A0A060YA56_ONCMY Loading...

Transmembrane protein 250

AlphaFold DB , UniProt , Accession A0A060YA56, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110509824, Length 139 aa.

						>A0A060YA56_ONCMY|A0A060YA56|LOC110509824
MPVIPIPRRVRSFHGPHSTCMHSACGSAHTTQLVRTKYNNFDLYLRSRCMYGFLRFLLYFGCSLLTSLLWVALSALFCLQYMSARVFLRLQYKLSVILLLLGHRRLDFGVLNNLFIYSMQVTMFLVGGLGWCFMVFVDM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.3	Very low	51.1	Low	230 Å²	230	163.3 Å²	163.3	100%	1.133	82%	0.819	S	S	*	*				0	120.7	0	-69.9	177.7	168.3	0	0	107.9	V3	M1-V3 PolarHBondContact O-N 3Å
2	P	46.7	Very low	51.1	Low	128 Å²	128	156.3 Å²	156.3	83%	0.831	80%	0.797	S	S	*	*			trans	-74.1	123.9	179.6	28.8	-30.4	0	0	0	110.2	I4	P2-I4 PolarHBondContact O-N 3.3Å
3	V	54.8	Low	51	Low	138 Å²	138	159.5 Å²	159.5	84%	0.836	80%	0.802	S	S	*	*			trans	-78.6	110.4	177	175.8	0	0	0	0	108.2	M1 P5	M1-V3 PolarHBondContact O-N 3Å; V3-P5 WeakPolarHBondContact O-CD 3.4Å
4	I	54.4	Low	51.1	Low	147 Å²	147	157.9 Å²	157.9	75%	0.754	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-78.6	119.5	172.2	-61.2	163.9	0	0	0	107.3	P2 I6	P2-I4 PolarHBondContact O-N 3.3Å; I4-I6 PolarHBondContact O-N 3.31Å
5	P	57.9	Low	51.6	Low	112 Å²	112	149.9 Å²	149.9	73%	0.727	76%	0.763	S	S	*	*	P	Polyproline II helix	trans	-72.5	120.6	175.9	27.4	-30	0	0	0	109.9	V3	V3-P5 WeakPolarHBondContact O-CD 3.4Å
6	I	49.6	Very low	51.3	Low	152 Å²	152	149.1 Å²	149.1	78%	0.779	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-62.1	124.9	171.3	-60.4	165.2	0	0	0	107.9	I4 R8	I4-I6 PolarHBondContact O-N 3.31Å; I6-R8 PolarHBondContact O-N 3.44Å
7	P	48.1	Very low	51.1	Low	117 Å²	117	146.6 Å²	146.6	76%	0.76	76%	0.756	S	S	*	*			trans	-65.5	107.8	176.9	24.4	-30.5	0	0	0	109.3	R9	P7-R9 PolarHBondContact O-N 3.46Å; P7-R9 VanDerWaalsContact O-N 3.08Å
8	R	53.3	Low	51.1	Low	231 Å²	231	144.3 Å²	144.3	87%	0.872	75%	0.754	S	S	*	*			trans	-59.2	113.3	168.5	-73.8	-174.4	-175.6	-173.2	1.9	107.3	I6 V10	I6-R8 PolarHBondContact O-N 3.44Å; R8-V10 PolarHBondContact O-N 3.36Å
9	R	51.8	Low	51.1	Low	214 Å²	214	142.2 Å²	142.2	81%	0.808	75%	0.748	S	S	*	*			trans	-60	89	166.8	-88	-176.8	176.1	169.8	0.8	108.7	P7 R11	P7-R9 PolarHBondContact O-N 3.46Å; P7-R9 VanDerWaalsContact O-N 3.08Å; R9-R11 PolarHBondContact O-N 3.18Å
10	V	48.9	Very low	51	Low	121 Å²	121	139.8 Å²	139.8	73%	0.733	74%	0.743	S	S	*	*			trans	-74.4	86.2	157.4	-175.7	0	0	0	0	105.4	R8 S12	R8-V10 PolarHBondContact O-N 3.36Å; V10-S12 PolarHBondContact O-N 2.84Å
11	R	52.5	Low	50.7	Low	206 Å²	206	141 Å²	141	78%	0.777	75%	0.746	S	S	*	*			trans	-75.2	82.3	158.6	-83.3	-173.7	174.2	172.3	-2.7	106.2	R9 F13	R9-R11 PolarHBondContact O-N 3.18Å; R11-F13 PolarHBondContact O-N 3.26Å
12	S	51.5	Low	50.9	Low	79 Å²	79	137.8 Å²	137.8	55%	0.552	73%	0.728	S	S	*	*			trans	-60.9	107.9	158.4	39.3	0	0	0	0	106.6	V10 H14	V10-S12 PolarHBondContact O-N 2.84Å; S12-H14 VanDerWaalsContact C-N 3.26Å; S12-H14 PolarHBondContact O-N 3.45Å
13	F	49.1	Very low	50.9	Low	198 Å²	198	136.6 Å²	136.6	87%	0.868	72%	0.723	S	S	*	*			trans	-67	89.1	175.1	-157.1	-91.4	0	0	0	107.6	R11 G15	R11-F13 PolarHBondContact O-N 3.26Å; F13-G15 PolarHBondContact O-N 3.32Å
14	H	52.4	Low	50.4	Low	138 Å²	138	134.2 Å²	134.2	64%	0.639	72%	0.717	S	S	*	*			trans	-81.2	108.2	165.2	-82.3	-9.1	0	0	0	107.4	S12 H17	S12-H14 VanDerWaalsContact C-N 3.26Å; S12-H14 PolarHBondContact O-N 3.45Å; H14-H17 WeakPolarHBondContact CB-NE2 3.36Å; H14-H17 AromaticContact CD2-CE1 4Å; H14-H17 AromaticContact CD2-NE2 3.44Å; H14-H17 PolarHBondContact CD2-NE2 2.99Å; H14-H17 AromaticContact CG-NE2 3.57Å
15	G	58	Low	49.9	Very low	37 Å²	37	132.5 Å²	132.5	38%	0.381	72%	0.717	S	S	.	*			trans	-54.4	168.1	168.6	0	0	0	0	0	111.3	F13 H17	F13-G15 PolarHBondContact O-N 3.32Å; G15-H17 PolarHBondContact O-N 3.29Å
16	P	47.7	Very low	49.1	Very low	138 Å²	138	130.1 Å²	130.1	90%	0.896	71%	0.713	S	S	*	*			trans	-59.5	109.9	-169.5	24.9	-32.6	0	0	0	110.2	S18	P16-S18 PolarHBondContact O-N 3.03Å
17	H	47.9	Very low	48.9	Very low	107 Å²	107	128.8 Å²	128.8	50%	0.495	72%	0.717	S	S	.	*			trans	-63.2	127.6	173	-71	-88	0	0	0	108.3	H14 G15 T19 C20	H14-H17 WeakPolarHBondContact CB-NE2 3.36Å; H14-H17 AromaticContact CD2-CE1 4Å; H14-H17 AromaticContact CD2-NE2 3.44Å; H14-H17 PolarHBondContact CD2-NE2 2.99Å; H14-H17 AromaticContact CG-NE2 3.57Å; G15-H17 PolarHBondContact O-N 3.29Å; H17-T19 WeakPolarHBondContact CB-OG1 3.47Å; H17-T19 PolarHBondContact O-N 2.72Å; H17-C20 PolarHBondContact O-N 3.07Å
18	S	50.2	Low	48.5	Very low	105 Å²	105	127.7 Å²	127.7	73%	0.734	72%	0.718	S	S	*	*	G	3₁₀ helix	trans	-56.2	-5.1	175.1	46.6	0	0	0	0	114.2	P16	P16-S18 PolarHBondContact O-N 3.03Å
19	T	51.6	Low	47.9	Very low	104 Å²	104	124.6 Å²	124.6	64%	0.638	71%	0.713	S	S	*	*	G	3₁₀ helix	trans	-83.4	-13.8	-176.3	53	0	0	0	0	114.3	H17	H17-T19 WeakPolarHBondContact CB-OG1 3.47Å; H17-T19 PolarHBondContact O-N 2.72Å
20	C	49.3	Very low	47.6	Very low	94 Å²	94	120.4 Å²	120.4	64%	0.635	71%	0.711	S	S	*	*	G	3₁₀ helix	trans	-87.2	-8.5	178	-63.4	0	0	0	0	114.7	H17 S23	H17-C20 PolarHBondContact O-N 3.07Å; C20-S23 PolarHBondContact O-OG 3.29Å; C20-S23 VanDerWaalsContact O-OG 3.13Å
21	M	45.8	Very low	47.1	Very low	165 Å²	165	120.2 Å²	120.2	81%	0.813	71%	0.711	S	S	*	*	S	Bend	trans	-76.3	-26.9	177.5	-87.7	-87.1	-153.9	0	0	112.6
22	H	46.9	Very low	46.9	Very low	163 Å²	163	120 Å²	120	76%	0.755	72%	0.718	S	S	*	*	G	3₁₀ helix	trans	-79.5	-21.5	-177.7	-85.3	-61.2	0	0	0	114	A24	H22-A24 VanDerWaalsContact C-N 3.33Å; H22-A24 PolarHBondContact O-N 3.38Å
23	S	47.9	Very low	46.5	Very low	103 Å²	103	123.6 Å²	123.6	72%	0.72	73%	0.731	S	S	*	*	G	3₁₀ helix	trans	-80	-8.5	179.6	41	0	0	0	0	114.6	C20	C20-S23 PolarHBondContact O-OG 3.29Å; C20-S23 VanDerWaalsContact O-OG 3.13Å
24	A	44.2	Very low	46.3	Very low	88 Å²	88	119.8 Å²	119.8	73%	0.727	72%	0.724	S	S	*	*	G	3₁₀ helix	trans	-96.5	-2.5	176	0	0	0	0	0	113.8	H22 G26	H22-A24 VanDerWaalsContact C-N 3.33Å; H22-A24 PolarHBondContact O-N 3.38Å; A24-G26 VanDerWaalsContact C-N 3.31Å; A24-G26 PolarHBondContact O-N 3.37Å; A24-G26 VanDerWaalsContact O-N 3.13Å
25	C	44.3	Very low	46.1	Very low	110 Å²	110	124.8 Å²	124.8	74%	0.743	74%	0.737	S	S	*	*			trans	-90.4	68.5	179.1	-139.8	0	0	0	0	110.4
26	G	39.5	Very low	45.6	Very low	63 Å²	63	127.5 Å²	127.5	65%	0.649	75%	0.746	S	S	*	*			trans	-64	132.3	161.7	0	0	0	0	0	109.6	A24 A28	A24-G26 VanDerWaalsContact C-N 3.31Å; A24-G26 PolarHBondContact O-N 3.37Å; A24-G26 VanDerWaalsContact O-N 3.13Å; G26-A28 PolarHBondContact O-N 3.4Å
27	S	45.4	Very low	45.8	Very low	123 Å²	123	130 Å²	130	86%	0.86	74%	0.743	S	S	*	*			trans	-52.4	105.4	175.6	161.5	0	0	0	0	111.4
28	A	40.1	Very low	46	Very low	95 Å²	95	133.3 Å²	133.3	79%	0.785	75%	0.752	S	S	*	*			trans	-121.7	117	164.3	0	0	0	0	0	108.9	G26 T30	G26-A28 PolarHBondContact O-N 3.4Å; A28-T30 PolarHBondContact O-N 3.01Å
