OD1 3Å; R3-D67 PolarHBondContact NE-OD1 3.48Å; R3-D67 IonicContact NE-OD2 2.69Å; R3-D67 PolarHBondContact NE-OD2 2.87Å; R3-D67 IonicContact NH2-OD1 2.8Å; R3-D67 IonicContact NH2-OD2 2.64Å; R3-D67 PolarHBondContact NH2-OD2 3.48Å; R3-N96 HydrophobicContact CB-CB 4.09Å; R3-N96 HydrophobicContact CG-CB 3.86Å; R3-N96 PolarHBondContact O-N 3.41Å
4	Y	93.1	Very high	92.1	Very high	28 Å²	28	50.1 Å²	50.1	11%	0.11	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	151.8	177.1	-64.7	-80.2	0	0	0	109.7	P2 F68 A70 V75 V93 L94 K95	P2-Y4 HydrophobicContact CB-CE2 3.95Å; P2-Y4 HydrophobicContact CG-CE2 3.67Å; Y4-F68 VanDerWaalsContact CB-CZ 3.49Å; Y4-F68 HydrophobicContact CD2-CE2 4.26Å; Y4-F68 HydrophobicContact CG-CE2 4.43Å; Y4-F68 HydrophobicContact CG-CZ 4.3Å; Y4-F68 PolarHBondContact N-O 3.33Å; Y4-F68 PolarHBondContact O-N 3.11Å; Y4-F68 VanDerWaalsContact O-O 3.11Å; Y4-A70 HydrophobicContact CD2-CB 3.93Å; Y4-A70 HydrophobicContact CE2-CB 4.15Å; Y4-V75 HydrophobicContact CD2-CG2 4.27Å; Y4-V75 HydrophobicContact CE1-CG2 4.29Å; Y4-V75 HydrophobicContact CE2-CG2 3.87Å; Y4-V93 HydrophobicContact CD1-CG1 3.97Å; Y4-V93 HydrophobicContact CG-CG1 4.35Å; Y4-L94 CarbonylContact C-O 3.59Å; Y4-L94 VanDerWaalsContact CA-O 3.27Å; Y4-L94 WeakPolarHBondContact CA-O 3.25Å; Y4-K95 HydrophobicContact CD1-CB 4.33Å; Y4-K95 HydrophobicContact CE1-CB 4.28Å; Y4-K95 HydrophobicContact CE1-CG 4.25Å
5	E	94	Very high	92.1	Very high	50 Å²	50	61.3 Å²	61.3	23%	0.234	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	128	170.2	-163.4	168.5	116.5	0	0	108.6	I66 V93 L94 N96	E5-I66 WeakPolarHBondContact CA-O 3.3Å; E5-V93 CarbonylContact O-C 3.52Å; E5-V93 WeakPolarHBondContact O-CA 3.39Å; E5-L94 HydrophobicContact CB-CB 4.43Å; E5-L94 PolarHBondContact N-O 3.3Å; E5-L94 PolarHBondContact O-N 3.33Å; E5-N96 PolarHBondContact OE2-ND2 3.12Å; E5-N96 PolarHBondContact OE2-OD1 3.47Å
6	L	94	Very high	92.3	Very high	0 Å²	0	63.4 Å²	63.4	0%	0	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	107.3	171.2	173.1	66.6	0	0	0	108	T25 L65 I66 F68 L82 P91 T92 V93	L6-T25 HydrophobicContact CD2-CG2 4.16Å; L6-L65 WeakPolarHBondContact O-CA 3.36Å; L6-I66 HydrophobicContact CB-CB 4.26Å; L6-I66 HydrophobicContact CD2-CD1 4.3Å; L6-I66 PolarHBondContact N-O 3.19Å; L6-I66 PolarHBondContact O-N 3.48Å; L6-F68 HydrophobicContact CB-CD1 4.35Å; L6-F68 HydrophobicContact CB-CE1 3.7Å; L6-L82 HydrophobicContact CD1-CD1 3.78Å; L6-L82 HydrophobicContact CD2-CD1 3.82Å; L6-L82 HydrophobicContact CG-CD1 4.47Å; L6-P91 HydrophobicContact CD1-CB 4.46Å; L6-T92 WeakPolarHBondContact CA-O 3.33Å; L6-V93 HydrophobicContact CD1-CG2 3.72Å
7	A	94.8	Very high	92.3	Very high	25 Å²	25	65.5 Å²	65.5	21%	0.207	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	110	167.8	0	0	0	0	0	108.9	L65 T92 L94	A7-L65 HydrophobicContact CB-CD2 3.83Å; A7-T92 PolarHBondContact N-O 2.97Å; A7-T92 PolarHBondContact O-N 2.71Å; A7-L94 HydrophobicContact CB-CD1 3.98Å
8	L	94.7	Very high	92.4	Very high	1 Å²	1	63.1 Å²	63.1	1%	0.005	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	121.9	-175.4	-164.7	79.7	0	0	0	109.8	V10 L21 L22 F64 L82 V88 P91	L8-V10 HydrophobicContact CD2-CG1 3.43Å; L8-V10 VanDerWaalsContact CD2-CG1 3.43Å; L8-V10 HydrophobicContact CG-CG1 3.81Å; L8-L21 HydrophobicContact CD2-CD2 3.94Å; L8-L22 HydrophobicContact CD2-CD2 4.3Å; L8-F64 HydrophobicContact CB-CB 4.35Å; L8-F64 PolarHBondContact N-O 2.91Å; L8-F64 PolarHBondContact O-N 3.45Å; L8-L82 HydrophobicContact CD1-CD2 4.27Å; L8-V88 HydrophobicContact CD1-CG1 3.76Å; L8-V88 HydrophobicContact CD1-CG2 4.13Å; L8-P91 HydrophobicContact CD1-CB 4.42Å
9	I	95.6	Very high	92.5	Very high	25 Å²	25	62.1 Å²	62.1	13%	0.128	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	114.8	166.8	-53.4	-177.1	0	0	0	107.8	L47 G62 Y63 V89 R90	I9-L47 HydrophobicContact CG2-CD2 3.72Å; I9-G62 WeakPolarHBondContact CA-O 3.28Å; I9-Y63 HydrophobicContact CD1-CD1 4.37Å; I9-Y63 HydrophobicContact CD1-CE1 3.77Å; I9-Y63 HydrophobicContact CG1-CD1 4.06Å; I9-Y63 HydrophobicContact CG1-CE1 3.96Å; I9-V89 HydrophobicContact CB-CB 4.5Å; I9-V89 HydrophobicContact CG2-CB 4.1Å; I9-V89 HydrophobicContact CG2-CG1 4.44Å; I9-V89 WeakPolarHBondContact O-CA 3.18Å; I9-V89 WeakPolarHBondContact O-CB 3.31Å; I9-V89 PolarHBondContact O-N 3.48Å; I9-R90 HydrophobicContact CB-CB 4.11Å; I9-R90 HydrophobicContact CD1-CB 4.16Å; I9-R90 HydrophobicContact CG1-CB 4.33Å; I9-R90 PolarHBondContact N-O 3.09Å; I9-R90 PolarHBondContact O-N 3.08Å; I9-R90 VanDerWaalsContact O-N 3.11Å
10	V	95.2	Very high	92.6	Very high	1 Å²	1	60.6 Å²	60.6	1%	0.006	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	154.6	179.6	-53.1	0	0	0	0	110.6	L8 T18 L21 G61 G62 F64	L8-V10 HydrophobicContact CD2-CG1 3.43Å; L8-V10 VanDerWaalsContact CD2-CG1 3.43Å; L8-V10 HydrophobicContact CG-CG1 3.81Å; V10-T18 HydrophobicContact CG2-CG2 4.47Å; V10-L21 HydrophobicContact CB-CD2 4.2Å; V10-L21 HydrophobicContact CG1-CD2 3.37Å; V10-G61 CarbonylContact O-C 3.58Å; V10-G61 WeakPolarHBondContact O-CA 3.41Å; V10-G62 PolarHBondContact N-O 3.24Å; V10-G62 PolarHBondContact O-N 2.96Å; V10-F64 HydrophobicContact CG1-CD2 4.03Å; V10-F64 HydrophobicContact CG1-CE2 4.44Å; V10-F64 HydrophobicContact CG2-CD2 3.82Å; V10-F64 HydrophobicContact CG2-CE2 3.52Å
11	K	94.3	Very high	92.7	Very high	52 Å²	52	57.7 Å²	57.7	23%	0.226	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-59.2	144.5	172.1	178.6	179	169.7	173.5	0	110	M13 E56 D87 V89	K11-M13 HydrophobicContact CB-CG 4.01Å; K11-M13 HydrophobicContact CB-SD 4.3Å; K11-M13 HydrophobicContact CD-CG 4.11Å; K11-M13 HydrophobicContact CD-SD 4.35Å; K11-M13 HydrophobicContact CG-CG 3.86Å; K11-M13 WeakPolarHBondContact O-CG 3.47Å; K11-M13 PolarHBondContact O-N 2.79Å; K11-M13 VanDerWaalsContact O-N 3.14Å; K11-E56 WeakPolarHBondContact CE-OE1 3.3Å; K11-E56 VanDerWaalsContact CE-OE2 3.31Å; K11-E56 WeakPolarHBondContact CE-OE2 3.47Å; K11-E56 IonicContact NZ-OE1 3.65Å; K11-E56 PolarHBondContact NZ-OE1 2.8Å; K11-E56 IonicContact NZ-OE2 3.74Å; K11-E56 PolarHBondContact NZ-OE2 2.91Å; K11-D87 PolarHBondContact N-O 3.03Å; K11-V89 HydrophobicContact CB-CG2 4.17Å
12	A	92.1	Very high	93.5	Very high	40 Å²	40	50.5 Å²	50.5	33%	0.331	26%	0.26	S	S	.	.	S	Bend	trans	-67.6	110.3	171.4	0	0	0	0	0	109.6	E44 R60	A12-E44 HydrophobicContact CB-CG 4.49Å; A12-E44 WeakPolarHBondContact CB-OE1 3.14Å; A12-R60 HydrophobicContact CB-CB 4.05Å
13	M	91.9	Very high	93.7	Very high	32 Å²	32	56.6 Å²	56.6	16%	0.158	28%	0.277	C	S	.	.			trans	-139.1	173.6	-170.2	-68.9	-168.2	-59	0	0	111	K11 E17 D87	K11-M13 HydrophobicContact CB-CG 4.01Å; K11-M13 HydrophobicContact CB-SD 4.3Å; K11-M13 HydrophobicContact CD-CG 4.11Å; K11-M13 HydrophobicContact CD-SD 4.35Å; K11-M13 HydrophobicContact CG-CG 3.86Å; K11-M13 WeakPolarHBondContact O-CG 3.47Å; K11-M13 PolarHBondContact O-N 2.79Å; K11-M13 VanDerWaalsContact O-N 3.14Å; M13-E17 HydrophobicContact CB-CB 4.07Å; M13-E17 WeakPolarHBondContact CB-OE2 3.5Å; M13-E17 HydrophobicContact CE-CB 4.31Å; M13-E17 HydrophobicContact SD-CB 4.19Å; M13-D87 HydrophobicContact CE-CB 3.82Å; M13-D87 HydrophobicContact SD-CB 4.12Å