29	H	41.4	Very low	46.3	Very low	165 Å²	165	132.6 Å²	132.6	76%	0.764	74%	0.74	S	S	*	*			trans	-34.6	127.3	175.5	-91.3	-94	0	0	0	115.1	T31	H29-T31 PolarHBondContact O-N 3.38Å
30	T	45.4	Very low	46.6	Very low	126 Å²	126	133 Å²	133	77%	0.773	74%	0.739	S	S	*	*			trans	19.5	91.3	138.2	56.4	0	0	0	0	116.9	A28	A28-T30 PolarHBondContact O-N 3.01Å
31	T	38.3	Very low	46.9	Very low	117 Å²	117	137.2 Å²	137.2	72%	0.718	75%	0.747	S	S	*	*			trans	-130.7	125.9	142.2	38.2	0	0	0	0	107.9	H29 L33	H29-T31 PolarHBondContact O-N 3.38Å; T31-L33 VanDerWaalsContact C-N 3.25Å; T31-L33 PolarHBondContact O-N 2.85Å
32	Q	47.3	Very low	47.4	Very low	201 Å²	201	133.9 Å²	133.9	94%	0.939	73%	0.732	S	S	*	*			trans	-67.7	83.3	-179.2	-135.7	-173.2	12.5	0	0	108.6	V34	Q32-V34 PolarHBondContact O-N 2.92Å; Q32-V34 VanDerWaalsContact O-N 3.15Å
33	L	44.5	Very low	47.9	Very low	155 Å²	155	131 Å²	131	81%	0.812	72%	0.722	S	S	*	*			trans	-76.7	104.3	172	-94.7	158.2	0	0	0	107.9	T31 R35	T31-L33 VanDerWaalsContact C-N 3.25Å; T31-L33 PolarHBondContact O-N 2.85Å; L33-R35 PolarHBondContact O-N 2.81Å
34	V	44.8	Very low	48.3	Very low	119 Å²	119	135.1 Å²	135.1	72%	0.721	72%	0.723	S	S	*	*			trans	-33.4	112.3	163.6	173	0	0	0	0	108.6	Q32 T36	Q32-V34 PolarHBondContact O-N 2.92Å; Q32-V34 VanDerWaalsContact O-N 3.15Å; V34-T36 HydrophobicContact CG1-CG2 4.3Å; V34-T36 PolarHBondContact O-N 3.49Å
35	R	47.5	Very low	49	Very low	242 Å²	242	136.8 Å²	136.8	91%	0.913	72%	0.719	S	S	*	*			trans	-63	76.6	178.8	-172.1	-179.5	-170.1	157.3	2.1	109.3	L33 K37	L33-R35 PolarHBondContact O-N 2.81Å; R35-K37 PolarHBondContact O-N 3.46Å
36	T	48.6	Very low	49.8	Very low	94 Å²	94	140.6 Å²	140.6	58%	0.577	72%	0.718	S	S	*	*			trans	-76.5	120.2	159.8	52.7	0	0	0	0	106	V34 Y38	V34-T36 HydrophobicContact CG1-CG2 4.3Å; V34-T36 PolarHBondContact O-N 3.49Å; T36-Y38 PolarHBondContact O-N 3.05Å
37	K	50.1	Low	50.9	Low	192 Å²	192	141.2 Å²	141.2	84%	0.835	71%	0.712	S	S	*	*			trans	-65.9	65.4	179.1	-171.2	-175.6	-178.8	-176.7	0	109.4	R35 N39	R35-K37 PolarHBondContact O-N 3.46Å; K37-N39 PolarHBondContact O-N 3.09Å
38	Y	53.4	Low	52.1	Low	176 Å²	176	145.1 Å²	145.1	69%	0.69	71%	0.707	S	S	*	*			trans	-82.5	110.4	174.5	-101.2	-86.9	0	0	0	108.3	T36 N40	T36-Y38 PolarHBondContact O-N 3.05Å; Y38-N40 PolarHBondContact O-N 3.19Å
39	N	56.6	Low	53.3	Low	89 Å²	89	144.9 Å²	144.9	48%	0.476	70%	0.699	S	S	.	*			trans	-65.4	95.4	174.7	-73.4	-18.8	0	0	0	109.1	K37 F41 D42	K37-N39 PolarHBondContact O-N 3.09Å; N39-F41 PolarHBondContact O-N 3.22Å; N39-F41 VanDerWaalsContact O-N 3.07Å; N39-D42 HydrophobicContact CB-CB 4.09Å; N39-D42 WeakPolarHBondContact CB-OD2 3.38Å; N39-D42 PolarHBondContact ND2-OD2 2.93Å; N39-D42 WeakPolarHBondContact O-CB 3.26Å; N39-D42 PolarHBondContact O-N 3.48Å
40	N	56.3	Low	55	Low	113 Å²	113	142.3 Å²	142.3	60%	0.604	69%	0.689	S	S	*	*	H	α-helix	trans	-56.6	-24.5	174.8	-69	-50.9	0	0	0	112.7	Y38 L43 Y44	Y38-N40 PolarHBondContact O-N 3.19Å; N40-L43 PolarHBondContact O-N 3.47Å; N40-Y44 PolarHBondContact O-N 2.9Å
41	F	56.3	Low	56.6	Low	183 Å²	183	143.9 Å²	143.9	80%	0.803	68%	0.682	S	S	*	*	H	α-helix	trans	-67	-34.8	173	-74.8	-78.8	0	0	0	113.6	N39 L43 Y44 L45	N39-F41 PolarHBondContact O-N 3.22Å; N39-F41 VanDerWaalsContact O-N 3.07Å; F41-L43 VanDerWaalsContact C-N 3.33Å; F41-Y44 PolarHBondContact O-N 3.1Å; F41-L45 WeakPolarHBondContact O-CB 3.41Å; F41-L45 PolarHBondContact O-N 3.16Å
42	D	56.4	Low	58.6	Low	94 Å²	94	140.1 Å²	140.1	50%	0.503	67%	0.666	S	S	.	*	H	α-helix	trans	-67	-37	175.9	-92.5	-52.1	0	0	0	111.2	N39 L45 R46	N39-D42 HydrophobicContact CB-CB 4.09Å; N39-D42 WeakPolarHBondContact CB-OD2 3.38Å; N39-D42 PolarHBondContact ND2-OD2 2.93Å; N39-D42 WeakPolarHBondContact O-CB 3.26Å; N39-D42 PolarHBondContact O-N 3.48Å; D42-L45 PolarHBondContact O-N 3.42Å; D42-R46 WeakPolarHBondContact O-CB 3.33Å; D42-R46 PolarHBondContact O-N 3.22Å
43	L	58.2	Low	60.1	Low	104 Å²	104	136.4 Å²	136.4	55%	0.545	65%	0.647	S	S	.	*	H	α-helix	trans	-63.2	-41.6	174.5	-82	158.4	0	0	0	111.7	N40 F41 S47	N40-L43 PolarHBondContact O-N 3.47Å; F41-L43 VanDerWaalsContact C-N 3.33Å; L43-S47 WeakPolarHBondContact O-CB 3.45Å; L43-S47 PolarHBondContact O-N 3.32Å
44	Y	55.4	Low	62	Low	189 Å²	189	134.6 Å²	134.6	74%	0.741	64%	0.638	S	S	*	*	H	α-helix	trans	-70.4	-41.7	175.8	-92.6	-89.4	0	0	0	113	N40 F41 S47 R48	N40-Y44 PolarHBondContact O-N 2.9Å; F41-Y44 PolarHBondContact O-N 3.1Å; Y44-S47 PolarHBondContact O-N 3.29Å; Y44-R48 WeakPolarHBondContact O-CB 3.46Å; Y44-R48 PolarHBondContact O-N 2.89Å
45	L	60.1	Low	63.7	Low	123 Å²	123	135.1 Å²	135.1	64%	0.644	63%	0.627	S	S	*	*	H	α-helix	trans	-66.1	-42.7	177.8	-152.5	84.3	0	0	0	110.8	F41 D42 R48 C49	F41-L45 WeakPolarHBondContact O-CB 3.41Å; F41-L45 PolarHBondContact O-N 3.16Å; D42-L45 PolarHBondContact O-N 3.42Å; L45-R48 PolarHBondContact O-N 3.1Å; L45-C49 VanDerWaalsContact O-CB 3.3Å; L45-C49 WeakPolarHBondContact O-CB 3.17Å; L45-C49 PolarHBondContact O-N 3.42Å
46	R	60.2	Low	65.5	Low	190 Å²	190	129.5 Å²	129.5	72%	0.717	61%	0.609	S	S	*	*	H	α-helix	trans	-67	-38.2	175	-170.3	163	-178.2	161.6	-1.1	111.9	D42 C49 M50	D42-R46 WeakPolarHBondContact O-CB 3.33Å; D42-R46 PolarHBondContact O-N 3.22Å; R46-C49 PolarHBondContact O-N 2.95Å; R46-M50 HydrophobicContact CG-CG 4.42Å; R46-M50 VanDerWaalsContact O-CB 3.25Å; R46-M50 WeakPolarHBondContact O-CB 3.33Å; R46-M50 WeakPolarHBondContact O-CG 3.36Å; R46-M50 PolarHBondContact O-N 2.93Å
47	S	63.4	Low	67.3	Low	75 Å²	75	129.5 Å²	129.5	52%	0.524	61%	0.605	S	S	.	*	H	α-helix	trans	-66.1	-41.5	173.7	-177.2	0	0	0	0	112.1	L43 Y44 M50 Y51	L43-S47 WeakPolarHBondContact O-CB 3.45Å; L43-S47 PolarHBondContact O-N 3.32Å; Y44-S47 PolarHBondContact O-N 3.29Å; S47-M50 PolarHBondContact O-N 2.79Å; S47-Y51 VanDerWaalsContact O-CB 3.3Å; S47-Y51 WeakPolarHBondContact O-CB 3.35Å; S47-Y51 PolarHBondContact O-N 3.35Å
48	R	68.9	Low	69	Low	205 Å²	205	125.7 Å²	125.7	77%	0.774	59%	0.593	S	S	*	*	H	α-helix	trans	-66.9	-38.8	175.5	-166.7	173.3	-173.7	171.3	0.9	112.3	Y44 L45 G52	Y44-R48 WeakPolarHBondContact O-CB 3.46Å; Y44-R48 PolarHBondContact O-N 2.89Å; L45-R48 PolarHBondContact O-N 3.1Å; R48-G52 PolarHBondContact O-N 3.17Å
49	C	67.2	Low	70.4	Confident	91 Å²	91	121.5 Å²	121.5	62%	0.615	58%	0.577	S	S	*	*	H	α-helix	trans	-68.1	-43.7	174.8	-163.5	0	0	0	0	111.3	L45 R46 Y51 G52 F53	L45-C49 VanDerWaalsContact O-CB 3.3Å; L45-C49 WeakPolarHBondContact O-CB 3.17Å; L45-C49 PolarHBondContact O-N 3.42Å; R46-C49 PolarHBondContact O-N 2.95Å; C49-Y51 PolarHBondContact O-N 2.77Å; C49-G52 PolarHBondContact O-N 2.82Å; C49-F53 VanDerWaalsContact O-CB 3.32Å; C49-F53 WeakPolarHBondContact O-CB 3.5Å; C49-F53 PolarHBondContact O-N 3.42Å
50	M	77.1	Confident	71.8	Confident	111 Å²	111	122.2 Å²	122.2	55%	0.547	58%	0.576	S	S	.	*	H	α-helix	trans	-61.9	-42.7	174	-73.4	-98.8	76.2	0	0	111.8	R46 S47 F53 L54	R46-M50 HydrophobicContact CG-CG 4.42Å; R46-M50 VanDerWaalsContact O-CB 3.25Å; R46-M50 WeakPolarHBondContact O-CB 3.33Å; R46-M50 WeakPolarHBondContact O-CG 3.36Å; R46-M50 PolarHBondContact O-N 2.93Å; S47-M50 PolarHBondContact O-N 2.79Å; M50-F53 PolarHBondContact O-N 3.29Å; M50-L54 VanDerWaalsContact O-CB 3.24Å; M50-L54 WeakPolarHBondContact O-CB 3.19Å; M50-L54 PolarHBondContact O-N 2.88Å
51	Y	78.4	Confident	73.2	Confident	158 Å²	158	118 Å²	118	62%	0.62	56%	0.559	S	S	*	*	H	α-helix	trans	-64.6	-42.8	176.2	-178.1	-97.5	0	0	0	111.8	S47 C49 L54 R55	S47-Y51 VanDerWaalsContact O-CB 3.3Å; S47-Y51 WeakPolarHBondContact O-CB 3.35Å; S47-Y51 PolarHBondContact O-N 3.35Å; C49-Y51 PolarHBondContact O-N 2.77Å; Y51-L54 PolarHBondContact O-N 2.9Å; Y51-R55 VanDerWaalsContact O-CB 3.24Å; Y51-R55 WeakPolarHBondContact O-CB 3.34Å; Y51-R55 PolarHBondContact O-N 3.38Å
52	G	79.3	Confident	74.5	Confident	38 Å²	38	111 Å²	111	39%	0.392	53%	0.533	S	S	.	.	H	α-helix	trans	-61.9	-43.9	173.9	0	0	0	0	0	112.5	R48 C49 R55 F56	R48-G52 PolarHBondContact O-N 3.17Å; C49-G52 PolarHBondContact O-N 2.82Å; G52-R55 PolarHBondContact O-N 3.38Å; G52-F56 WeakPolarHBondContact O-CB 3.39Å; G52-F56 PolarHBondContact O-N 3.31Å
53	F	80	Confident	75.9	Confident	124 Å²	124	110 Å²	110	54%	0.544	53%	0.533	S	S	.	.	H	α-helix	trans	-66.3	-42.6	177.3	-172.1	-94.7	0	0	0	112.2	C49 M50 R55 F56 L57	C49-F53 VanDerWaalsContact O-CB 3.32Å; C49-F53 WeakPolarHBondContact O-CB 3.5Å; C49-F53 PolarHBondContact O-N 3.42Å; M50-F53 PolarHBondContact O-N 3.29Å; F53-R55 VanDerWaalsContact C-N 3.33Å; F53-R55 PolarHBondContact O-N 3.01Å; F53-F56 PolarHBondContact O-N 3.5Å; F53-L57 WeakPolarHBondContact O-CB 3.49Å; F53-L57 PolarHBondContact O-N 2.81Å
54	L	82.9	Confident	77.2	Confident	116 Å²	116	108.7 Å²	108.7	61%	0.607	53%	0.526	S	S	*	.	H	α-helix	trans	-63.8	-41.5	176.6	-163.5	77.1	0	0	0	111	M50 Y51 L57 L58	M50-L54 VanDerWaalsContact O-CB 3.24Å; M50-L54 WeakPolarHBondContact O-CB 3.19Å; M50-L54 PolarHBondContact O-N 2.88Å; Y51-L54 PolarHBondContact O-N 2.9Å; L54-L57 PolarHBondContact O-N 3.33Å; L54-L58 WeakPolarHBondContact O-CB 3.37Å; L54-L58 PolarHBondContact O-N 2.73Å
55	R	82.1	Confident	78.7	Confident	130 Å²	130	104.9 Å²	104.9	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-64.7	-42.6	175.5	-173.7	171.3	-174.8	-150.8	-10.4	111.4	Y51 G52 F53 L58 Y59	Y51-R55 VanDerWaalsContact O-CB 3.24Å; Y51-R55 WeakPolarHBondContact O-CB 3.34Å; Y51-R55 PolarHBondContact O-N 3.38Å; G52-R55 PolarHBondContact O-N 3.38Å; F53-R55 VanDerWaalsContact C-N 3.33Å; F53-R55 PolarHBondContact O-N 3.01Å; R55-L58 PolarHBondContact O-N 3.29Å; R55-Y59 HydrophobicContact CG-CD2 3.74Å; R55-Y59 HydrophobicContact CG-CE2 3.29Å; R55-Y59 PolarHBondContact NE-OH 3.49Å; R55-Y59 PolarHBondContact NH2-OH 3.42Å; R55-Y59 WeakPolarHBondContact O-CD2 3.31Å; R55-Y59 PolarHBondContact O-N 2.89Å
56	F	83.8	Confident	79.9	Confident	124 Å²	124	99.9 Å²	99.9	54%	0.544	49%	0.493	S	S	.	.	H	α-helix	trans	-60.8	-48.5	173.3	176.1	-97.5	0	0	0	111.6	G52 F53 L58 Y59 F60	G52-F56 WeakPolarHBondContact O-CB 3.39Å; G52-F56 PolarHBondContact O-N 3.31Å; F53-F56 PolarHBondContact O-N 3.5Å; F56-L58 VanDerWaalsContact C-N 3.28Å; F56-L58 PolarHBondContact O-N 3.33Å; F56-Y59 PolarHBondContact O-N 3.43Å; F56-F60 HydrophobicContact CE1-CB 4.3Å; F56-F60 HydrophobicContact CE1-CG 4.43Å; F56-F60 HydrophobicContact CZ-CB 4.37Å; F56-F60 HydrophobicContact CZ-CD2 4.47Å; F56-F60 HydrophobicContact CZ-CG 4.41Å; F56-F60 WeakPolarHBondContact O-CB 3.5Å; F56-F60 PolarHBondContact O-N 2.98Å
57	L	87.3	Confident	81.1	Confident	94 Å²	94	93.2 Å²	93.2	49%	0.492	48%	0.475	S	S	.	.	H	α-helix	trans	-61.1	-39	179.2	-168.8	73.6	0	0	0	111.6	F53 L54 G61	F53-L57 WeakPolarHBondContact O-CB 3.49Å; F53-L57 PolarHBondContact O-N 2.81Å; L54-L57 PolarHBondContact O-N 3.33Å; L57-G61 WeakPolarHBondContact O-CA 3.25Å; L57-G61 PolarHBondContact O-N 2.93Å
58	L	85.6	Confident	82.3	Confident	113 Å²	113	94.8 Å²	94.8	59%	0.592	48%	0.477	S	S	*	.	H	α-helix	trans	-64.2	-51.6	176.8	-165.8	86.8	0	0	0	111.1	L54 R55 F56 G61 C62	L54-L58 WeakPolarHBondContact O-CB 3.37Å; L54-L58 PolarHBondContact O-N 2.73Å; R55-L58 PolarHBondContact O-N 3.29Å; F56-L58 VanDerWaalsContact C-N 3.28Å; F56-L58 PolarHBondContact O-N 3.33Å; L58-G61 PolarHBondContact O-N 3.48Å; L58-C62 WeakPolarHBondContact O-CB 3.45Å; L58-C62 PolarHBondContact O-N 3.25Å; L58-C62 PolarHBondContact O-SG 2.89Å; L58-C62 VanDerWaalsContact O-SG 3.39Å
59	Y	83.8	Confident	83.3	Confident	87 Å²	87	88.9 Å²	88.9	34%	0.341	46%	0.46	S	S	.	.	H	α-helix	trans	-66.4	-41.9	179.8	-69.4	-55.2	0	0	0	112.5	R55 F56 C62 S63	R55-Y59 HydrophobicContact CG-CD2 3.74Å; R55-Y59 HydrophobicContact CG-CE2 3.29Å; R55-Y59 PolarHBondContact NE-OH 3.49Å; R55-Y59 PolarHBondContact NH2-OH 3.42Å; R55-Y59 WeakPolarHBondContact O-CD2 3.31Å; R55-Y59 PolarHBondContact O-N 2.89Å; F56-Y59 PolarHBondContact O-N 3.43Å; Y59-C62 PolarHBondContact O-N 3.09Å; Y59-S63 WeakPolarHBondContact O-CB 3.16Å; Y59-S63 PolarHBondContact O-N 3.05Å
60	F	85.2	Confident	84.2	Confident	104 Å²	104	89.3 Å²	89.3	46%	0.456	45%	0.449	S	S	.	.	H	α-helix	trans	-64.2	-42.9	176.6	-177	-110.9	0	0	0	111.3	F56 S63 L64	F56-F60 HydrophobicContact CE1-CB 4.3Å; F56-F60 HydrophobicContact CE1-CG 4.43Å; F56-F60 HydrophobicContact CZ-CB 4.37Å; F56-F60 HydrophobicContact CZ-CD2 4.47Å; F56-F60 HydrophobicContact CZ-CG 4.41Å; F56-F60 WeakPolarHBondContact O-CB 3.5Å; F56-F60 PolarHBondContact O-N 2.98Å; F60-S63 PolarHBondContact O-N 2.95Å; F60-L64 HydrophobicContact CD1-CD1 3.71Å; F60-L64 HydrophobicContact CE1-CD1 3.24Å; F60-L64 HydrophobicContact CE1-CG 4.2Å; F60-L64 HydrophobicContact CE2-CD1 4.24Å; F60-L64 HydrophobicContact CE2-CG 4.37Å; F60-L64 HydrophobicContact CG-CD1 4.38Å; F60-L64 HydrophobicContact CZ-CD1 3.55Å; F60-L64 HydrophobicContact CZ-CG 4.11Å; F60-L64 WeakPolarHBondContact O-CB 3.27Å; F60-L64 WeakPolarHBondContact O-CG 3.48Å; F60-L64 PolarHBondContact O-N 2.95Å
61	G	86	Confident	84.8	Confident	25 Å²	25	88.7 Å²	88.7	26%	0.258	45%	0.452	S	S	.	.	H	α-helix	trans	-62.3	-46.5	174.1	0	0	0	0	0	112.3	L57 L58 S63 L64 L65	L57-G61 WeakPolarHBondContact O-CA 3.25Å; L57-G61 PolarHBondContact O-N 2.93Å; L58-G61 PolarHBondContact O-N 3.48Å; G61-S63 PolarHBondContact O-N 2.71Å; G61-L64 PolarHBondContact O-N 3.19Å; G61-L65 WeakPolarHBondContact O-CB 3.06Å; G61-L65 VanDerWaalsContact O-CG 3.27Å; G61-L65 WeakPolarHBondContact O-CG 3.38Å; G61-L65 PolarHBondContact O-N 3.37Å
62	C	84.3	Confident	85.4	Confident	37 Å²	37	83.5 Å²	83.5	25%	0.25	44%	0.441	C	S	.	.	H	α-helix	trans	-61.3	-42.9	175.2	-77.9	0	0	0	0	112.4	L58 Y59 L65 T66 F136	L58-C62 WeakPolarHBondContact O-CB 3.45Å; L58-C62 PolarHBondContact O-N 3.25Å; L58-C62 PolarHBondContact O-SG 2.89Å; L58-C62 VanDerWaalsContact O-SG 3.39Å; Y59-C62 PolarHBondContact O-N 3.09Å; C62-L65 PolarHBondContact O-N 3.04Å; C62-T66 WeakPolarHBondContact O-CB 3.31Å; C62-T66 VanDerWaalsContact O-CG2 3.27Å; C62-T66 WeakPolarHBondContact O-CG2 3.39Å; C62-T66 PolarHBondContact O-N 2.99Å; C62-T66 PolarHBondContact O-OG1 3.49Å; C62-F136 HydrophobicContact CB-CD1 4.15Å; C62-F136 HydrophobicContact CB-CE1 3.4Å; C62-F136 HydrophobicContact CB-CE2 4.47Å; C62-F136 HydrophobicContact CB-CZ 3.6Å