14	Q	93.3	Very high	93.9	Very high	133 Å²	133	58.4 Å²	58.4	62%	0.621	28%	0.284	S	S	*	.			trans	-68.3	155.6	173.3	-63.8	-63.6	-37.5	0	0	110.8	P16 E17 T18	Q14-P16 HydrophobicContact CB-CG 4.16Å; Q14-E17 HydrophobicContact CB-CG 4.48Å; Q14-E17 PolarHBondContact N-OE2 3.2Å; Q14-E17 PolarHBondContact O-N 2.71Å; Q14-T18 PolarHBondContact O-N 3.18Å; Q14-T18 PolarHBondContact O-OG1 2.94Å
15	R	91.2	Very high	93.9	Very high	219 Å²	219	57.1 Å²	57.1	83%	0.826	28%	0.279	S	S	*	.	H	α-helix	trans	-50.7	-46.2	176.7	-73.8	-174.1	171.6	-173	-2.3	114.5	E17 T18 A19	R15-E17 PolarHBondContact O-N 2.7Å; R15-T18 PolarHBondContact O-N 3Å; R15-A19 WeakPolarHBondContact O-CB 3.48Å; R15-A19 PolarHBondContact O-N 2.98Å
16	P	95.1	Very high	93.9	Very high	95 Å²	95	56.2 Å²	56.2	62%	0.617	28%	0.277	S	S	*	.	H	α-helix	trans	-63.8	-38.1	179	23.2	-35.3	0	0	0	113.3	Q14 A19 A20	Q14-P16 HydrophobicContact CB-CG 4.16Å; P16-A19 PolarHBondContact O-N 2.53Å; P16-A20 WeakPolarHBondContact O-CB 3.49Å; P16-A20 PolarHBondContact O-N 2.88Å
17	E	93.1	Very high	93.9	Very high	99 Å²	99	61.4 Å²	61.4	46%	0.463	30%	0.301	S	S	.	.	H	α-helix	trans	-66.9	-44.1	178.5	-64.4	168.5	166.6	0	0	110.6	M13 Q14 R15 A19 A20 L21	M13-E17 HydrophobicContact CB-CB 4.07Å; M13-E17 WeakPolarHBondContact CB-OE2 3.5Å; M13-E17 HydrophobicContact CE-CB 4.31Å; M13-E17 HydrophobicContact SD-CB 4.19Å; Q14-E17 HydrophobicContact CB-CG 4.48Å; Q14-E17 PolarHBondContact N-OE2 3.2Å; Q14-E17 PolarHBondContact O-N 2.71Å; R15-E17 PolarHBondContact O-N 2.7Å; E17-A19 VanDerWaalsContact C-N 3.35Å; E17-A19 PolarHBondContact O-N 3.26Å; E17-A20 WeakPolarHBondContact O-CB 3.31Å; E17-A20 PolarHBondContact O-N 3.09Å; E17-L21 PolarHBondContact O-N 3.11Å
18	T	93.8	Very high	93.8	Very high	22 Å²	22	60.9 Å²	60.9	14%	0.135	30%	0.295	C	S	.	.	H	α-helix	trans	-60.9	-44.7	175.7	-51.7	0	0	0	0	111.2	V10 Q14 R15 A20 L21 L22 F64	V10-T18 HydrophobicContact CG2-CG2 4.47Å; Q14-T18 PolarHBondContact O-N 3.18Å; Q14-T18 PolarHBondContact O-OG1 2.94Å; R15-T18 PolarHBondContact O-N 3Å; T18-A20 VanDerWaalsContact C-N 3.32Å; T18-A20 PolarHBondContact O-N 2.77Å; T18-L21 PolarHBondContact O-N 3.21Å; T18-L22 HydrophobicContact CG2-CD1 4.28Å; T18-L22 WeakPolarHBondContact O-CG 3.38Å; T18-L22 PolarHBondContact O-N 2.74Å; T18-F64 HydrophobicContact CG2-CE2 3.8Å; T18-F64 HydrophobicContact CG2-CZ 3.65Å
19	A	93.8	Very high	93.7	Very high	43 Å²	43	61 Å²	61	36%	0.355	30%	0.296	S	S	.	.	H	α-helix	trans	-63.9	-37.6	177.2	0	0	0	0	0	112.2	R15 P16 E17 L22 R23	R15-A19 WeakPolarHBondContact O-CB 3.48Å; R15-A19 PolarHBondContact O-N 2.98Å; P16-A19 PolarHBondContact O-N 2.53Å; E17-A19 VanDerWaalsContact C-N 3.35Å; E17-A19 PolarHBondContact O-N 3.26Å; A19-L22 PolarHBondContact O-N 2.92Å; A19-R23 WeakPolarHBondContact O-CB 3.37Å; A19-R23 VanDerWaalsContact O-CG 3.28Å; A19-R23 WeakPolarHBondContact O-CG 2.98Å; A19-R23 PolarHBondContact O-N 3.13Å
20	A	95.3	Very high	93.5	Very high	33 Å²	33	65.6 Å²	65.6	27%	0.273	32%	0.319	S	S	.	.	H	α-helix	trans	-65	-43.8	176.2	0	0	0	0	0	111.8	P16 E17 T18 R23 R24	P16-A20 WeakPolarHBondContact O-CB 3.49Å; P16-A20 PolarHBondContact O-N 2.88Å; E17-A20 WeakPolarHBondContact O-CB 3.31Å; E17-A20 PolarHBondContact O-N 3.09Å; T18-A20 VanDerWaalsContact C-N 3.32Å; T18-A20 PolarHBondContact O-N 2.77Å; A20-R23 PolarHBondContact O-N 2.8Å; A20-R24 VanDerWaalsContact O-CG 3.28Å; A20-R24 WeakPolarHBondContact O-CG 3.49Å; A20-R24 PolarHBondContact O-N 3.28Å
21	L	94.3	Very high	93.4	Very high	0 Å²	0	73.1 Å²	73.1	0%	0	35%	0.353	C	S	.	.	H	α-helix	trans	-61.5	-46.8	174.9	168.7	132.2	0	0	0	112.1	L8 V10 E17 T18 R23 R24 T25 D87 V88	L8-L21 HydrophobicContact CD2-CD2 3.94Å; V10-L21 HydrophobicContact CB-CD2 4.2Å; V10-L21 HydrophobicContact CG1-CD2 3.37Å; E17-L21 PolarHBondContact O-N 3.11Å; T18-L21 PolarHBondContact O-N 3.21Å; L21-R23 VanDerWaalsContact C-N 3.29Å; L21-R23 PolarHBondContact O-N 2.88Å; L21-R24 PolarHBondContact O-N 3.11Å; L21-T25 WeakPolarHBondContact O-CB 3.15Å; L21-T25 PolarHBondContact O-N 2.94Å; L21-T25 PolarHBondContact O-OG1 2.89Å; L21-D87 HydrophobicContact CD1-CB 3.24Å; L21-V88 HydrophobicContact CD1-CG2 3.86Å
22	L	93.7	Very high	93.2	Very high	21 Å²	21	74.7 Å²	74.7	11%	0.11	36%	0.358	C	S	.	.	H	α-helix	trans	-61.4	-41.1	179.3	-69.7	174	0	0	0	111.1	L8 T18 A19 T25 V26 L39 F64	L8-L22 HydrophobicContact CD2-CD2 4.3Å; T18-L22 HydrophobicContact CG2-CD1 4.28Å; T18-L22 WeakPolarHBondContact O-CG 3.38Å; T18-L22 PolarHBondContact O-N 2.74Å; A19-L22 PolarHBondContact O-N 2.92Å; L22-T25 PolarHBondContact O-N 2.84Å; L22-V26 WeakPolarHBondContact O-CB 3.49Å; L22-V26 VanDerWaalsContact O-CG2 3.29Å; L22-V26 WeakPolarHBondContact O-CG2 3.48Å; L22-V26 PolarHBondContact O-N 2.66Å; L22-L39 HydrophobicContact CB-CD1 4.41Å; L22-L39 HydrophobicContact CD1-CD1 4.36Å; L22-L39 HydrophobicContact CD2-CD1 4.23Å; L22-F64 HydrophobicContact CD1-CD1 3.99Å; L22-F64 HydrophobicContact CD1-CE1 3.72Å; L22-F64 HydrophobicContact CD1-CZ 4.09Å; L22-F64 HydrophobicContact CD2-CB 4.31Å; L22-F64 HydrophobicContact CD2-CD1 4.15Å; L22-F64 HydrophobicContact CD2-CD2 4.32Å; L22-F64 HydrophobicContact CD2-CG 3.99Å
23	R	94.5	Very high	93.1	Very high	174 Å²	174	75.1 Å²	75.1	66%	0.657	37%	0.366	S	S	*	.	H	α-helix	trans	-59.6	-51.5	174.3	-76.3	175.6	-179.7	-176.4	-0.1	112	A19 A20 L21 T25 V26 E27	A19-R23 WeakPolarHBondContact O-CB 3.37Å; A19-R23 VanDerWaalsContact O-CG 3.28Å; A19-R23 WeakPolarHBondContact O-CG 2.98Å; A19-R23 PolarHBondContact O-N 3.13Å; A20-R23 PolarHBondContact O-N 2.8Å; L21-R23 VanDerWaalsContact C-N 3.29Å; L21-R23 PolarHBondContact O-N 2.88Å; R23-T25 VanDerWaalsContact C-N 3.27Å; R23-T25 PolarHBondContact O-N 2.84Å; R23-V26 PolarHBondContact O-N 2.91Å; R23-E27 WeakPolarHBondContact O-CB 3.38Å; R23-E27 WeakPolarHBondContact O-CG 3.49Å; R23-E27 PolarHBondContact O-N 3.27Å
24	R	94.4	Very high	93.1	Very high	134 Å²	134	73.9 Å²	73.9	51%	0.506	36%	0.361	S	S	.	.	H	α-helix	trans	-57.3	-41	178.1	-68.9	168.3	-174.6	171.8	2.6	112.3	A20 L21 T28	A20-R24 VanDerWaalsContact O-CG 3.28Å; A20-R24 WeakPolarHBondContact O-CG 3.49Å; A20-R24 PolarHBondContact O-N 3.28Å; L21-R24 PolarHBondContact O-N 3.11Å; R24-T28 WeakPolarHBondContact O-CB 3.4Å; R24-T28 PolarHBondContact O-N 2.92Å; R24-T28 PolarHBondContact O-OG1 2.89Å
25	T	93.3	Very high	93.1	Very high	1 Å²	1	71.7 Å²	71.7	1%	0.006	36%	0.357	C	S	.	.	H	α-helix	trans	-64.9	-46.7	178.4	-57.9	0	0	0	0	111.3	L6 L21 L22 R23 T28 L29 I66 L82	L6-T25 HydrophobicContact CD2-CG2 4.16Å; L21-T25 WeakPolarHBondContact O-CB 3.15Å; L21-T25 PolarHBondContact O-N 2.94Å; L21-T25 PolarHBondContact O-OG1 2.89Å; L22-T25 PolarHBondContact O-N 2.84Å; R23-T25 VanDerWaalsContact C-N 3.27Å; R23-T25 PolarHBondContact O-N 2.84Å; T25-T28 PolarHBondContact O-N 2.97Å; T25-L29 HydrophobicContact CG2-CD1 4.39Å; T25-L29 WeakPolarHBondContact O-CG 3.36Å; T25-L29 PolarHBondContact O-N 2.93Å; T25-I66 HydrophobicContact CG2-CD1 4.12Å; T25-L82 HydrophobicContact CG2-CD2 3.97Å