63	S	84.1	Confident	85.9	Confident	71 Å²	71	82 Å²	82	50%	0.497	42%	0.424	S	S	.	.	H	α-helix	trans	-64	-43.4	176.1	177.2	0	0	0	0	111.8	Y59 F60 G61 T66 S67	Y59-S63 WeakPolarHBondContact O-CB 3.16Å; Y59-S63 PolarHBondContact O-N 3.05Å; F60-S63 PolarHBondContact O-N 2.95Å; G61-S63 PolarHBondContact O-N 2.71Å; S63-T66 WeakPolarHBondContact CA-OG1 3.38Å; S63-T66 PolarHBondContact O-OG1 2.92Å; S63-S67 WeakPolarHBondContact O-CB 3.42Å; S63-S67 PolarHBondContact O-N 3.27Å; S63-S67 PolarHBondContact O-OG 3.02Å
64	L	87.3	Confident	86.2	Confident	78 Å²	78	79.4 Å²	79.4	41%	0.408	42%	0.421	S	S	.	.	H	α-helix	trans	-62.5	-49.8	174.7	-81.4	171.9	0	0	0	112	F60 G61 T66 S67 L68	F60-L64 HydrophobicContact CD1-CD1 3.71Å; F60-L64 HydrophobicContact CE1-CD1 3.24Å; F60-L64 HydrophobicContact CE1-CG 4.2Å; F60-L64 HydrophobicContact CE2-CD1 4.24Å; F60-L64 HydrophobicContact CE2-CG 4.37Å; F60-L64 HydrophobicContact CG-CD1 4.38Å; F60-L64 HydrophobicContact CZ-CD1 3.55Å; F60-L64 HydrophobicContact CZ-CG 4.11Å; F60-L64 WeakPolarHBondContact O-CB 3.27Å; F60-L64 WeakPolarHBondContact O-CG 3.48Å; F60-L64 PolarHBondContact O-N 2.95Å; G61-L64 PolarHBondContact O-N 3.19Å; L64-T66 VanDerWaalsContact C-N 3.32Å; L64-T66 PolarHBondContact O-N 3.5Å; L64-S67 PolarHBondContact O-N 3.34Å; L64-S67 PolarHBondContact O-OG 3.38Å; L64-L68 WeakPolarHBondContact O-CB 3.44Å; L64-L68 WeakPolarHBondContact O-CG 3.39Å; L64-L68 PolarHBondContact O-N 3.24Å
65	L	86.3	Confident	86.6	Confident	108 Å²	108	76.1 Å²	76.1	57%	0.565	41%	0.411	S	S	*	.	H	α-helix	trans	-59.8	-43.1	-180	-75.1	171.8	0	0	0	111.8	G61 C62 L68 L69	G61-L65 WeakPolarHBondContact O-CB 3.06Å; G61-L65 VanDerWaalsContact O-CG 3.27Å; G61-L65 WeakPolarHBondContact O-CG 3.38Å; G61-L65 PolarHBondContact O-N 3.37Å; C62-L65 PolarHBondContact O-N 3.04Å; L65-L68 PolarHBondContact O-N 3.3Å; L65-L69 WeakPolarHBondContact O-CB 3.25Å; L65-L69 VanDerWaalsContact O-CG 3.28Å; L65-L69 WeakPolarHBondContact O-CG 3.41Å; L65-L69 PolarHBondContact O-N 3.18Å
66	T	85.1	Confident	87	Confident	18 Å²	18	73.9 Å²	73.9	11%	0.11	41%	0.409	C	S	.	.	H	α-helix	trans	-64.8	-41.8	177.3	48.5	0	0	0	0	111.8	C62 S63 L64 L69 W70 F136	C62-T66 WeakPolarHBondContact O-CB 3.31Å; C62-T66 VanDerWaalsContact O-CG2 3.27Å; C62-T66 WeakPolarHBondContact O-CG2 3.39Å; C62-T66 PolarHBondContact O-N 2.99Å; C62-T66 PolarHBondContact O-OG1 3.49Å; S63-T66 WeakPolarHBondContact CA-OG1 3.38Å; S63-T66 PolarHBondContact O-OG1 2.92Å; L64-T66 VanDerWaalsContact C-N 3.32Å; L64-T66 PolarHBondContact O-N 3.5Å; T66-L69 PolarHBondContact O-N 3.48Å; T66-W70 PolarHBondContact O-N 3.18Å; T66-F136 HydrophobicContact CG2-CD2 4.19Å; T66-F136 HydrophobicContact CG2-CE2 4.42Å
67	S	85.3	Confident	87.2	Confident	50 Å²	50	71.9 Å²	71.9	35%	0.35	40%	0.4	S	S	.	.	H	α-helix	trans	-62.5	-42.7	174.5	75.8	0	0	0	0	112.4	S63 L64 W70 V71	S63-S67 WeakPolarHBondContact O-CB 3.42Å; S63-S67 PolarHBondContact O-N 3.27Å; S63-S67 PolarHBondContact O-OG 3.02Å; L64-S67 PolarHBondContact O-N 3.34Å; L64-S67 PolarHBondContact O-OG 3.38Å; S67-W70 WeakPolarHBondContact O-CB 3.33Å; S67-W70 PolarHBondContact O-N 3.4Å; S67-V71 WeakPolarHBondContact O-CG2 3.31Å; S67-V71 PolarHBondContact O-N 2.95Å
68	L	89.6	Confident	87.2	Confident	109 Å²	109	71 Å²	71	57%	0.571	40%	0.401	S	S	*	.	H	α-helix	trans	-65.5	-40.5	177.3	-74.3	173.8	0	0	0	111.8	L64 L65 W70 V71 A72	L64-L68 WeakPolarHBondContact O-CB 3.44Å; L64-L68 WeakPolarHBondContact O-CG 3.39Å; L64-L68 PolarHBondContact O-N 3.24Å; L65-L68 PolarHBondContact O-N 3.3Å; L68-W70 VanDerWaalsContact C-N 3.29Å; L68-W70 PolarHBondContact O-N 3.23Å; L68-V71 PolarHBondContact O-N 3.21Å; L68-A72 WeakPolarHBondContact O-CB 3.43Å; L68-A72 PolarHBondContact O-N 2.92Å
69	L	88.6	Confident	87.4	Confident	80 Å²	80	71.1 Å²	71.1	42%	0.419	40%	0.402	S	S	.	.	H	α-helix	trans	-60.4	-40	174.8	-79.4	164.3	0	0	0	111.4	L65 T66 A72 L73 L129	L65-L69 WeakPolarHBondContact O-CB 3.25Å; L65-L69 VanDerWaalsContact O-CG 3.28Å; L65-L69 WeakPolarHBondContact O-CG 3.41Å; L65-L69 PolarHBondContact O-N 3.18Å; T66-L69 PolarHBondContact O-N 3.48Å; L69-A72 PolarHBondContact O-N 2.85Å; L69-L73 WeakPolarHBondContact O-CB 3.43Å; L69-L73 WeakPolarHBondContact O-CG 3.33Å; L69-L73 PolarHBondContact O-N 3.43Å; L69-L129 HydrophobicContact CB-CD2 4.43Å; L69-L129 HydrophobicContact CD1-CD2 4.02Å
70	W	86.5	Confident	87.7	Confident	100 Å²	100	68 Å²	68	38%	0.379	39%	0.39	S	S	.	.	H	α-helix	trans	-64.5	-44.4	174.9	-97.9	97.8	0	0	0	112.9	T66 S67 L68 A72 L73 S74 V126 F133	T66-W70 PolarHBondContact O-N 3.18Å; S67-W70 WeakPolarHBondContact O-CB 3.33Å; S67-W70 PolarHBondContact O-N 3.4Å; L68-W70 VanDerWaalsContact C-N 3.29Å; L68-W70 PolarHBondContact O-N 3.23Å; W70-A72 VanDerWaalsContact C-N 3.35Å; W70-L73 WeakPolarHBondContact O-CB 3.45Å; W70-L73 PolarHBondContact O-N 3.24Å; W70-S74 PolarHBondContact O-N 3.44Å; W70-V126 HydrophobicContact CH2-CG1 4.43Å; W70-F133 AromaticContact CD1-CD2 3.53Å; W70-F133 AromaticContact CD1-CE2 3.91Å; W70-F133 AromaticContact NE1-CD2 3.5Å; W70-F133 AromaticContact NE1-CG 3.92Å
71	V	90.1	Very high	87.8	Confident	99 Å²	99	69.3 Å²	69.3	60%	0.6	39%	0.393	S	S	*	.	H	α-helix	trans	-62.7	-44.3	175.3	174.1	0	0	0	0	110.7	S67 L68 L73 S74 A75	S67-V71 WeakPolarHBondContact O-CG2 3.31Å; S67-V71 PolarHBondContact O-N 2.95Å; L68-V71 PolarHBondContact O-N 3.21Å; V71-L73 VanDerWaalsContact C-N 3.33Å; V71-L73 PolarHBondContact O-N 3.06Å; V71-S74 PolarHBondContact O-N 2.94Å; V71-A75 PolarHBondContact O-N 3.29Å
72	A	90.1	Very high	87.8	Confident	49 Å²	49	73.4 Å²	73.4	41%	0.405	41%	0.406	S	S	.	.	H	α-helix	trans	-61	-41.8	177	0	0	0	0	0	111.7	L68 L69 W70 A75 L76	L68-A72 WeakPolarHBondContact O-CB 3.43Å; L68-A72 PolarHBondContact O-N 2.92Å; L69-A72 PolarHBondContact O-N 2.85Å; W70-A72 VanDerWaalsContact C-N 3.35Å; A72-A75 PolarHBondContact O-N 3.29Å; A72-L76 WeakPolarHBondContact O-CB 3.45Å; A72-L76 WeakPolarHBondContact O-CG 3.04Å; A72-L76 PolarHBondContact O-N 3.15Å
73	L	89.4	Confident	87.8	Confident	5 Å²	5	74 Å²	74	3%	0.026	41%	0.411	C	S	.	.	H	α-helix	trans	-60.7	-48.2	173.4	-85.3	172.9	0	0	0	112.3	L69 W70 V71 A75 L76 F77 L125 V126 L129	L69-L73 WeakPolarHBondContact O-CB 3.43Å; L69-L73 WeakPolarHBondContact O-CG 3.33Å; L69-L73 PolarHBondContact O-N 3.43Å; W70-L73 WeakPolarHBondContact O-CB 3.45Å; W70-L73 PolarHBondContact O-N 3.24Å; V71-L73 VanDerWaalsContact C-N 3.33Å; V71-L73 PolarHBondContact O-N 3.06Å; L73-A75 VanDerWaalsContact C-N 3.27Å; L73-A75 PolarHBondContact O-N 3.03Å; L73-L76 WeakPolarHBondContact O-CB 3.48Å; L73-L76 PolarHBondContact O-N 3.34Å; L73-L76 VanDerWaalsContact O-N 3.15Å; L73-F77 WeakPolarHBondContact O-CD2 3.44Å; L73-F77 PolarHBondContact O-N 3.37Å; L73-L125 HydrophobicContact CD2-CB 3.8Å; L73-L125 HydrophobicContact CD2-CD2 3.79Å; L73-L125 HydrophobicContact CD2-CG 4.44Å; L73-L125 HydrophobicContact CG-CD2 4.49Å; L73-V126 HydrophobicContact CD1-CG2 4.17Å; L73-V126 HydrophobicContact CD2-CG2 4.27Å; L73-L129 HydrophobicContact CD1-CB 4.13Å; L73-L129 HydrophobicContact CD1-CD1 3.36Å; L73-L129 HydrophobicContact CD1-CG 4.35Å; L73-L129 HydrophobicContact CG-CD1 4.11Å
74	S	86.9	Confident	87.9	Confident	70 Å²	70	71.7 Å²	71.7	49%	0.49	40%	0.397	S	S	.	.	H	α-helix	trans	-58.5	-42.9	177.4	-173.1	0	0	0	0	111.2	W70 V71 F77 C78	W70-S74 PolarHBondContact O-N 3.44Å; V71-S74 PolarHBondContact O-N 2.94Å; S74-F77 PolarHBondContact O-N 2.92Å; S74-C78 PolarHBondContact O-N 3.07Å; S74-C78 PolarHBondContact O-SG 3.22Å; S74-C78 VanDerWaalsContact O-SG 3.38Å
75	A	91.4	Very high	87.9	Confident	48 Å²	48	74.1 Å²	74.1	40%	0.397	40%	0.4	S	S	.	.	H	α-helix	trans	-63.5	-41.7	176.4	0	0	0	0	0	111.9	V71 A72 L73 C78 L79	V71-A75 PolarHBondContact O-N 3.29Å; A72-A75 PolarHBondContact O-N 3.29Å; L73-A75 VanDerWaalsContact C-N 3.27Å; L73-A75 PolarHBondContact O-N 3.03Å; A75-C78 PolarHBondContact O-N 2.94Å; A75-L79 WeakPolarHBondContact O-CB 3.48Å; A75-L79 WeakPolarHBondContact O-CG 3.44Å; A75-L79 PolarHBondContact O-N 2.88Å
76	L	90.3	Very high	87.9	Confident	83 Å²	83	72.8 Å²	72.8	44%	0.435	40%	0.396	S	S	.	.	H	α-helix	trans	-60.7	-43.2	174.1	-76.5	170	0	0	0	111.7	A72 L73 C78 L79 Q80	A72-L76 WeakPolarHBondContact O-CB 3.45Å; A72-L76 WeakPolarHBondContact O-CG 3.04Å; A72-L76 PolarHBondContact O-N 3.15Å; L73-L76 WeakPolarHBondContact O-CB 3.48Å; L73-L76 PolarHBondContact O-N 3.34Å; L73-L76 VanDerWaalsContact O-N 3.15Å; L76-C78 PolarHBondContact O-N 3.34Å; L76-L79 PolarHBondContact O-N 3.22Å; L76-Q80 WeakPolarHBondContact O-CB 3.28Å; L76-Q80 VanDerWaalsContact O-CG 3.31Å; L76-Q80 WeakPolarHBondContact O-CG 3.45Å; L76-Q80 PolarHBondContact O-N 2.94Å
77	F	87.8	Confident	87.9	Confident	81 Å²	81	74.9 Å²	74.9	36%	0.355	40%	0.404	S	S	.	.	H	α-helix	trans	-60.7	-44.5	174.6	-95.3	-83.5	0	0	0	112.2	L73 S74 Q80 Y81 V126	L73-F77 WeakPolarHBondContact O-CD2 3.44Å; L73-F77 PolarHBondContact O-N 3.37Å; S74-F77 PolarHBondContact O-N 2.92Å; F77-Q80 PolarHBondContact O-N 3.42Å; F77-Y81 WeakPolarHBondContact O-CB 3.5Å; F77-Y81 PolarHBondContact O-N 2.83Å; F77-V126 HydrophobicContact CD2-CG2 4.21Å; F77-V126 HydrophobicContact CE2-CG2 3.32Å; F77-V126 HydrophobicContact CZ-CG2 3.97Å
78	C	88.7	Confident	87.9	Confident	77 Å²	77	78 Å²	78	52%	0.52	42%	0.416	S	S	.	.	H	α-helix	trans	-62.4	-43.3	175.8	-69	0	0	0	0	111.9	S74 A75 L76 Y81 M82	S74-C78 PolarHBondContact O-N 3.07Å; S74-C78 PolarHBondContact O-SG 3.22Å; S74-C78 VanDerWaalsContact O-SG 3.38Å; A75-C78 PolarHBondContact O-N 2.94Å; L76-C78 PolarHBondContact O-N 3.34Å; C78-Y81 PolarHBondContact O-N 2.88Å; C78-M82 WeakPolarHBondContact O-CG 3.43Å; C78-M82 PolarHBondContact O-N 3.49Å
79	L	89	Confident	87.8	Confident	115 Å²	115	80.7 Å²	80.7	60%	0.602	42%	0.419	S	S	*	.	H	α-helix	trans	-63.8	-40.9	176	-76.9	170.1	0	0	0	111.8	A75 L76 M82 S83	A75-L79 WeakPolarHBondContact O-CB 3.48Å; A75-L79 WeakPolarHBondContact O-CG 3.44Å; A75-L79 PolarHBondContact O-N 2.88Å; L76-L79 PolarHBondContact O-N 3.22Å; L79-M82 PolarHBondContact O-N 3.12Å; L79-S83 VanDerWaalsContact O-CB 3.27Å; L79-S83 WeakPolarHBondContact O-CB 3.45Å; L79-S83 PolarHBondContact O-N 3.42Å; L79-S83 PolarHBondContact O-OG 3.24Å
80	Q	89	Confident	87.5	Confident	20 Å²	20	81.6 Å²	81.6	9%	0.093	42%	0.423	C	S	.	.	H	α-helix	trans	-62.2	-44.9	174.1	-78	-178.1	-13.6	0	0	111.3	L76 F77 M82 S83 A84 F115 S118 M119 T122	L76-Q80 WeakPolarHBondContact O-CB 3.28Å; L76-Q80 VanDerWaalsContact O-CG 3.31Å; L76-Q80 WeakPolarHBondContact O-CG 3.45Å; L76-Q80 PolarHBondContact O-N 2.94Å; F77-Q80 PolarHBondContact O-N 3.42Å; Q80-M82 PolarHBondContact O-N 2.92Å; Q80-S83 VanDerWaalsContact CA-OG 3.25Å; Q80-S83 WeakPolarHBondContact CA-OG 3.33Å; Q80-S83 PolarHBondContact O-N 3.44Å; Q80-S83 PolarHBondContact O-OG 3.24Å; Q80-A84 WeakPolarHBondContact O-CB 3.39Å; Q80-A84 PolarHBondContact O-N 2.95Å; Q80-F115 VanDerWaalsContact O-CZ 3.31Å; Q80-F115 WeakPolarHBondContact O-CZ 3.21Å; Q80-S118 PolarHBondContact NE2-O 2.98Å; Q80-S118 PolarHBondContact NE2-OG 3.45Å; Q80-M119 HydrophobicContact CB-CE 3.84Å; Q80-M119 HydrophobicContact CB-SD 4.41Å; Q80-M119 PolarHBondContact OE1-SD 3.44Å; Q80-T122 PolarHBondContact OE1-OG1 2.94Å; Q80-T122 VanDerWaalsContact OE1-OG1 3.09Å
81	Y	87.4	Confident	87.3	Confident	132 Å²	132	79 Å²	79	52%	0.518	42%	0.416	S	S	.	.	H	α-helix	trans	-61	-46.5	175.7	179.1	-97.8	0	0	0	112.7	F77 C78 A84 R85	F77-Y81 WeakPolarHBondContact O-CB 3.5Å; F77-Y81 PolarHBondContact O-N 2.83Å; C78-Y81 PolarHBondContact O-N 2.88Å; Y81-A84 PolarHBondContact O-N 3.43Å; Y81-R85 PolarHBondContact O-N 3.28Å; Y81-R85 VanDerWaalsContact O-N 3.1Å; Y81-R85 PolarHBondContact OH-NE 2.96Å
82	M	87.3	Confident	87	Confident	111 Å²	111	82.3 Å²	82.3	55%	0.547	42%	0.418	S	S	.	.	H	α-helix	trans	-65.8	-42.2	179.2	-71.7	-62.5	-79.5	0	0	111.7	C78 L79 Q80 R85 V86	C78-M82 WeakPolarHBondContact O-CG 3.43Å; C78-M82 PolarHBondContact O-N 3.49Å; L79-M82 PolarHBondContact O-N 3.12Å; Q80-M82 PolarHBondContact O-N 2.92Å; M82-R85 PolarHBondContact O-N 3.32Å; M82-V86 WeakPolarHBondContact O-CG2 3.34Å; M82-V86 PolarHBondContact O-N 2.89Å
83	S	84.4	Confident	86.7	Confident	49 Å²	49	86.9 Å²	86.9	34%	0.343	43%	0.429	S	S	.	.	H	α-helix	trans	-62.8	-45.2	175.8	53.1	0	0	0	0	111.2	L79 Q80 R85 V86 F87 F115	L79-S83 VanDerWaalsContact O-CB 3.27Å; L79-S83 WeakPolarHBondContact O-CB 3.45Å; L79-S83 PolarHBondContact O-N 3.42Å; L79-S83 PolarHBondContact O-OG 3.24Å; Q80-S83 VanDerWaalsContact CA-OG 3.25Å; Q80-S83 WeakPolarHBondContact CA-OG 3.33Å; Q80-S83 PolarHBondContact O-N 3.44Å; Q80-S83 PolarHBondContact O-OG 3.24Å; S83-R85 VanDerWaalsContact C-N 3.32Å; S83-R85 PolarHBondContact O-N 2.89Å; S83-V86 PolarHBondContact O-N 3.36Å; S83-F87 WeakPolarHBondContact O-CB 3.42Å; S83-F87 PolarHBondContact O-N 3.24Å; S83-F115 WeakPolarHBondContact OG-CE2 3.45Å
84	A	86.3	Confident	86.3	Confident	24 Å²	24	89.5 Å²	89.5	20%	0.198	44%	0.443	C	S	.	.	H	α-helix	trans	-52.7	-48.3	172.7	0	0	0	0	0	112.4	Q80 Y81 F87 L88 F115	Q80-A84 WeakPolarHBondContact O-CB 3.39Å; Q80-A84 PolarHBondContact O-N 2.95Å; Y81-A84 PolarHBondContact O-N 3.43Å; A84-F87 PolarHBondContact O-N 2.72Å; A84-L88 WeakPolarHBondContact O-CB 3.4Å; A84-L88 WeakPolarHBondContact O-CG 3.39Å; A84-L88 PolarHBondContact O-N 3.25Å; A84-F115 HydrophobicContact CB-CE1 3.89Å; A84-F115 HydrophobicContact CB-CE2 4.32Å; A84-F115 HydrophobicContact CB-CZ 3.51Å