26	V	93.9	Very high	93.2	Very high	31 Å²	31	63.4 Å²	63.4	19%	0.188	33%	0.33	C	S	.	.	H	α-helix	trans	-67.4	-42.6	178.9	170.3	0	0	0	0	111.3	L22 R23 T28 L29 M30 V36 L39	L22-V26 WeakPolarHBondContact O-CB 3.49Å; L22-V26 VanDerWaalsContact O-CG2 3.29Å; L22-V26 WeakPolarHBondContact O-CG2 3.48Å; L22-V26 PolarHBondContact O-N 2.66Å; R23-V26 PolarHBondContact O-N 2.91Å; V26-T28 PolarHBondContact O-N 3.17Å; V26-L29 WeakPolarHBondContact O-CB 3.48Å; V26-L29 PolarHBondContact O-N 2.93Å; V26-M30 HydrophobicContact CG1-CG 4.43Å; V26-M30 HydrophobicContact CG1-SD 3.98Å; V26-M30 VanDerWaalsContact O-CG 3.31Å; V26-M30 WeakPolarHBondContact O-CG 3.44Å; V26-M30 PolarHBondContact O-N 2.89Å; V26-V36 HydrophobicContact CG1-CG2 4.28Å; V26-L39 HydrophobicContact CG2-CD1 4.43Å
27	E	94.2	Very high	93.1	Very high	108 Å²	108	66 Å²	66	51%	0.505	33%	0.328	S	S	.	.	H	α-helix	trans	-57.5	-48.9	174.5	-76.7	167.4	-173.1	0	0	110.7	R23 L29 M30 E31	R23-E27 WeakPolarHBondContact O-CB 3.38Å; R23-E27 WeakPolarHBondContact O-CG 3.49Å; R23-E27 PolarHBondContact O-N 3.27Å; E27-L29 VanDerWaalsContact C-N 3.28Å; E27-L29 PolarHBondContact O-N 2.99Å; E27-M30 PolarHBondContact O-N 3.42Å; E27-E31 WeakPolarHBondContact O-CG 3.23Å; E27-E31 PolarHBondContact O-N 3.19Å
28	T	92.9	Very high	93.1	Very high	14 Å²	14	62.9 Å²	62.9	9%	0.086	32%	0.322	C	S	.	.	H	α-helix	trans	-61.7	-36.2	178.3	-57	0	0	0	0	112.5	R24 T25 V26 R32 H81	R24-T28 WeakPolarHBondContact O-CB 3.4Å; R24-T28 PolarHBondContact O-N 2.92Å; R24-T28 PolarHBondContact O-OG1 2.89Å; T25-T28 PolarHBondContact O-N 2.97Å; V26-T28 PolarHBondContact O-N 3.17Å; T28-R32 VanDerWaalsContact CG2-NE 3.29Å; T28-R32 WeakPolarHBondContact O-CD 3.27Å; T28-R32 VanDerWaalsContact O-CG 3.25Å; T28-R32 WeakPolarHBondContact O-CG 3.42Å; T28-R32 PolarHBondContact O-N 3.45Å; T28-H81 PolarHBondContact OG1-NE2 3.39Å
29	L	92.1	Very high	93.1	Very high	4 Å²	4	65.8 Å²	65.8	2%	0.021	34%	0.337	C	S	.	.	H	α-helix	trans	-62.4	-48.4	172.9	-80.2	167.7	0	0	0	110.9	T25 V26 E27 R32 A34 V36 I66 F68 L78	T25-L29 HydrophobicContact CG2-CD1 4.39Å; T25-L29 WeakPolarHBondContact O-CG 3.36Å; T25-L29 PolarHBondContact O-N 2.93Å; V26-L29 WeakPolarHBondContact O-CB 3.48Å; V26-L29 PolarHBondContact O-N 2.93Å; E27-L29 VanDerWaalsContact C-N 3.28Å; E27-L29 PolarHBondContact O-N 2.99Å; L29-R32 PolarHBondContact O-N 3.14Å; L29-A34 HydrophobicContact CB-CB 4.13Å; L29-A34 HydrophobicContact CD2-CB 4.08Å; L29-A34 WeakPolarHBondContact O-CB 3.43Å; L29-A34 PolarHBondContact O-N 3.48Å; L29-V36 HydrophobicContact CB-CG2 4.26Å; L29-V36 HydrophobicContact CD1-CG2 4.22Å; L29-I66 HydrophobicContact CD1-CG2 4.13Å; L29-F68 HydrophobicContact CD2-CD2 4.04Å; L29-F68 HydrophobicContact CD2-CE2 4.01Å; L29-F68 HydrophobicContact CD2-CG 4.37Å; L29-F68 HydrophobicContact CD2-CZ 4.34Å; L29-L78 HydrophobicContact CD2-CD1 3.67Å; L29-L78 HydrophobicContact CD2-CD2 3.44Å; L29-L78 VanDerWaalsContact CD2-CD2 3.44Å; L29-L78 HydrophobicContact CD2-CG 4.17Å; L29-L78 HydrophobicContact CG-CD1 4.02Å
30	M	91.9	Very high	93.2	Very high	122 Å²	122	69.1 Å²	69.1	60%	0.601	35%	0.345	S	S	*	.	H	α-helix	trans	-67	-41.1	-178	-67.3	179.7	80.4	0	0	112.5	V26 E27 R32 G33	V26-M30 HydrophobicContact CG1-CG 4.43Å; V26-M30 HydrophobicContact CG1-SD 3.98Å; V26-M30 VanDerWaalsContact O-CG 3.31Å; V26-M30 WeakPolarHBondContact O-CG 3.44Å; V26-M30 PolarHBondContact O-N 2.89Å; E27-M30 PolarHBondContact O-N 3.42Å; M30-R32 PolarHBondContact O-N 2.69Å; M30-G33 PolarHBondContact O-N 3.42Å
31	E	92.7	Very high	93.2	Very high	158 Å²	158	72.3 Å²	72.3	74%	0.738	36%	0.358	S	S	*	.	H	α-helix	trans	-58.3	-32.1	176.3	-75.2	176.6	176.4	0	0	112.7	E27 G33	E27-E31 WeakPolarHBondContact O-CG 3.23Å; E27-E31 PolarHBondContact O-N 3.19Å; E31-G33 VanDerWaalsContact C-N 3.26Å; E31-G33 PolarHBondContact O-N 2.85Å
32	R	89.5	Confident	93.1	Very high	85 Å²	85	75.5 Å²	75.5	32%	0.321	37%	0.374	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.4	4.1	179.5	-64.8	170.9	-170.6	-143.5	4	113.3	T28 L29 M30 I74 G77	T28-R32 VanDerWaalsContact CG2-NE 3.29Å; T28-R32 WeakPolarHBondContact O-CD 3.27Å; T28-R32 VanDerWaalsContact O-CG 3.25Å; T28-R32 WeakPolarHBondContact O-CG 3.42Å; T28-R32 PolarHBondContact O-N 3.45Å; L29-R32 PolarHBondContact O-N 3.14Å; M30-R32 PolarHBondContact O-N 2.69Å; R32-I74 HydrophobicContact CB-CB 4.49Å; R32-I74 HydrophobicContact CB-CD1 4.39Å; R32-G77 PolarHBondContact NH1-O 2.73Å
33	G	89.6	Confident	93.1	Very high	49 Å²	49	75.7 Å²	75.7	51%	0.505	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	80.6	22.6	-179.3	0	0	0	0	0	113.9	M30 E31	M30-G33 PolarHBondContact O-N 3.42Å; E31-G33 VanDerWaalsContact C-N 3.26Å; E31-G33 PolarHBondContact O-N 2.85Å
34	A	92.4	Very high	93.1	Very high	6 Å²	6	71.6 Å²	71.6	5%	0.05	37%	0.37	C	S	.	.			trans	-82.5	145	167.7	0	0	0	0	0	111	L29 F68 H69 A70 I74	L29-A34 HydrophobicContact CB-CB 4.13Å; L29-A34 HydrophobicContact CD2-CB 4.08Å; L29-A34 WeakPolarHBondContact O-CB 3.43Å; L29-A34 PolarHBondContact O-N 3.48Å; A34-F68 HydrophobicContact CB-CD2 4.02Å; A34-H69 CarbonylContact C-O 3.52Å; A34-H69 WeakPolarHBondContact CA-O 3.28Å; A34-H69 WeakPolarHBondContact CB-O 3.31Å; A34-A70 HydrophobicContact CB-CB 4.33Å; A34-I74 HydrophobicContact CB-CD1 3.98Å
35	V	93.4	Very high	93	Very high	88 Å²	88	71 Å²	71	53%	0.533	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	111.1	174.6	-178	0	0	0	0	108.7	F68 H69	V35-F68 CarbonylContact O-C 3.5Å; V35-F68 VanDerWaalsContact O-CA 3.26Å; V35-F68 WeakPolarHBondContact O-CA 3.46Å; V35-H69 HydrophobicContact CB-CB 4.42Å; V35-H69 PolarHBondContact N-O 3.22Å; V35-H69 PolarHBondContact O-N 3.49Å
36	V	93.9	Very high	93.1	Very high	44 Å²	44	77 Å²	77	27%	0.267	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.4	127.9	178.5	-177.6	0	0	0	0	109.7	V26 L29 I66 F68	V26-V36 HydrophobicContact CG1-CG2 4.28Å; L29-V36 HydrophobicContact CB-CG2 4.26Å; L29-V36 HydrophobicContact CD1-CG2 4.22Å; V36-I66 HydrophobicContact CG1-CG2 3.91Å; V36-F68 HydrophobicContact CG2-CB 4.4Å
37	R	92.9	Very high	93.2	Very high	149 Å²	149	76.2 Å²	76.2	56%	0.562	40%	0.397	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.5	-41	177.5	-75	-172.1	170.3	-149.5	-0.3	112.6	D67 H69	R37-D67 HydrophobicContact CB-CB 4.32Å; R37-D67 WeakPolarHBondContact CB-OD2 3.29Å; R37-D67 VanDerWaalsContact CD-OD2 3.26Å; R37-D67 WeakPolarHBondContact CD-OD2 3.48Å; R37-D67 PolarHBondContact N-O 3.26Å; R37-H69 PolarHBondContact NE-CD2 3.28Å; R37-H69 PolarHBondContact NE-NE2 3Å; R37-H69 PolarHBondContact NH2-NE2 3.26Å
38	G	92.6	Very high	93.2	Very high	34 Å²	34	76.4 Å²	76.4	35%	0.351	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-164.8	153.6	-173.6	0	0	0	0	0	112.3	D67	G38-D67 PolarHBondContact N-O 3.03Å; G38-D67 PolarHBondContact O-N 3.2Å