85	R	87.4	Confident	86	Confident	129 Å²	129	88.9 Å²	88.9	49%	0.487	44%	0.439	S	S	.	.	H	α-helix	trans	-60.6	-47.6	179.3	-106.6	-160.6	-175.4	-158.6	2.6	112.3	Y81 M82 S83 F87 R89	Y81-R85 PolarHBondContact O-N 3.28Å; Y81-R85 VanDerWaalsContact O-N 3.1Å; Y81-R85 PolarHBondContact OH-NE 2.96Å; M82-R85 PolarHBondContact O-N 3.32Å; S83-R85 VanDerWaalsContact C-N 3.32Å; S83-R85 PolarHBondContact O-N 2.89Å; R85-F87 VanDerWaalsContact C-N 3.33Å; R85-R89 WeakPolarHBondContact O-CG 3.39Å; R85-R89 PolarHBondContact O-N 3.38Å
86	V	86.5	Confident	85.6	Confident	79 Å²	79	89.4 Å²	89.4	48%	0.479	44%	0.437	S	S	.	.	H	α-helix	trans	-66.8	-40.3	-179.9	172.2	0	0	0	0	110.1	M82 S83 R89 L90	M82-V86 WeakPolarHBondContact O-CG2 3.34Å; M82-V86 PolarHBondContact O-N 2.89Å; S83-V86 PolarHBondContact O-N 3.36Å; V86-R89 PolarHBondContact O-N 3.4Å; V86-L90 HydrophobicContact CG1-CD1 3.8Å; V86-L90 HydrophobicContact CG1-CG 4.39Å; V86-L90 WeakPolarHBondContact O-CB 3.5Å; V86-L90 WeakPolarHBondContact O-CG 3.44Å; V86-L90 PolarHBondContact O-N 2.86Å
87	F	85.1	Confident	85.3	Confident	63 Å²	63	90.4 Å²	90.4	28%	0.276	44%	0.441	S	S	.	.	H	α-helix	trans	-63.9	-46.3	-179.9	-143.3	-89.9	0	0	0	111.9	S83 A84 R85 R89 L90 Q91 F108 L111	S83-F87 WeakPolarHBondContact O-CB 3.42Å; S83-F87 PolarHBondContact O-N 3.24Å; A84-F87 PolarHBondContact O-N 2.72Å; R85-F87 VanDerWaalsContact C-N 3.33Å; F87-R89 VanDerWaalsContact C-N 3.34Å; F87-R89 PolarHBondContact O-N 3.44Å; F87-L90 PolarHBondContact O-N 2.78Å; F87-Q91 HydrophobicContact CD1-CG 3.92Å; F87-Q91 HydrophobicContact CE1-CG 4.05Å; F87-Q91 WeakPolarHBondContact O-CB 3.37Å; F87-Q91 WeakPolarHBondContact O-CG 3.27Å; F87-Q91 PolarHBondContact O-N 3.45Å; F87-F108 HydrophobicContact CE1-CD1 4.34Å; F87-L111 HydrophobicContact CE1-CB 3.9Å; F87-L111 HydrophobicContact CE1-CD1 4.5Å; F87-L111 HydrophobicContact CE2-CB 4.4Å; F87-L111 HydrophobicContact CE2-CD1 4.38Å; F87-L111 HydrophobicContact CE2-CD2 4.16Å; F87-L111 HydrophobicContact CZ-CB 3.47Å; F87-L111 VanDerWaalsContact CZ-CB 3.47Å; F87-L111 HydrophobicContact CZ-CD1 3.59Å; F87-L111 HydrophobicContact CZ-CD2 3.93Å; F87-L111 HydrophobicContact CZ-CG 3.81Å
88	L	84	Confident	85	Confident	114 Å²	114	87.8 Å²	87.8	60%	0.597	43%	0.431	S	S	*	.	H	α-helix	trans	-61.4	-42.2	175.7	-74	166.6	0	0	0	111.8	A84 Y92	A84-L88 WeakPolarHBondContact O-CB 3.4Å; A84-L88 WeakPolarHBondContact O-CG 3.39Å; A84-L88 PolarHBondContact O-N 3.25Å; L88-Y92 WeakPolarHBondContact O-CB 3.28Å; L88-Y92 PolarHBondContact O-N 3.22Å
89	R	87	Confident	84.6	Confident	167 Å²	167	90.8 Å²	90.8	63%	0.63	44%	0.441	S	S	*	.	H	α-helix	trans	-65.1	-41	176	-74.5	-179.3	179.4	-170.3	-0.6	112.1	R85 V86 F87 K93	R85-R89 WeakPolarHBondContact O-CG 3.39Å; R85-R89 PolarHBondContact O-N 3.38Å; V86-R89 PolarHBondContact O-N 3.4Å; F87-R89 VanDerWaalsContact C-N 3.34Å; F87-R89 PolarHBondContact O-N 3.44Å; R89-K93 PolarHBondContact O-N 3.1Å
90	L	82.8	Confident	84.1	Confident	98 Å²	98	92 Å²	92	51%	0.513	45%	0.448	S	S	.	.	H	α-helix	trans	-65.8	-47.9	176.5	-85.9	168.3	0	0	0	111.1	V86 F87 Y92 K93 L94	V86-L90 HydrophobicContact CG1-CD1 3.8Å; V86-L90 HydrophobicContact CG1-CG 4.39Å; V86-L90 WeakPolarHBondContact O-CB 3.5Å; V86-L90 WeakPolarHBondContact O-CG 3.44Å; V86-L90 PolarHBondContact O-N 2.86Å; F87-L90 PolarHBondContact O-N 2.78Å; L90-Y92 VanDerWaalsContact C-N 3.3Å; L90-Y92 PolarHBondContact O-N 3.39Å; L90-K93 PolarHBondContact O-N 3.42Å; L90-L94 WeakPolarHBondContact O-CB 3.41Å; L90-L94 PolarHBondContact O-N 3.29Å
91	Q	83.4	Confident	83.9	Confident	47 Å²	47	97 Å²	97	22%	0.22	47%	0.474	C	S	.	.	H	α-helix	trans	-55.6	-46.4	176	-78.8	-178	-16.8	0	0	111.1	F87 L94 S95 F108	F87-Q91 HydrophobicContact CD1-CG 3.92Å; F87-Q91 HydrophobicContact CE1-CG 4.05Å; F87-Q91 WeakPolarHBondContact O-CB 3.37Å; F87-Q91 WeakPolarHBondContact O-CG 3.27Å; F87-Q91 PolarHBondContact O-N 3.45Å; Q91-L94 PolarHBondContact O-N 3.32Å; Q91-S95 WeakPolarHBondContact O-CB 3.48Å; Q91-S95 PolarHBondContact O-N 3.29Å; Q91-S95 PolarHBondContact O-OG 3Å; Q91-F108 HydrophobicContact CG-CD1 4.16Å; Q91-F108 HydrophobicContact CG-CD2 4.27Å; Q91-F108 HydrophobicContact CG-CE1 4.26Å; Q91-F108 HydrophobicContact CG-CE2 4.36Å; Q91-F108 HydrophobicContact CG-CG 4.15Å; Q91-F108 HydrophobicContact CG-CZ 4.34Å
92	Y	82.8	Confident	83.5	Confident	167 Å²	167	94.2 Å²	94.2	66%	0.655	49%	0.486	S	S	*	.	H	α-helix	trans	-60.6	-53.7	177.5	-177.6	-98.7	0	0	0	111.7	L88 L90 L94 S95 V96	L88-Y92 WeakPolarHBondContact O-CB 3.28Å; L88-Y92 PolarHBondContact O-N 3.22Å; L90-Y92 VanDerWaalsContact C-N 3.3Å; L90-Y92 PolarHBondContact O-N 3.39Å; Y92-L94 VanDerWaalsContact C-N 3.34Å; Y92-L94 PolarHBondContact O-N 2.94Å; Y92-S95 PolarHBondContact O-N 2.88Å; Y92-S95 PolarHBondContact O-OG 3.23Å; Y92-V96 HydrophobicContact CE1-CG2 4.16Å; Y92-V96 HydrophobicContact CE2-CG2 4.44Å; Y92-V96 WeakPolarHBondContact O-CG2 3.4Å; Y92-V96 PolarHBondContact O-N 3.35Å
93	K	84.8	Confident	82.8	Confident	146 Å²	146	95.3 Å²	95.3	64%	0.635	49%	0.489	S	S	*	.	H	α-helix	trans	-59.7	-44	179.5	-76.5	-166.8	174.8	-162	0	112.5	R89 L90 V96 I97	R89-K93 PolarHBondContact O-N 3.1Å; L90-K93 PolarHBondContact O-N 3.42Å; K93-V96 PolarHBondContact O-N 3.45Å; K93-I97 WeakPolarHBondContact O-CD1 3.27Å; K93-I97 VanDerWaalsContact O-CG1 3.26Å; K93-I97 WeakPolarHBondContact O-CG1 3.37Å; K93-I97 PolarHBondContact O-N 3.06Å
94	L	81.2	Confident	81.8	Confident	59 Å²	59	103.8 Å²	103.8	31%	0.309	51%	0.513	S	S	.	.	H	α-helix	trans	-68.7	-38	-177.8	-153	146.8	0	0	0	110.7	L90 Q91 Y92 I97 L98 L106 F108	L90-L94 WeakPolarHBondContact O-CB 3.41Å; L90-L94 PolarHBondContact O-N 3.29Å; Q91-L94 PolarHBondContact O-N 3.32Å; Y92-L94 VanDerWaalsContact C-N 3.34Å; Y92-L94 PolarHBondContact O-N 2.94Å; L94-I97 PolarHBondContact O-N 3.4Å; L94-L98 HydrophobicContact CD2-CD1 3.98Å; L94-L98 WeakPolarHBondContact O-CB 3.43Å; L94-L98 PolarHBondContact O-N 3.44Å; L94-L106 HydrophobicContact CD2-CD1 3.61Å; L94-F108 HydrophobicContact CB-CZ 4.48Å; L94-F108 HydrophobicContact CD2-CZ 4Å
95	S	78.7	Confident	80.8	Confident	58 Å²	58	112.7 Å²	112.7	41%	0.406	54%	0.542	S	S	.	.	H	α-helix	trans	-63.3	-40.6	175	73.3	0	0	0	0	112.8	Q91 Y92 L99	Q91-S95 WeakPolarHBondContact O-CB 3.48Å; Q91-S95 PolarHBondContact O-N 3.29Å; Q91-S95 PolarHBondContact O-OG 3Å; Y92-S95 PolarHBondContact O-N 2.88Å; Y92-S95 PolarHBondContact O-OG 3.23Å; S95-L99 WeakPolarHBondContact O-CB 3.35Å; S95-L99 PolarHBondContact O-N 2.86Å
96	V	83.3	Confident	79.7	Confident	59 Å²	59	111.4 Å²	111.4	36%	0.358	54%	0.544	S	S	.	.	H	α-helix	trans	-65.6	-46.4	175.7	171.8	0	0	0	0	110.9	Y92 K93 L98 L99 L100	Y92-V96 HydrophobicContact CE1-CG2 4.16Å; Y92-V96 HydrophobicContact CE2-CG2 4.44Å; Y92-V96 WeakPolarHBondContact O-CG2 3.4Å; Y92-V96 PolarHBondContact O-N 3.35Å; K93-V96 PolarHBondContact O-N 3.45Å; V96-L98 VanDerWaalsContact C-N 3.34Å; V96-L98 PolarHBondContact O-N 3.27Å; V96-L99 PolarHBondContact O-N 3.48Å; V96-L100 HydrophobicContact CG1-CD1 3.88Å; V96-L100 PolarHBondContact O-N 3.48Å
97	I	84	Confident	78.8	Confident	103 Å²	103	114.9 Å²	114.9	53%	0.528	56%	0.56	S	S	.	*	H	α-helix	trans	-61.8	-43.6	178.6	-67.8	164	0	0	0	110.7	K93 L94 L99 L100 L101	K93-I97 WeakPolarHBondContact O-CD1 3.27Å; K93-I97 VanDerWaalsContact O-CG1 3.26Å; K93-I97 WeakPolarHBondContact O-CG1 3.37Å; K93-I97 PolarHBondContact O-N 3.06Å; L94-I97 PolarHBondContact O-N 3.4Å; I97-L99 VanDerWaalsContact C-N 3.33Å; I97-L99 PolarHBondContact O-N 3.39Å; I97-L100 PolarHBondContact O-N 2.84Å; I97-L101 WeakPolarHBondContact O-CB 3.36Å; I97-L101 PolarHBondContact O-N 3.46Å
98	L	81.4	Confident	78.3	Confident	27 Å²	27	114.6 Å²	114.6	14%	0.141	56%	0.559	C	S	.	*	H	α-helix	trans	-64.5	-39.2	179	-126.1	76.6	0	0	0	112.5	L94 V96 L100 L101 G102 H103 R104 L106	L94-L98 HydrophobicContact CD2-CD1 3.98Å; L94-L98 WeakPolarHBondContact O-CB 3.43Å; L94-L98 PolarHBondContact O-N 3.44Å; V96-L98 VanDerWaalsContact C-N 3.34Å; V96-L98 PolarHBondContact O-N 3.27Å; L98-L100 VanDerWaalsContact C-N 3.34Å; L98-L101 CarbonylContact O-C 3.57Å; L98-L101 PolarHBondContact O-N 2.87Å; L98-G102 PolarHBondContact O-N 3.35Å; L98-G102 VanDerWaalsContact O-N 3.09Å; L98-H103 HydrophobicContact CG-CB 4.28Å; L98-H103 PolarHBondContact O-N 3.4Å; L98-R104 WeakPolarHBondContact CD2-O 3.42Å; L98-L106 HydrophobicContact CD1-CD1 4.47Å; L98-L106 HydrophobicContact CD2-CG 4.45Å
99	L	80.2	Confident	78.1	Confident	139 Å²	139	111 Å²	111	73%	0.728	55%	0.55	S	S	*	.	H	α-helix	trans	-64.7	-40.4	176.9	-171.8	129.8	0	0	0	111.3	S95 V96 I97 L101 G102	S95-L99 WeakPolarHBondContact O-CB 3.35Å; S95-L99 PolarHBondContact O-N 2.86Å; V96-L99 PolarHBondContact O-N 3.48Å; I97-L99 VanDerWaalsContact C-N 3.33Å; I97-L99 PolarHBondContact O-N 3.39Å; L99-L101 VanDerWaalsContact C-N 3.34Å; L99-G102 PolarHBondContact O-N 3.49Å
100	L	80	Confident	77.7	Confident	142 Å²	142	108.8 Å²	108.8	74%	0.743	55%	0.554	S	S	*	*	H	α-helix	trans	-65.9	-33.9	172	-91.4	145.1	0	0	0	112.9	V96 I97 L98 G102	V96-L100 HydrophobicContact CG1-CD1 3.88Å; V96-L100 PolarHBondContact O-N 3.48Å; I97-L100 PolarHBondContact O-N 2.84Å; L98-L100 VanDerWaalsContact C-N 3.34Å; L100-G102 VanDerWaalsContact C-N 3.3Å
101	L	84.1	Confident	77.5	Confident	125 Å²	125	108.1 Å²	108.1	65%	0.654	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	-1.2	-178.7	-154.1	66.2	0	0	0	113.2	I97 L98 L99 H103	I97-L101 WeakPolarHBondContact O-CB 3.36Å; I97-L101 PolarHBondContact O-N 3.46Å; L98-L101 CarbonylContact O-C 3.57Å; L98-L101 PolarHBondContact O-N 2.87Å; L99-L101 VanDerWaalsContact C-N 3.34Å; L101-H103 PolarHBondContact O-N 2.84Å; L101-H103 VanDerWaalsContact O-N 3.1Å
102	G	79.4	Confident	77.5	Confident	73 Å²	73	109.8 Å²	109.8	75%	0.753	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	62.1	15.4	-178.2	0	0	0	0	0	114.1	L98 L99 L100	L98-G102 PolarHBondContact O-N 3.35Å; L98-G102 VanDerWaalsContact O-N 3.09Å; L99-G102 PolarHBondContact O-N 3.49Å; L100-G102 VanDerWaalsContact C-N 3.3Å
103	H	71.3	Confident	77.7	Confident	133 Å²	133	106.1 Å²	106.1	62%	0.616	55%	0.553	S	S	*	*	P	Polyproline II helix	trans	-94.8	149.3	-171.3	-134.1	72.3	0	0	0	111.8	L98 L101 R105	L98-H103 HydrophobicContact CG-CB 4.28Å; L98-H103 PolarHBondContact O-N 3.4Å; L101-H103 PolarHBondContact O-N 2.84Å; L101-H103 VanDerWaalsContact O-N 3.1Å; H103-R105 PolarHBondContact O-N 2.97Å
104	R	65.1	Low	77.7	Confident	227 Å²	227	104.8 Å²	104.8	86%	0.857	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-55.7	132.9	-175.5	-172.3	174.1	-178.8	162.2	0.2	111.6	L98 L106	L98-R104 WeakPolarHBondContact CD2-O 3.42Å; R104-L106 PolarHBondContact O-N 3.08Å
105	R	63.6	Low	77.9	Confident	212 Å²	212	104.4 Å²	104.4	80%	0.8	55%	0.548	S	S	*	.	P	Polyproline II helix	trans	-52.3	128.1	179.8	-63	-170	-167.1	-147.9	3.9	111.1	H103	H103-R105 PolarHBondContact O-N 2.97Å
106	L	64.8	Low	78.2	Confident	102 Å²	102	105.3 Å²	105.3	53%	0.534	55%	0.547	S	S	.	.	P	Polyproline II helix	trans	-74.2	125.2	169.9	-82.3	164.5	0	0	0	109.6	L94 L98 R104 F108	L94-L106 HydrophobicContact CD2-CD1 3.61Å; L98-L106 HydrophobicContact CD1-CD1 4.47Å; L98-L106 HydrophobicContact CD2-CG 4.45Å; R104-L106 PolarHBondContact O-N 3.08Å; L106-F108 HydrophobicContact CB-CE2 4.25Å; L106-F108 HydrophobicContact CB-CZ 4.34Å; L106-F108 VanDerWaalsContact O-CD2 3.25Å; L106-F108 WeakPolarHBondContact O-CD2 3.14Å; L106-F108 PolarHBondContact O-N 3.29Å
107	D	68.7	Low	78.5	Confident	152 Å²	152	109.8 Å²	109.8	81%	0.813	56%	0.559	S	S	*	*			trans	-78.2	98.9	179.1	-73.5	-42.1	0	0	0	110.8	G109	D107-G109 PolarHBondContact O-N 2.83Å
108	F	73.6	Confident	78.5	Confident	57 Å²	57	106.7 Å²	106.7	25%	0.25	55%	0.546	C	S	.	.	T	Hydrogen-bonded Turn	trans	-77	7.7	175.8	-65.4	-77.6	0	0	0	114.2	F87 Q91 L94 L106 V110 L111 N112	F87-F108 HydrophobicContact CE1-CD1 4.34Å; Q91-F108 HydrophobicContact CG-CD1 4.16Å; Q91-F108 HydrophobicContact CG-CD2 4.27Å; Q91-F108 HydrophobicContact CG-CE1 4.26Å; Q91-F108 HydrophobicContact CG-CE2 4.36Å; Q91-F108 HydrophobicContact CG-CG 4.15Å; Q91-F108 HydrophobicContact CG-CZ 4.34Å; L94-F108 HydrophobicContact CB-CZ 4.48Å; L94-F108 HydrophobicContact CD2-CZ 4Å; L106-F108 HydrophobicContact CB-CE2 4.25Å; L106-F108 HydrophobicContact CB-CZ 4.34Å; L106-F108 VanDerWaalsContact O-CD2 3.25Å; L106-F108 WeakPolarHBondContact O-CD2 3.14Å; L106-F108 PolarHBondContact O-N 3.29Å; F108-V110 VanDerWaalsContact C-N 3.33Å; F108-V110 PolarHBondContact O-N 3.39Å; F108-L111 HydrophobicContact CD1-CD1 4.49Å; F108-L111 PolarHBondContact O-N 2.8Å; F108-N112 PolarHBondContact O-N 2.81Å
109	G	80.3	Confident	78.7	Confident	39 Å²	39	108.6 Å²	108.6	40%	0.402	56%	0.555	S	S	.	*	H	α-helix	trans	-57.8	-40.8	-173.8	0	0	0	0	0	113.5	D107 N112 N113	D107-G109 PolarHBondContact O-N 2.83Å; G109-N112 PolarHBondContact O-N 3.32Å; G109-N113 WeakPolarHBondContact O-CB 3.36Å; G109-N113 VanDerWaalsContact O-CG 3.26Å; G109-N113 PolarHBondContact O-N 3.03Å; G109-N113 PolarHBondContact O-ND2 3.36Å
110	V	78.8	Confident	79.1	Confident	119 Å²	119	107.4 Å²	107.4	72%	0.721	55%	0.546	S	S	*	.	H	α-helix	trans	-64.1	-45.1	179.6	179.7	0	0	0	0	111.5	F108 N113 L114	F108-V110 VanDerWaalsContact C-N 3.33Å; F108-V110 PolarHBondContact O-N 3.39Å; V110-N113 PolarHBondContact O-N 3.41Å; V110-L114 WeakPolarHBondContact O-CB 3.43Å; V110-L114 PolarHBondContact O-N 3.4Å
111	L	78.8	Confident	79.5	Confident	84 Å²	84	104.7 Å²	104.7	44%	0.44	54%	0.535	S	S	.	.	H	α-helix	trans	-67.9	-37.6	179.8	-76.9	155	0	0	0	111.5	F87 F108 L114 F115	F87-L111 HydrophobicContact CE1-CB 3.9Å; F87-L111 HydrophobicContact CE1-CD1 4.5Å; F87-L111 HydrophobicContact CE2-CB 4.4Å; F87-L111 HydrophobicContact CE2-CD1 4.38Å; F87-L111 HydrophobicContact CE2-CD2 4.16Å; F87-L111 HydrophobicContact CZ-CB 3.47Å; F87-L111 VanDerWaalsContact CZ-CB 3.47Å; F87-L111 HydrophobicContact CZ-CD1 3.59Å; F87-L111 HydrophobicContact CZ-CD2 3.93Å; F87-L111 HydrophobicContact CZ-CG 3.81Å; F108-L111 HydrophobicContact CD1-CD1 4.49Å; F108-L111 PolarHBondContact O-N 2.8Å; L111-L114 PolarHBondContact O-N 2.9Å; L111-F115 WeakPolarHBondContact O-CB 3.36Å; L111-F115 PolarHBondContact O-N 3.02Å