39	L	94.4	Very high	93.3	Very high	83 Å²	83	82 Å²	82	44%	0.435	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	122.3	173.2	-178.2	155.5	0	0	0	107.7	L22 V26 F64 L65 I66	L22-L39 HydrophobicContact CB-CD1 4.41Å; L22-L39 HydrophobicContact CD1-CD1 4.36Å; L22-L39 HydrophobicContact CD2-CD1 4.23Å; V26-L39 HydrophobicContact CG2-CD1 4.43Å; L39-F64 HydrophobicContact CD2-CD1 4.35Å; L39-L65 WeakPolarHBondContact CA-O 3.38Å; L39-I66 HydrophobicContact CD1-CD1 4.45Å; L39-I66 HydrophobicContact CD1-CG1 4.39Å; L39-I66 HydrophobicContact CG-CG1 4.33Å
40	E	95.3	Very high	93.4	Very high	113 Å²	113	87.7 Å²	87.7	53%	0.528	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	139	178.7	-171.4	176.9	177.8	0	0	110.3	L42 F64 L65	E40-L42 HydrophobicContact CG-CD2 4.37Å; E40-F64 WeakPolarHBondContact O-CA 3.48Å; E40-L65 HydrophobicContact CB-CB 4.26Å; E40-L65 PolarHBondContact N-O 3.01Å; E40-L65 PolarHBondContact O-N 3.44Å
41	N	94.7	Very high	93.5	Very high	101 Å²	101	83 Å²	83	54%	0.54	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	111.4	177.1	-179.5	3.8	0	0	0	109.6	G43 F64	N41-G43 VanDerWaalsContact C-N 3.26Å; N41-G43 WeakPolarHBondContact OD1-CA 3.49Å; N41-G43 PolarHBondContact OD1-N 3.39Å; N41-F64 HydrophobicContact CB-CD1 3.99Å; N41-F64 HydrophobicContact CB-CE1 3.72Å; N41-F64 VanDerWaalsContact CG-CE1 3.41Å; N41-F64 WeakPolarHBondContact OD1-CE1 3.5Å
42	L	93.9	Very high	93.6	Very high	66 Å²	66	79.7 Å²	79.7	35%	0.346	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.9	-1.1	178.6	-59.5	179.1	0	0	0	112.9	E40 K45 Y63 L65	E40-L42 HydrophobicContact CG-CD2 4.37Å; L42-K45 VanDerWaalsContact O-CE 3.3Å; L42-K45 WeakPolarHBondContact O-CE 3.43Å; L42-Y63 WeakPolarHBondContact CB-O 3.26Å; L42-Y63 PolarHBondContact N-O 2.99Å; L42-L65 HydrophobicContact CD1-CD1 3.92Å; L42-L65 HydrophobicContact CD1-CD2 4.19Å; L42-L65 HydrophobicContact CD1-CG 3.77Å; L42-L65 HydrophobicContact CD2-CD1 4.24Å; L42-L65 HydrophobicContact CG-CD1 4.3Å; L42-L65 HydrophobicContact CG-CG 4.18Å
43	G	92.9	Very high	93.7	Very high	26 Å²	26	77.7 Å²	77.7	27%	0.268	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	89.3	172.8	178.9	0	0	0	0	0	113.9	N41 Y63	N41-G43 VanDerWaalsContact C-N 3.26Å; N41-G43 WeakPolarHBondContact OD1-CA 3.49Å; N41-G43 PolarHBondContact OD1-N 3.39Å; G43-Y63 PolarHBondContact O-N 3.42Å
44	E	94	Very high	93.8	Very high	88 Å²	88	78.9 Å²	78.9	41%	0.411	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	124.8	173.5	-162	-163.3	134.5	0	0	109.8	A12 R60 G61	A12-E44 HydrophobicContact CB-CG 4.49Å; A12-E44 WeakPolarHBondContact CB-OE1 3.14Å; E44-R60 IonicContact OE1-CZ 3.11Å; E44-R60 IonicContact OE1-NE 2.79Å; E44-R60 PolarHBondContact OE1-NE 3Å; E44-R60 IonicContact OE1-NH2 2.71Å; E44-R60 PolarHBondContact OE1-NH2 2.64Å; E44-R60 IonicContact OE2-NH2 3.79Å; E44-G61 WeakPolarHBondContact CA-O 3.41Å
45	K	93.6	Very high	93.8	Very high	120 Å²	120	87.2 Å²	87.2	52%	0.522	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	161.8	-179.2	-60.3	177.9	-175.7	172.4	0	110.5	L42 G61 Y63	L42-K45 VanDerWaalsContact O-CE 3.3Å; L42-K45 WeakPolarHBondContact O-CE 3.43Å; K45-G61 PolarHBondContact N-O 2.84Å; K45-G61 PolarHBondContact O-N 3.01Å; K45-Y63 HydrophobicContact CB-CD2 4.13Å; K45-Y63 HydrophobicContact CB-CE2 3.81Å; K45-Y63 HydrophobicContact CG-CD2 4.49Å
46	L	94.8	Very high	93.7	Very high	128 Å²	128	87 Å²	87	67%	0.67	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.7	137.2	167.4	-72.4	161.9	0	0	0	109.2	R60	L46-R60 HydrophobicContact CD2-CG 3.48Å; L46-R60 VanDerWaalsContact CD2-CG 3.48Å; L46-R60 HydrophobicContact CG-CG 4.28Å
47	L	94.6	Very high	93.7	Very high	14 Å²	14	92.5 Å²	92.5	7%	0.073	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	143	173.9	-62.2	172.1	0	0	0	108.7	I9 Y49 I51 H58 T59 Y63	I9-L47 HydrophobicContact CG2-CD2 3.72Å; L47-Y49 VanDerWaalsContact CB-O 3.28Å; L47-Y49 WeakPolarHBondContact CB-O 3.33Å; L47-Y49 PolarHBondContact O-N 3.36Å; L47-Y49 VanDerWaalsContact O-N 3.12Å; L47-I51 HydrophobicContact CD1-CB 4.39Å; L47-I51 HydrophobicContact CD1-CD1 4.1Å; L47-I51 HydrophobicContact CD1-CG1 4.29Å; L47-I51 HydrophobicContact CD2-CD1 4.49Å; L47-H58 HydrophobicContact CD1-CB 3.82Å; L47-T59 PolarHBondContact N-O 3.33Å; L47-Y63 HydrophobicContact CD2-CE2 4.41Å
48	P	94.6	Very high	93.8	Very high	113 Å²	113	85.7 Å²	85.7	73%	0.734	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.1	-28.5	178.6	-24.8	33.5	0	0	0	113.1
49	Y	95.6	Very high	93.9	Very high	130 Å²	130	87.4 Å²	87.4	51%	0.51	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.9	164.1	174.6	60.5	-88.3	0	0	0	110.3	L47 I51 R90	L47-Y49 VanDerWaalsContact CB-O 3.28Å; L47-Y49 WeakPolarHBondContact CB-O 3.33Å; L47-Y49 PolarHBondContact O-N 3.36Å; L47-Y49 VanDerWaalsContact O-N 3.12Å; Y49-I51 HydrophobicContact CD2-CG1 3.96Å; Y49-I51 HydrophobicContact CE2-CD1 4.27Å; Y49-I51 HydrophobicContact CE2-CG1 3.56Å; Y49-I51 PolarHBondContact O-N 2.94Å; Y49-R90 PolarHBondContact OH-NH1 2.83Å
50	K	94	Very high	93.9	Very high	124 Å²	124	89.3 Å²	89.3	54%	0.539	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.6	116.8	179.8	-59.2	-177.4	179.7	175.3	0	109.9	R57 H58 T59	K50-R57 HydrophobicContact CB-CG 4.38Å; K50-H58 WeakPolarHBondContact CA-O 3.43Å; K50-T59 HydrophobicContact CD-CG2 4.41Å; K50-T59 HydrophobicContact CG-CG2 4.17Å
51	I	94.6	Very high	93.9	Very high	23 Å²	23	84 Å²	84	12%	0.118	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	133.3	177.3	-61.4	175.2	0	0	0	108.2	L47 Y49 R57 H58 V89	L47-I51 HydrophobicContact CD1-CB 4.39Å; L47-I51 HydrophobicContact CD1-CD1 4.1Å; L47-I51 HydrophobicContact CD1-CG1 4.29Å; L47-I51 HydrophobicContact CD2-CD1 4.49Å; Y49-I51 HydrophobicContact CD2-CG1 3.96Å; Y49-I51 HydrophobicContact CE2-CD1 4.27Å; Y49-I51 HydrophobicContact CE2-CG1 3.56Å; Y49-I51 PolarHBondContact O-N 2.94Å; I51-R57 CarbonylContact O-C 3.58Å; I51-H58 PolarHBondContact N-O 2.78Å; I51-H58 VanDerWaalsContact N-O 3.11Å; I51-H58 PolarHBondContact O-N 3.05Å; I51-V89 HydrophobicContact CB-CG1 4.04Å; I51-V89 HydrophobicContact CD1-CG1 4.06Å; I51-V89 HydrophobicContact CG2-CG1 3.72Å
52	S	93.7	Very high	93.9	Very high	90 Å²	90	79.4 Å²	79.4	63%	0.629	40%	0.395	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.1	115.6	171.9	-50.6	0	0	0	0	108.4	E56	S52-E56 CarbonylContact C-O 3.55Å; S52-E56 VanDerWaalsContact CA-O 3.28Å; S52-E56 WeakPolarHBondContact CA-O 3.45Å
53	K	92.3	Very high	94	Very high	43 Å²	43	78.6 Å²	78.6	19%	0.187	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	150.1	178.4	-160.1	-178.1	173.5	-137.8	0	108.6	N55 E56 V88 V89	K53-N55 PolarHBondContact O-N 2.97Å; K53-N55 VanDerWaalsContact O-N 3.11Å; K53-E56 PolarHBondContact N-O 3.06Å; K53-E56 PolarHBondContact O-N 2.8Å; K53-V88 PolarHBondContact NZ-O 2.96Å; K53-V89 WeakPolarHBondContact CD-O 3.38Å
54	H	92.3	Very high	94.2	Very high	73 Å²	73	78 Å²	78	34%	0.338	38%	0.378	S	S	.	.	T	Hydrogen-bonded Turn	trans	51.4	37.9	179.5	-55.8	-63.7	0	0	0	114.3	E56 E83 D85 I86	H54-E56 PolarHBondContact O-N 2.97Å; H54-E83 PolarHBondContact CE1-O 2.99Å; H54-D85 PolarHBondContact NE2-O 3.36Å; H54-I86 PolarHBondContact CD2-O 3.43Å
55	N	91.1	Very high	94.2	Very high	182 Å²	182	75.4 Å²	75.4	97%	0.973	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.4	17.9	-177.4	-155.5	47.4	0	0	0	115	K53	K53-N55 PolarHBondContact O-N 2.97Å; K53-N55 VanDerWaalsContact O-N 3.11Å
56	E	91.9	Very high	94.3	Very high	82 Å²	82	69.7 Å²	69.7	38%	0.383	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	149.3	175.2	-168.7	178	158.1	0	0	110.8	K11 S52 K53 H54 H58	K11-E56 WeakPolarHBondContact CE-OE1 3.3Å; K11-E56 VanDerWaalsContact CE-OE2 3.31Å; K11-E56 WeakPolarHBondContact CE-OE2 3.47Å; K11-E56 IonicContact NZ-OE1 3.65Å; K11-E56 PolarHBondContact NZ-OE1 2.8Å; K11-E56 IonicContact NZ-OE2 3.74Å; K11-E56 PolarHBondContact NZ-OE2 2.91Å; S52-E56 CarbonylContact C-O 3.55Å; S52-E56 VanDerWaalsContact CA-O 3.28Å; S52-E56 WeakPolarHBondContact CA-O 3.45Å; K53-E56 PolarHBondContact N-O 3.06Å; K53-E56 PolarHBondContact O-N 2.8Å; H54-E56 PolarHBondContact O-N 2.97Å; E56-H58 IonicContact OE1-CE1 2.66Å; E56-H58 IonicContact OE1-ND1 3.85Å; E56-H58 IonicContact OE2-CE1 3.67Å
57	R	93.8	Very high	94.3	Very high	160 Å²	160	64.7 Å²	64.7	60%	0.604	32%	0.315	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.5	109.6	177.2	-167.1	174.7	-169.2	179.2	5.4	110.2	K50 I51	K50-R57 HydrophobicContact CB-CG 4.38Å; I51-R57 CarbonylContact O-C 3.58Å
58	H	94.8	Very high	94.2	Very high	7 Å²	7	64 Å²	64	3%	0.032	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.5	130.7	-178.7	-50.8	-71.9	0	0	0	111.3	L47 K50 I51 E56 V89	L47-H58 HydrophobicContact CD1-CB 3.82Å; K50-H58 WeakPolarHBondContact CA-O 3.43Å; I51-H58 PolarHBondContact N-O 2.78Å; I51-H58 VanDerWaalsContact N-O 3.11Å; I51-H58 PolarHBondContact O-N 3.05Å; E56-H58 IonicContact OE1-CE1 2.66Å; E56-H58 IonicContact OE1-ND1 3.85Å; E56-H58 IonicContact OE2-CE1 3.67Å; H58-V89 HydrophobicContact CB-CG1 4.3Å; H58-V89 HydrophobicContact CB-CG2 4.31Å
59	T	95.3	Very high	94.1	Very high	70 Å²	70	60.2 Å²	60.2	43%	0.429	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	-23	172.8	50.9	0	0	0	0	112.4	L47 K50	L47-T59 PolarHBondContact N-O 3.33Å; K50-T59 HydrophobicContact CD-CG2 4.41Å; K50-T59 HydrophobicContact CG-CG2 4.17Å
60	R	94.7	Very high	94	Very high	123 Å²	123	54 Å²	54	46%	0.464	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	152.2	179.3	-69.8	174.7	63.2	155.8	1.5	109.2	A12 E44 L46	A12-R60 HydrophobicContact CB-CB 4.05Å; E44-R60 IonicContact OE1-CZ 3.11Å; E44-R60 IonicContact OE1-NE 2.79Å; E44-R60 PolarHBondContact OE1-NE 3Å; E44-R60 IonicContact OE1-NH2 2.71Å; E44-R60 PolarHBondContact OE1-NH2 2.64Å; E44-R60 IonicContact OE2-NH2 3.79Å; L46-R60 HydrophobicContact CD2-CG 3.48Å; L46-R60 VanDerWaalsContact CD2-CG 3.48Å; L46-R60 HydrophobicContact CG-CG 4.28Å
61	G	95	Very high	93.9	Very high	0 Å²	0	50.3 Å²	50.3	0%	0	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.6	153.3	175.5	0	0	0	0	0	112.4	V10 E44 K45	V10-G61 CarbonylContact O-C 3.58Å; V10-G61 WeakPolarHBondContact O-CA 3.41Å; E44-G61 WeakPolarHBondContact CA-O 3.41Å; K45-G61 PolarHBondContact N-O 2.84Å; K45-G61 PolarHBondContact O-N 3.01Å
62	G	95.6	Very high	93.5	Very high	6 Å²	6	53.2 Å²	53.2	6%	0.062	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.3	134.3	170.4	0	0	0	0	0	110.2	I9 V10	I9-G62 WeakPolarHBondContact CA-O 3.28Å; V10-G62 PolarHBondContact N-O 3.24Å; V10-G62 PolarHBondContact O-N 2.96Å
63	Y	95.9	Very high	93.3	Very high	48 Å²	48	51.8 Å²	51.8	19%	0.188	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	122.7	177.4	-70.7	-99	0	0	0	109.6	I9 L42 G43 K45 L47	I9-Y63 HydrophobicContact CD1-CD1 4.37Å; I9-Y63 HydrophobicContact CD1-CE1 3.77Å; I9-Y63 HydrophobicContact CG1-CD1 4.06Å; I9-Y63 HydrophobicContact CG1-CE1 3.96Å; L42-Y63 WeakPolarHBondContact CB-O 3.26Å; L42-Y63 PolarHBondContact N-O 2.99Å; G43-Y63 PolarHBondContact O-N 3.42Å; K45-Y63 HydrophobicContact CB-CD2 4.13Å; K45-Y63 HydrophobicContact CB-CE2 3.81Å; K45-Y63 HydrophobicContact CG-CD2 4.49Å; L47-Y63 HydrophobicContact CD2-CE2 4.41Å
64	F	95.9	Very high	93.1	Very high	14 Å²	14	51.4 Å²	51.4	6%	0.061	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	140.9	177.9	-66.2	-85.2	0	0	0	110.1	L8 V10 T18 L22 L39 E40 N41	L8-F64 HydrophobicContact CB-CB 4.35Å; L8-F64 PolarHBondContact N-O 2.91Å; L8-F64 PolarHBondContact O-N 3.45Å; V10-F64 HydrophobicContact CG1-CD2 4.03Å; V10-F64 HydrophobicContact CG1-CE2 4.44Å; V10-F64 HydrophobicContact CG2-CD2 3.82Å; V10-F64 HydrophobicContact CG2-CE2 3.52Å; T18-F64 HydrophobicContact CG2-CE2 3.8Å; T18-F64 HydrophobicContact CG2-CZ 3.65Å; L22-F64 HydrophobicContact CD1-CD1 3.99Å; L22-F64 HydrophobicContact CD1-CE1 3.72Å; L22-F64 HydrophobicContact CD1-CZ 4.09Å; L22-F64 HydrophobicContact CD2-CB 4.31Å; L22-F64 HydrophobicContact CD2-CD1 4.15Å; L22-F64 HydrophobicContact CD2-CD2 4.32Å; L22-F64 HydrophobicContact CD2-CG 3.99Å; L39-F64 HydrophobicContact CD2-CD1 4.35Å; E40-F64 WeakPolarHBondContact O-CA 3.48Å; N41-F64 HydrophobicContact CB-CD1 3.99Å; N41-F64 HydrophobicContact CB-CE1 3.72Å; N41-F64 VanDerWaalsContact CG-CE1 3.41Å; N41-F64 WeakPolarHBondContact OD1-CE1 3.5Å
65	L	95.3	Very high	93	Very high	34 Å²	34	48.9 Å²	48.9	18%	0.178	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	133.1	170.5	-59.2	178.3	0	0	0	108.6	L6 A7 L39 E40 L42	L6-L65 WeakPolarHBondContact O-CA 3.36Å; A7-L65 HydrophobicContact CB-CD2 3.83Å; L39-L65 WeakPolarHBondContact CA-O 3.38Å; E40-L65 HydrophobicContact CB-CB 4.26Å; E40-L65 PolarHBondContact N-O 3.01Å; E40-L65 PolarHBondContact O-N 3.44Å; L42-L65 HydrophobicContact CD1-CD1 3.92Å; L42-L65 HydrophobicContact CD1-CD2 4.19Å; L42-L65 HydrophobicContact CD1-CG 3.77Å; L42-L65 HydrophobicContact CD2-CD1 4.24Å; L42-L65 HydrophobicContact CG-CD1 4.3Å; L42-L65 HydrophobicContact CG-CG 4.18Å
66	I	94.9	Very high	92.9	Very high	0 Å²	0	44.7 Å²	44.7	0%	0	24%	0.242	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	117.4	174.5	-54.7	178.1	0	0	0	107.6	E5 L6 T25 L29 V36 L39	E5-I66 WeakPolarHBondContact CA-O 3.3Å; L6-I66 HydrophobicContact CB-CB 4.26Å; L6-I66 HydrophobicContact CD2-CD1 4.3Å; L6-I66 PolarHBondContact N-O 3.19Å; L6-I66 PolarHBondContact O-N 3.48Å; T25-I66 HydrophobicContact CG2-CD1 4.12Å; L29-I66 HydrophobicContact CD1-CG2 4.13Å; V36-I66 HydrophobicContact CG1-CG2 3.91Å; L39-I66 HydrophobicContact CD1-CD1 4.45Å; L39-I66 HydrophobicContact CD1-CG1 4.39Å; L39-I66 HydrophobicContact CG-CG1 4.33Å
67	D	94	Very high	92.8	Very high	22 Å²	22	41.9 Å²	41.9	12%	0.118	24%	0.235	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-94.9	127	176	179.2	31.6	0	0	0	109.5	R3 R37 G38	R3-D67 VanDerWaalsContact CG-OD1 3.31Å; R3-D67 WeakPolarHBondContact CG-OD1 3.26Å; R3-D67 IonicContact CZ-OD1 3.2Å; R3-D67 IonicContact CZ-OD2 3.27Å; R3-D67 VanDerWaalsContact NE-CG 3.29Å; R3-D67 IonicContact NE-OD1 3Å; R3-D67 PolarHBondContact NE-OD1 3.48Å; R3-D67 IonicContact NE-OD2 2.69Å; R3-D67 PolarHBondContact NE-OD2 2.87Å; R3-D67 IonicContact NH2-OD1 2.8Å; R3-D67 IonicContact NH2-OD2 2.64Å; R3-D67 PolarHBondContact NH2-OD2 3.48Å; R37-D67 HydrophobicContact CB-CB 4.32Å; R37-D67 WeakPolarHBondContact CB-OD2 3.29Å; R37-D67 VanDerWaalsContact CD-OD2 3.26Å; R37-D67 WeakPolarHBondContact CD-OD2 3.48Å; R37-D67 PolarHBondContact N-O 3.26Å; G38-D67 PolarHBondContact N-O 3.03Å; G38-D67 PolarHBondContact O-N 3.2Å
68	F	93.6	Very high	92.7	Very high	0 Å²	0	34.3 Å²	34.3	0%	0	21%	0.207	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-150	156.9	-175.7	68.2	-78.6	0	0	0	113.5	Y4 L6 L29 A34 V35 V36 A70 L78 V93	Y4-F68 VanDerWaalsContact CB-CZ 3.49Å; Y4-F68 HydrophobicContact CD2-CE2 4.26Å; Y4-F68 HydrophobicContact CG-CE2 4.43Å; Y4-F68 HydrophobicContact CG-CZ 4.3Å; Y4-F68 PolarHBondContact N-O 3.33Å; Y4-F68 PolarHBondContact O-N 3.11Å; Y4-F68 VanDerWaalsContact O-O 3.11Å; L6-F68 HydrophobicContact CB-CD1 4.35Å; L6-F68 HydrophobicContact CB-CE1 3.7Å; L29-F68 HydrophobicContact CD2-CD2 4.04Å; L29-F68 HydrophobicContact CD2-CE2 4.01Å; L29-F68 HydrophobicContact CD2-CG 4.37Å; L29-F68 HydrophobicContact CD2-CZ 4.34Å; A34-F68 HydrophobicContact CB-CD2 4.02Å; V35-F68 CarbonylContact O-C 3.5Å; V35-F68 VanDerWaalsContact O-CA 3.26Å; V35-F68 WeakPolarHBondContact O-CA 3.46Å; V36-F68 HydrophobicContact CG2-CB 4.4Å; F68-A70 HydrophobicContact CD2-CB 3.7Å; F68-A70 HydrophobicContact CE2-CB 3.54Å; F68-L78 HydrophobicContact CE2-CD2 4.36Å; F68-L78 HydrophobicContact CZ-CD2 4.01Å; F68-V93 HydrophobicContact CZ-CG1 4.49Å
69	H	93	Very high	92.5	Very high	34 Å²	34	36.2 Å²	36.2	16%	0.157	22%	0.217	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	135.2	166.8	-76.5	-67.8	0	0	0	111.2	M1 P2 A34 V35 R37	M1-H69 HydrophobicContact CB-CB 4.35Å; M1-H69 PolarHBondContact O-ND1 3.37Å; P2-H69 PolarHBondContact O-ND1 3.5Å; P2-H69 VanDerWaalsContact O-ND1 3.1Å; A34-H69 CarbonylContact C-O 3.52Å; A34-H69 WeakPolarHBondContact CA-O 3.28Å; A34-H69 WeakPolarHBondContact CB-O 3.31Å; V35-H69 HydrophobicContact CB-CB 4.42Å; V35-H69 PolarHBondContact N-O 3.22Å; V35-H69 PolarHBondContact O-N 3.49Å; R37-H69 PolarHBondContact NE-CD2 3.28Å; R37-H69 PolarHBondContact NE-NE2 3Å; R37-H69 PolarHBondContact NH2-NE2 3.26Å
70	A	92	Very high	92.4	Very high	0 Å²	0	36.8 Å²	36.8	0%	0	22%	0.218	C	C	.	.			trans	-148.6	153.5	-178.5	0	0	0	0	0	111.3	P2 Y4 A34 F68 I74	P2-A70 WeakPolarHBondContact CD-O 3.5Å; P2-A70 WeakPolarHBondContact CG-O 3.28Å; P2-A70 PolarHBondContact O-N 2.71Å; Y4-A70 HydrophobicContact CD2-CB 3.93Å; Y4-A70 HydrophobicContact CE2-CB 4.15Å; A34-A70 HydrophobicContact CB-CB 4.33Å; F68-A70 HydrophobicContact CD2-CB 3.7Å; F68-A70 HydrophobicContact CE2-CB 3.54Å; A70-I74 HydrophobicContact CB-CD1 3.38Å; A70-I74 HydrophobicContact CB-CG1 3.74Å
71	A	91.4	Very high	92.2	Very high	45 Å²	45	34 Å²	34	37%	0.372	21%	0.21	S	C	.	.			trans	-71.8	141.8	162.8	0	0	0	0	0	109.3	G73 I74	A71-G73 PolarHBondContact O-N 3.14Å; A71-G73 VanDerWaalsContact O-N 3.09Å; A71-I74 HydrophobicContact CB-CG2 4.42Å; A71-I74 WeakPolarHBondContact O-CG1 3.49Å; A71-I74 PolarHBondContact O-N 3.02Å; A71-I74 VanDerWaalsContact O-N 3.08Å
72	P	88.2	Confident	92.1	Very high	84 Å²	84	34 Å²	34	55%	0.545	21%	0.21	S	C	.	.	H	α-helix	trans	-58.1	-29.1	-177.3	21.4	-31.5	0	0	0	113.4	I74 V75	P72-I74 VanDerWaalsContact C-N 3.25Å; P72-I74 PolarHBondContact O-N 3.21Å; P72-V75 PolarHBondContact O-N 3.17Å
73	G	88.3	Confident	91.9	Very high	60 Å²	60	39 Å²	39	62%	0.619	23%	0.232	S	C	*	.	H	α-helix	trans	-66.2	-19	178.3	0	0	0	0	0	115.3	A71 T76	A71-G73 PolarHBondContact O-N 3.14Å; A71-G73 VanDerWaalsContact O-N 3.09Å; G73-T76 PolarHBondContact O-OG1 3.15Å
74	I	88.5	Confident	91.7	Very high	36 Å²	36	46.3 Å²	46.3	19%	0.185	26%	0.259	C	S	.	.	H	α-helix	trans	-90.2	-15.8	-178.9	82.8	-171.7	0	0	0	112.8	R32 A34 A70 A71 P72 L78	R32-I74 HydrophobicContact CB-CB 4.49Å; R32-I74 HydrophobicContact CB-CD1 4.39Å; A34-I74 HydrophobicContact CB-CD1 3.98Å; A70-I74 HydrophobicContact CB-CD1 3.38Å; A70-I74 HydrophobicContact CB-CG1 3.74Å; A71-I74 HydrophobicContact CB-CG2 4.42Å; A71-I74 WeakPolarHBondContact O-CG1 3.49Å; A71-I74 PolarHBondContact O-N 3.02Å; A71-I74 VanDerWaalsContact O-N 3.08Å; P72-I74 VanDerWaalsContact C-N 3.25Å; P72-I74 PolarHBondContact O-N 3.21Å; I74-L78 WeakPolarHBondContact O-CB 3.45Å; I74-L78 PolarHBondContact O-N 2.79Å
75	V	89.3	Confident	91.6	Very high	19 Å²	19	46.8 Å²	46.8	12%	0.115	26%	0.262	C	S	.	.	H	α-helix	trans	-66.6	-41.7	-174.2	178.1	0	0	0	0	111.4	Y4 P72 L78 L79 V93	Y4-V75 HydrophobicContact CD2-CG2 4.27Å; Y4-V75 HydrophobicContact CE1-CG2 4.29Å; Y4-V75 HydrophobicContact CE2-CG2 3.87Å; P72-V75 PolarHBondContact O-N 3.17Å; V75-L78 WeakPolarHBondContact O-CB 3.28Å; V75-L78 PolarHBondContact O-N 3Å; V75-L79 HydrophobicContact CG1-CD1 4.23Å; V75-L79 WeakPolarHBondContact O-CG 3.32Å; V75-L79 PolarHBondContact O-N 3.32Å; V75-V93 HydrophobicContact CG1-CB 4.3Å; V75-V93 HydrophobicContact CG1-CG1 3.84Å; V75-V93 HydrophobicContact CG1-CG2 4.42Å
76	T	89.6	Confident	91.5	Very high	94 Å²	94	50.3 Å²	50.3	58%	0.577	28%	0.28	S	S	*	.	H	α-helix	trans	-61.7	-51.1	178.1	49.1	0	0	0	0	111	G73 L78 L79 D80	G73-T76 PolarHBondContact O-OG1 3.15Å; T76-L78 PolarHBondContact O-N 3.1Å; T76-L79 PolarHBondContact O-N 3.38Å; T76-D80 PolarHBondContact O-N 2.85Å
77	G	90.1	Very high	91.4	Very high	23 Å²	23	51.7 Å²	51.7	24%	0.237	29%	0.287	C	S	.	.	H	α-helix	trans	-61.5	-34.7	177.3	0	0	0	0	0	112.3	R32 D80 H81	R32-G77 PolarHBondContact NH1-O 2.73Å; G77-D80 PolarHBondContact O-N 2.91Å; G77-H81 PolarHBondContact O-N 2.93Å; G77-H81 VanDerWaalsContact O-N 3.14Å
78	L	90.9	Very high	91.4	Very high	1 Å²	1	50.7 Å²	50.7	1%	0.005	28%	0.282	C	S	.	.	H	α-helix	trans	-64.8	-46	178.4	174.7	70.8	0	0	0	110.6	L29 F68 I74 V75 T76 D80 H81 L82	L29-L78 HydrophobicContact CD2-CD1 3.67Å; L29-L78 HydrophobicContact CD2-CD2 3.44Å; L29-L78 VanDerWaalsContact CD2-CD2 3.44Å; L29-L78 HydrophobicContact CD2-CG 4.17Å; L29-L78 HydrophobicContact CG-CD1 4.02Å; F68-L78 HydrophobicContact CE2-CD2 4.36Å; F68-L78 HydrophobicContact CZ-CD2 4.01Å; I74-L78 WeakPolarHBondContact O-CB 3.45Å; I74-L78 PolarHBondContact O-N 2.79Å; V75-L78 WeakPolarHBondContact O-CB 3.28Å; V75-L78 PolarHBondContact O-N 3Å; T76-L78 PolarHBondContact O-N 3.1Å; L78-D80 VanDerWaalsContact C-N 3.33Å; L78-D80 PolarHBondContact O-N 3.39Å; L78-H81 WeakPolarHBondContact O-CB 3.47Å; L78-H81 PolarHBondContact O-N 3.31Å; L78-L82 HydrophobicContact CD1-CD1 4.24Å; L78-L82 HydrophobicContact CD1-CG 4.43Å; L78-L82 HydrophobicContact CG-CD1 4.02Å; L78-L82 WeakPolarHBondContact O-CG 3.35Å; L78-L82 PolarHBondContact O-N 3.28Å
79	L	91.3	Very high	91.4	Very high	47 Å²	47	50.8 Å²	50.8	25%	0.246	28%	0.283	C	S	.	.	H	α-helix	trans	-58.3	-46.1	175.2	-72.7	169.2	0	0	0	110.9	V75 T76 H81 L82 E83 V93	V75-L79 HydrophobicContact CG1-CD1 4.23Å; V75-L79 WeakPolarHBondContact O-CG 3.32Å; V75-L79 PolarHBondContact O-N 3.32Å; T76-L79 PolarHBondContact O-N 3.38Å; L79-H81 PolarHBondContact O-N 3.39Å; L79-L82 PolarHBondContact O-N 2.82Å; L79-L82 VanDerWaalsContact O-N 3.15Å; L79-E83 WeakPolarHBondContact O-CB 3.32Å; L79-E83 WeakPolarHBondContact O-CG 3.12Å; L79-E83 PolarHBondContact O-N 2.96Å; L79-V93 HydrophobicContact CD2-CB 4.35Å; L79-V93 HydrophobicContact CD2-CG2 3.66Å; L79-V93 HydrophobicContact CG-CG2 4.13Å
80	D	92.1	Very high	91.5	Very high	83 Å²	83	54.6 Å²	54.6	44%	0.444	30%	0.296	S	S	.	.	H	α-helix	trans	-58.7	-33.9	177.3	-65.9	-22.9	0	0	0	113	T76 G77 L78 R84	T76-D80 PolarHBondContact O-N 2.85Å; G77-D80 PolarHBondContact O-N 2.91Å; L78-D80 VanDerWaalsContact C-N 3.33Å; L78-D80 PolarHBondContact O-N 3.39Å; D80-R84 WeakPolarHBondContact O-CD 3.38Å; D80-R84 VanDerWaalsContact O-CG 3.3Å; D80-R84 WeakPolarHBondContact O-CG 3.47Å; D80-R84 PolarHBondContact O-NE 2.98Å
81	H	92.3	Very high	91.6	Very high	64 Å²	64	55.6 Å²	55.6	30%	0.296	30%	0.302	S	S	.	.	H	α-helix	trans	-72.3	-46.7	176.5	177.1	78.7	0	0	0	111.7	T28 G77 L78 L79 E83 R84 D85	T28-H81 PolarHBondContact OG1-NE2 3.39Å; G77-H81 PolarHBondContact O-N 2.93Å; G77-H81 VanDerWaalsContact O-N 3.14Å; L78-H81 WeakPolarHBondContact O-CB 3.47Å; L78-H81 PolarHBondContact O-N 3.31Å; L79-H81 PolarHBondContact O-N 3.39Å; H81-E83 VanDerWaalsContact C-N 3.29Å; H81-E83 PolarHBondContact O-N 3.5Å; H81-R84 PolarHBondContact O-N 3.27Å; H81-D85 PolarHBondContact O-N 3.01Å
82	L	92.1	Very high	91.7	Very high	0 Å²	0	55.9 Å²	55.9	0%	0	30%	0.299	C	S	.	.	H	α-helix	trans	-68.7	-27.3	179.4	-66.4	172.2	0	0	0	112.9	L6 L8 T25 L78 L79 R84 V88 P91	L6-L82 HydrophobicContact CD1-CD1 3.78Å; L6-L82 HydrophobicContact CD2-CD1 3.82Å; L6-L82 HydrophobicContact CG-CD1 4.47Å; L8-L82 HydrophobicContact CD1-CD2 4.27Å; T25-L82 HydrophobicContact CG2-CD2 3.97Å; L78-L82 HydrophobicContact CD1-CD1 4.24Å; L78-L82 HydrophobicContact CD1-CG 4.43Å; L78-L82 HydrophobicContact CG-CD1 4.02Å; L78-L82 WeakPolarHBondContact O-CG 3.35Å; L78-L82 PolarHBondContact O-N 3.28Å; L79-L82 PolarHBondContact O-N 2.82Å; L79-L82 VanDerWaalsContact O-N 3.15Å; L82-R84 VanDerWaalsContact C-N 3.31Å; L82-V88 HydrophobicContact CD2-CG2 4.36Å; L82-P91 HydrophobicContact CB-CB 3.79Å; L82-P91 HydrophobicContact CB-CG 3.96Å; L82-P91 HydrophobicContact CD1-CB 3.9Å; L82-P91 HydrophobicContact CG-CB 4.48Å
83	E	91.6	Very high	91.9	Very high	112 Å²	112	53.5 Å²	53.5	52%	0.523	28%	0.283	S	S	.	.	H	α-helix	trans	-69.8	-29.3	174.8	-78.8	-173.7	175.7	0	0	112.8	H54 L79 H81 P91	H54-E83 PolarHBondContact CE1-O 2.99Å; L79-E83 WeakPolarHBondContact O-CB 3.32Å; L79-E83 WeakPolarHBondContact O-CG 3.12Å; L79-E83 PolarHBondContact O-N 2.96Å; H81-E83 VanDerWaalsContact C-N 3.29Å; H81-E83 PolarHBondContact O-N 3.5Å; E83-P91 HydrophobicContact CG-CG 4.33Å
84	R	92.4	Very high	92.1	Very high	200 Å²	200	54.4 Å²	54.4	76%	0.755	27%	0.273	S	S	*	.	H	α-helix	trans	-83.8	-19.4	177.8	-66.3	172.1	-166.4	-169.2	3.8	113.3	D80 H81 L82 I86	D80-R84 WeakPolarHBondContact O-CD 3.38Å; D80-R84 VanDerWaalsContact O-CG 3.3Å; D80-R84 WeakPolarHBondContact O-CG 3.47Å; D80-R84 PolarHBondContact O-NE 2.98Å; H81-R84 PolarHBondContact O-N 3.27Å; L82-R84 VanDerWaalsContact C-N 3.31Å; R84-I86 PolarHBondContact O-N 3.44Å
85	D	93.1	Very high	92.2	Very high	24 Å²	24	58.5 Å²	58.5	13%	0.128	29%	0.29	C	S	.	.			trans	-71.9	120	178.6	-167.3	-19.4	0	0	0	110.8	H54 H81 D87 V88	H54-D85 PolarHBondContact NE2-O 3.36Å; H81-D85 PolarHBondContact O-N 3.01Å; D85-D87 PolarHBondContact O-N 3.01Å; D85-D87 PolarHBondContact OD1-N 2.79Å; D85-V88 HydrophobicContact CB-CB 4.31Å; D85-V88 HydrophobicContact CB-CG2 3.85Å; D85-V88 PolarHBondContact O-N 3.2Å
86	I	92.1	Very high	91.9	Very high	108 Å²	108	59.5 Å²	59.5	55%	0.554	30%	0.295	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.9	-27.3	-177	57.7	171.8	0	0	0	113.1	H54 R84 V88	H54-I86 PolarHBondContact CD2-O 3.43Å; R84-I86 PolarHBondContact O-N 3.44Å; I86-V88 VanDerWaalsContact C-N 3.32Å
87	D	93.5	Very high	91.1	Very high	30 Å²	30	59.8 Å²	59.8	16%	0.16	29%	0.292	C	S	.	.	T	Hydrogen-bonded Turn	trans	-86.6	-11	-175.1	-65.7	-32.1	0	0	0	111.4	K11 M13 L21 D85	K11-D87 PolarHBondContact N-O 3.03Å; M13-D87 HydrophobicContact CE-CB 3.82Å; M13-D87 HydrophobicContact SD-CB 4.12Å; L21-D87 HydrophobicContact CD1-CB 3.24Å; D85-D87 PolarHBondContact O-N 3.01Å; D85-D87 PolarHBondContact OD1-N 2.79Å
88	V	94.4	Very high	90	Very high	0 Å²	0	64 Å²	64	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	116.8	175.2	-179.5	0	0	0	0	110	L8 L21 K53 L82 D85 I86 P91	L8-V88 HydrophobicContact CD1-CG1 3.76Å; L8-V88 HydrophobicContact CD1-CG2 4.13Å; L21-V88 HydrophobicContact CD1-CG2 3.86Å; K53-V88 PolarHBondContact NZ-O 2.96Å; L82-V88 HydrophobicContact CD2-CG2 4.36Å; D85-V88 HydrophobicContact CB-CB 4.31Å; D85-V88 HydrophobicContact CB-CG2 3.85Å; D85-V88 PolarHBondContact O-N 3.2Å; I86-V88 VanDerWaalsContact C-N 3.32Å; V88-P91 HydrophobicContact CG1-CB 4.19Å; V88-P91 HydrophobicContact CG1-CG 4.25Å
89	V	94.1	Very high	88.7	Confident	3 Å²	3	71.5 Å²	71.5	2%	0.018	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.8	-41.8	176.6	179.6	0	0	0	0	111	I9 K11 I51 K53 H58	I9-V89 HydrophobicContact CB-CB 4.5Å; I9-V89 HydrophobicContact CG2-CB 4.1Å; I9-V89 HydrophobicContact CG2-CG1 4.44Å; I9-V89 WeakPolarHBondContact O-CA 3.18Å; I9-V89 WeakPolarHBondContact O-CB 3.31Å; I9-V89 PolarHBondContact O-N 3.48Å; K11-V89 HydrophobicContact CB-CG2 4.17Å; I51-V89 HydrophobicContact CB-CG1 4.04Å; I51-V89 HydrophobicContact CD1-CG1 4.06Å; I51-V89 HydrophobicContact CG2-CG1 3.72Å; K53-V89 WeakPolarHBondContact CD-O 3.38Å; H58-V89 HydrophobicContact CB-CG1 4.3Å; H58-V89 HydrophobicContact CB-CG2 4.31Å
90	R	93.4	Very high	87.2	Confident	114 Å²	114	74.8 Å²	74.8	43%	0.43	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.5	112.9	178.3	-170.5	175.5	-177	163.5	2.3	111.1	I9 Y49	I9-R90 HydrophobicContact CB-CB 4.11Å; I9-R90 HydrophobicContact CD1-CB 4.16Å; I9-R90 HydrophobicContact CG1-CB 4.33Å; I9-R90 PolarHBondContact N-O 3.09Å; I9-R90 PolarHBondContact O-N 3.08Å; I9-R90 VanDerWaalsContact O-N 3.11Å; Y49-R90 PolarHBondContact OH-NH1 2.83Å
91	P	94.3	Very high	85.6	Confident	21 Å²	21	76 Å²	76	14%	0.136	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	138.4	166.5	33.3	-28.8	0	0	0	110	L6 L8 L82 E83 V88	L6-P91 HydrophobicContact CD1-CB 4.46Å; L8-P91 HydrophobicContact CD1-CB 4.42Å; L82-P91 HydrophobicContact CB-CB 3.79Å; L82-P91 HydrophobicContact CB-CG 3.96Å; L82-P91 HydrophobicContact CD1-CB 3.9Å; L82-P91 HydrophobicContact CG-CB 4.48Å; E83-P91 HydrophobicContact CG-CG 4.33Å; V88-P91 HydrophobicContact CG1-CB 4.19Å; V88-P91 HydrophobicContact CG1-CG 4.25Å
92	T	93.9	Very high	84.3	Confident	50 Å²	50	80 Å²	80	31%	0.307	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	120.5	171.3	-55.4	0	0	0	0	108.9	L6 A7 L94	L6-T92 WeakPolarHBondContact CA-O 3.33Å; A7-T92 PolarHBondContact N-O 2.97Å; A7-T92 PolarHBondContact O-N 2.71Å; T92-L94 HydrophobicContact CG2-CD1 4.02Å; T92-L94 HydrophobicContact CG2-CG 4.24Å
93	V	93	Very high	83	Confident	34 Å²	34	82 Å²	82	21%	0.206	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	126.6	174.2	177.3	0	0	0	0	108.9	Y4 E5 L6 F68 V75 L79	Y4-V93 HydrophobicContact CD1-CG1 3.97Å; Y4-V93 HydrophobicContact CG-CG1 4.35Å; E5-V93 CarbonylContact O-C 3.52Å; E5-V93 WeakPolarHBondContact O-CA 3.39Å; L6-V93 HydrophobicContact CD1-CG2 3.72Å; F68-V93 HydrophobicContact CZ-CG1 4.49Å; V75-V93 HydrophobicContact CG1-CB 4.3Å; V75-V93 HydrophobicContact CG1-CG1 3.84Å; V75-V93 HydrophobicContact CG1-CG2 4.42Å; L79-V93 HydrophobicContact CD2-CB 4.35Å; L79-V93 HydrophobicContact CD2-CG2 3.66Å; L79-V93 HydrophobicContact CG-CG2 4.13Å
94	L	92.1	Very high	81.9	Confident	80 Å²	80	82.3 Å²	82.3	42%	0.419	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	145.2	175.9	-60.1	113.7	0	0	0	109.2	Y4 E5 A7 T92	Y4-L94 CarbonylContact C-O 3.59Å; Y4-L94 VanDerWaalsContact CA-O 3.27Å; Y4-L94 WeakPolarHBondContact CA-O 3.25Å; E5-L94 HydrophobicContact CB-CB 4.43Å; E5-L94 PolarHBondContact N-O 3.3Å; E5-L94 PolarHBondContact O-N 3.33Å; A7-L94 HydrophobicContact CB-CD1 3.98Å; T92-L94 HydrophobicContact CG2-CD1 4.02Å; T92-L94 HydrophobicContact CG2-CG 4.24Å
95	K	89.8	Confident	80.7	Confident	122 Å²	122	78 Å²	78	53%	0.53	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.7	119.7	170.1	-170.9	-175.9	178.3	-134.9	0	107.6	Y4 D97	Y4-K95 HydrophobicContact CD1-CB 4.33Å; Y4-K95 HydrophobicContact CE1-CB 4.28Å; Y4-K95 HydrophobicContact CE1-CG 4.25Å; K95-D97 VanDerWaalsContact C-N 3.35Å; K95-D97 VanDerWaalsContact CE-OD1 3.23Å; K95-D97 WeakPolarHBondContact CE-OD1 3.35Å; K95-D97 IonicContact NZ-OD1 3.8Å; K95-D97 PolarHBondContact NZ-OD1 3.03Å; K95-D97 IonicContact NZ-OD2 3.82Å; K95-D97 PolarHBondContact O-N 3.22Å; K95-D97 VanDerWaalsContact O-N 3.13Å
96	N	83.7	Confident	79.6	Confident	40 Å²	40	83.7 Å²	83.7	21%	0.214	49%	0.485	C	S	.	.			trans	-83.6	88.1	171.5	-98.1	-8.4	0	0	0	107.6	R3 E5	R3-N96 HydrophobicContact CB-CB 4.09Å; R3-N96 HydrophobicContact CG-CB 3.86Å; R3-N96 PolarHBondContact O-N 3.41Å; E5-N96 PolarHBondContact OE2-ND2 3.12Å; E5-N96 PolarHBondContact OE2-OD1 3.47Å
97	D	73.3	Confident	78	Confident	99 Å²	99	81.7 Å²	81.7	53%	0.529	49%	0.492	S	S	.	.			trans	-65.7	131.6	164.3	-73.2	-45.9	0	0	0	107.5	K95 E99	K95-D97 VanDerWaalsContact C-N 3.35Å; K95-D97 VanDerWaalsContact CE-OD1 3.23Å; K95-D97 WeakPolarHBondContact CE-OD1 3.35Å; K95-D97 IonicContact NZ-OD1 3.8Å; K95-D97 PolarHBondContact NZ-OD1 3.03Å; K95-D97 IonicContact NZ-OD2 3.82Å; K95-D97 PolarHBondContact O-N 3.22Å; K95-D97 VanDerWaalsContact O-N 3.13Å; D97-E99 PolarHBondContact O-N 3.46Å
98	P	67.4	Low	76.2	Confident	112 Å²	112	88 Å²	88	73%	0.727	52%	0.52	S	S	*	.			trans	-54.3	129.8	171.8	25.2	-31.8	0	0	0	106.7	P100	P98-P100 VanDerWaalsContact O-N 3.15Å
99	E	63.1	Low	74.2	Confident	159 Å²	159	94 Å²	94	74%	0.743	56%	0.559	S	S	*	*			trans	-45.7	129.7	177.5	-63.7	-158.8	161.6	0	0	107.8	D97 S101	D97-E99 PolarHBondContact O-N 3.46Å; E99-S101 PolarHBondContact O-N 3.37Å
100	P	59.4	Low	72.5	Confident	115 Å²	115	99.9 Å²	99.9	75%	0.747	59%	0.594	S	S	*	*			trans	-52.3	120.6	173.7	23	-31	0	0	0	105.1	P98 N102	P98-P100 VanDerWaalsContact O-N 3.15Å; P100-N102 PolarHBondContact O-N 2.98Å
101	S	59.3	Low	70.5	Confident	110 Å²	110	98.8 Å²	98.8	77%	0.769	61%	0.61	S	S	*	*			trans	-37	119.9	176.6	53.8	0	0	0	0	106.4	E99 G103	E99-S101 PolarHBondContact O-N 3.37Å; S101-G103 PolarHBondContact O-N 2.78Å
102	N	63.2	Low	68.5	Low	147 Å²	147	102.8 Å²	102.8	79%	0.786	64%	0.638	S	S	*	*			trans	-49.8	83.6	-177.5	-82.8	-46.5	0	0	0	108.9	P100	P100-N102 PolarHBondContact O-N 2.98Å
103	G	66.4	Low	65.9	Low	43 Å²	43	110.3 Å²	110.3	44%	0.443	67%	0.666	S	S	.	*			trans	-68.7	145.6	174	0	0	0	0	0	104	S101 C105	S101-G103 PolarHBondContact O-N 2.78Å; G103-C105 VanDerWaalsContact C-N 3.3Å; G103-C105 PolarHBondContact O-N 3.23Å
104	P	68.2	Low	63.6	Low	118 Å²	118	116.9 Å²	116.9	77%	0.766	69%	0.694	S	S	*	*			trans	-56.7	101.8	175.2	22.6	-30.6	0	0	0	108.1	C106	P104-C106 PolarHBondContact O-N 2.88Å
105	C	66.8	Low	61.3	Low	109 Å²	109	121.6 Å²	121.6	74%	0.736	71%	0.714	S	S	*	*			trans	-55.9	125.9	161.4	-79.1	0	0	0	0	105.1	G103 G107 H108	G103-C105 VanDerWaalsContact C-N 3.3Å; G103-C105 PolarHBondContact O-N 3.23Å; C105-G107 VanDerWaalsContact C-N 3.31Å; C105-G107 PolarHBondContact O-N 2.96Å; C105-H108 PolarHBondContact O-N 3.07Å
106	C	69.4	Low	58.9	Low	143 Å²	143	123.3 Å²	123.3	97%	0.966	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.8	92.2	-176.7	-48.5	0	0	0	0	109.5	P104	P104-C106 PolarHBondContact O-N 2.88Å
107	G	59.1	Low	57.1	Low	67 Å²	67	127.2 Å²	127.2	69%	0.691	76%	0.755	S	S	*	*	T	Hydrogen-bonded Turn	trans	147.1	-11.2	174.9	0	0	0	0	0	119.1	C105	C105-G107 VanDerWaalsContact C-N 3.31Å; C105-G107 PolarHBondContact O-N 2.96Å
108	H	55.9	Low	55.9	Low	163 Å²	163	132.5 Å²	132.5	76%	0.755	79%	0.79	S	S	*	*			trans	-131.9	123.7	179.1	-84.4	-16.4	0	0	0	114.2	C105 V110	C105-H108 PolarHBondContact O-N 3.07Å; H108-V110 PolarHBondContact O-N 3.19Å
109	P	53.2	Low	55.4	Low	125 Å²	125	133.5 Å²	133.5	81%	0.812	79%	0.793	S	S	*	*			trans	-72.3	113	168.7	28.9	-29.2	0	0	0	108.8	A111	P109-A111 PolarHBondContact O-N 2.81Å
110	V	57.7	Low	55	Low	127 Å²	127	132.2 Å²	132.2	77%	0.77	80%	0.796	S	S	*	*			trans	-73.7	106.9	170.3	-177.3	0	0	0	0	107.3	H108 S112	H108-V110 PolarHBondContact O-N 3.19Å; V110-S112 PolarHBondContact O-N 3.45Å; V110-S112 VanDerWaalsContact O-N 3.09Å
111	A	51.9	Low	54.7	Low	91 Å²	91	133.1 Å²	133.1	75%	0.752	80%	0.799	S	S	*	*			trans	-67.7	104.8	171.5	0	0	0	0	0	109	P109 K113	P109-A111 PolarHBondContact O-N 2.81Å; A111-K113 PolarHBondContact O-N 3Å
112	S	51	Low	54.4	Low	104 Å²	104	134.5 Å²	134.5	73%	0.727	80%	0.8	S	S	*	*			trans	-61.9	113.4	169.5	52.2	0	0	0	0	109	V110 H114	V110-S112 PolarHBondContact O-N 3.45Å; V110-S112 VanDerWaalsContact O-N 3.09Å; S112-H114 PolarHBondContact O-N 3.23Å
113	K	40.8	Very low	53.9	Low	208 Å²	208	133.7 Å²	133.7	90%	0.904	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-62.5	124.3	169.1	-79.5	-174.9	176	-174.4	0	108.7	A111	A111-K113 PolarHBondContact O-N 3Å
114	H	44.3	Very low	53.1	Low	172 Å²	172	139.7 Å²	139.7	80%	0.796	83%	0.825	S	S	*	*	P	Polyproline II helix	trans	-50.8	140	175.6	-89.6	-91.7	0	0	0	112.2	S112 D116	S112-H114 PolarHBondContact O-N 3.23Å; H114-D116 PolarHBondContact O-N 2.85Å
115	Q	43.9	Very low	52	Low	179 Å²	179	141.3 Å²	141.3	84%	0.836	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-56.2	121.2	156.3	-112.2	114.2	0.9	0	0	109.2
116	D	38.8	Very low	50.8	Low	158 Å²	158	143.8 Å²	143.8	85%	0.845	84%	0.837	S	S	*	*			trans	-100.9	104.9	158.8	-76.1	-50.3	0	0	0	108.5	H114	H114-D116 PolarHBondContact O-N 2.85Å
117	T	45.9	Very low	49.3	Very low	122 Å²	122	143.8 Å²	143.8	75%	0.748	83%	0.826	S	S	*	*			trans	-69.6	135.7	161.4	-56.2	0	0	0	0	109.3
118	V	49.2	Very low	48.4	Very low	210 Å²	210	150.8 Å²	150.8	100%	1.273	84%	0.838	S	S	*	*			trans	-135.6	0	143.8	-176.6	0	0	0	0	108.3

Retrieved 118 of 118 residues in 365.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).