112	N	82.9	Confident	79.6	Confident	82 Å²	82	99.2 Å²	99.2	44%	0.439	51%	0.507	S	S	.	.	H	α-helix	trans	-64.9	-45.3	174.3	-170	42.6	0	0	0	111.9	F108 G109 L114 F115 I116	F108-N112 PolarHBondContact O-N 2.81Å; G109-N112 PolarHBondContact O-N 3.32Å; N112-L114 PolarHBondContact O-N 2.88Å; N112-F115 WeakPolarHBondContact O-CB 3.24Å; N112-F115 PolarHBondContact O-N 3.22Å; N112-I116 VanDerWaalsContact O-CG1 3.31Å; N112-I116 WeakPolarHBondContact O-CG1 3.09Å; N112-I116 PolarHBondContact O-N 3.49Å
113	N	85.7	Confident	79.9	Confident	90 Å²	90	102.7 Å²	102.7	48%	0.481	51%	0.506	S	S	.	.	H	α-helix	trans	-60.7	-45.9	176.1	-73.6	-24.4	0	0	0	111.4	G109 V110 F115 I116 Y117	G109-N113 WeakPolarHBondContact O-CB 3.36Å; G109-N113 VanDerWaalsContact O-CG 3.26Å; G109-N113 PolarHBondContact O-N 3.03Å; G109-N113 PolarHBondContact O-ND2 3.36Å; V110-N113 PolarHBondContact O-N 3.41Å; N113-F115 VanDerWaalsContact C-N 3.26Å; N113-F115 PolarHBondContact O-N 3.07Å; N113-I116 PolarHBondContact O-N 3.31Å; N113-Y117 HydrophobicContact CB-CE2 4.43Å; N113-Y117 WeakPolarHBondContact O-CD2 3.32Å; N113-Y117 PolarHBondContact O-N 3.37Å
114	L	85.3	Confident	80.7	Confident	119 Å²	119	104.2 Å²	104.2	62%	0.623	51%	0.511	S	S	*	.	H	α-helix	trans	-57	-42	175.3	-170.2	78.8	0	0	0	111.4	V110 L111 N112 Y117 S118	V110-L114 WeakPolarHBondContact O-CB 3.43Å; V110-L114 PolarHBondContact O-N 3.4Å; L111-L114 PolarHBondContact O-N 2.9Å; N112-L114 PolarHBondContact O-N 2.88Å; L114-Y117 PolarHBondContact O-N 3.39Å; L114-S118 WeakPolarHBondContact O-CB 3.24Å; L114-S118 PolarHBondContact O-N 3.42Å
115	F	85.3	Confident	81.7	Confident	51 Å²	51	96.6 Å²	96.6	22%	0.224	49%	0.487	C	S	.	.	H	α-helix	trans	-64.8	-45.6	179.2	-160.7	-92.8	0	0	0	112.1	Q80 S83 A84 L111 N112 N113 Y117 S118 M119	Q80-F115 VanDerWaalsContact O-CZ 3.31Å; Q80-F115 WeakPolarHBondContact O-CZ 3.21Å; S83-F115 WeakPolarHBondContact OG-CE2 3.45Å; A84-F115 HydrophobicContact CB-CE1 3.89Å; A84-F115 HydrophobicContact CB-CE2 4.32Å; A84-F115 HydrophobicContact CB-CZ 3.51Å; L111-F115 WeakPolarHBondContact O-CB 3.36Å; L111-F115 PolarHBondContact O-N 3.02Å; N112-F115 WeakPolarHBondContact O-CB 3.24Å; N112-F115 PolarHBondContact O-N 3.22Å; N113-F115 VanDerWaalsContact C-N 3.26Å; N113-F115 PolarHBondContact O-N 3.07Å; F115-Y117 PolarHBondContact O-N 2.78Å; F115-S118 PolarHBondContact O-N 3.04Å; F115-S118 PolarHBondContact O-OG 2.92Å; F115-M119 HydrophobicContact CD1-CG 4.31Å; F115-M119 HydrophobicContact CE1-CE 3.45Å; F115-M119 VanDerWaalsContact CE1-CE 3.45Å; F115-M119 HydrophobicContact CE1-CG 4.03Å; F115-M119 HydrophobicContact CZ-CE 3.61Å; F115-M119 PolarHBondContact O-N 3.47Å
116	I	86.7	Confident	82.8	Confident	76 Å²	76	88.7 Å²	88.7	39%	0.39	46%	0.462	S	S	.	.	H	α-helix	trans	-60.7	-46	176.2	-66.5	164.2	0	0	0	110.8	N112 N113 S118 M119 Q120	N112-I116 VanDerWaalsContact O-CG1 3.31Å; N112-I116 WeakPolarHBondContact O-CG1 3.09Å; N112-I116 PolarHBondContact O-N 3.49Å; N113-I116 PolarHBondContact O-N 3.31Å; I116-S118 VanDerWaalsContact C-N 3.32Å; I116-S118 PolarHBondContact O-N 2.96Å; I116-M119 PolarHBondContact O-N 2.81Å; I116-Q120 PolarHBondContact O-N 3.05Å
117	Y	88.1	Confident	83.6	Confident	153 Å²	153	86.2 Å²	86.2	60%	0.6	46%	0.461	S	S	*	.	H	α-helix	trans	-61.4	-40.6	175.5	-76.8	-61.7	0	0	0	111.9	N113 L114 F115 M119 Q120 V121	N113-Y117 HydrophobicContact CB-CE2 4.43Å; N113-Y117 WeakPolarHBondContact O-CD2 3.32Å; N113-Y117 PolarHBondContact O-N 3.37Å; L114-Y117 PolarHBondContact O-N 3.39Å; F115-Y117 PolarHBondContact O-N 2.78Å; Y117-M119 VanDerWaalsContact C-N 3.29Å; Y117-M119 PolarHBondContact O-N 3.41Å; Y117-Q120 PolarHBondContact O-N 2.9Å; Y117-V121 WeakPolarHBondContact O-CG2 3.3Å; Y117-V121 PolarHBondContact O-N 2.81Å
118	S	84.7	Confident	84.3	Confident	38 Å²	38	80.6 Å²	80.6	27%	0.266	44%	0.439	S	S	.	.	H	α-helix	trans	-63.8	-34	178.1	80.9	0	0	0	0	113.1	Q80 L114 F115 I116 T122	Q80-S118 PolarHBondContact NE2-O 2.98Å; Q80-S118 PolarHBondContact NE2-OG 3.45Å; L114-S118 WeakPolarHBondContact O-CB 3.24Å; L114-S118 PolarHBondContact O-N 3.42Å; F115-S118 PolarHBondContact O-N 3.04Å; F115-S118 PolarHBondContact O-OG 2.92Å; I116-S118 VanDerWaalsContact C-N 3.32Å; I116-S118 PolarHBondContact O-N 2.96Å; S118-T122 WeakPolarHBondContact O-CG2 3.39Å; S118-T122 PolarHBondContact O-N 3.41Å; S118-T122 VanDerWaalsContact O-N 3.12Å; S118-T122 PolarHBondContact O-OG1 3.33Å
119	M	86.2	Confident	84.6	Confident	67 Å²	67	79.4 Å²	79.4	33%	0.33	44%	0.435	S	S	.	.	H	α-helix	trans	-70.1	-40.3	174.3	-75.2	-69.9	-171.2	0	0	111.5	Q80 F115 I116 Y117 T122 M123	Q80-M119 HydrophobicContact CB-CE 3.84Å; Q80-M119 HydrophobicContact CB-SD 4.41Å; Q80-M119 PolarHBondContact OE1-SD 3.44Å; F115-M119 HydrophobicContact CD1-CG 4.31Å; F115-M119 HydrophobicContact CE1-CE 3.45Å; F115-M119 VanDerWaalsContact CE1-CE 3.45Å; F115-M119 HydrophobicContact CE1-CG 4.03Å; F115-M119 HydrophobicContact CZ-CE 3.61Å; F115-M119 PolarHBondContact O-N 3.47Å; I116-M119 PolarHBondContact O-N 2.81Å; Y117-M119 VanDerWaalsContact C-N 3.29Å; Y117-M119 PolarHBondContact O-N 3.41Å; M119-T122 WeakPolarHBondContact CA-OG1 3.38Å; M119-T122 PolarHBondContact O-N 2.87Å; M119-T122 PolarHBondContact O-OG1 2.87Å; M119-M123 WeakPolarHBondContact O-CB 3.3Å; M119-M123 PolarHBondContact O-N 2.82Å
120	Q	88.3	Confident	84.6	Confident	114 Å²	114	78.6 Å²	78.6	53%	0.533	43%	0.427	S	S	.	.	H	α-helix	trans	-64.7	-42.9	176.1	-72.7	177.6	-10.4	0	0	112	I116 Y117 M123 F124	I116-Q120 PolarHBondContact O-N 3.05Å; Y117-Q120 PolarHBondContact O-N 2.9Å; Q120-M123 PolarHBondContact O-N 3.44Å; Q120-F124 WeakPolarHBondContact O-CB 3.37Å; Q120-F124 PolarHBondContact O-N 3.4Å
121	V	87.4	Confident	84.5	Confident	86 Å²	86	82.1 Å²	82.1	52%	0.521	43%	0.427	S	S	.	.	H	α-helix	trans	-63.7	-43.5	178.5	171.7	0	0	0	0	111.2	Y117 F124 L125	Y117-V121 WeakPolarHBondContact O-CG2 3.3Å; Y117-V121 PolarHBondContact O-N 2.81Å; V121-F124 PolarHBondContact O-N 3.46Å; V121-L125 HydrophobicContact CG1-CD1 3.98Å; V121-L125 WeakPolarHBondContact O-CB 3.03Å; V121-L125 PolarHBondContact O-N 3.48Å
122	T	86.9	Confident	84.2	Confident	10 Å²	10	80.7 Å²	80.7	6%	0.061	42%	0.424	C	S	.	.	H	α-helix	trans	-67.9	-39.5	178.1	48.2	0	0	0	0	112.6	Q80 S118 M119 F124 L125 V126	Q80-T122 PolarHBondContact OE1-OG1 2.94Å; Q80-T122 VanDerWaalsContact OE1-OG1 3.09Å; S118-T122 WeakPolarHBondContact O-CG2 3.39Å; S118-T122 PolarHBondContact O-N 3.41Å; S118-T122 VanDerWaalsContact O-N 3.12Å; S118-T122 PolarHBondContact O-OG1 3.33Å; M119-T122 WeakPolarHBondContact CA-OG1 3.38Å; M119-T122 PolarHBondContact O-N 2.87Å; M119-T122 PolarHBondContact O-OG1 2.87Å; T122-F124 VanDerWaalsContact C-N 3.34Å; T122-F124 PolarHBondContact O-N 3.5Å; T122-L125 PolarHBondContact O-N 2.83Å; T122-V126 WeakPolarHBondContact O-CG2 3.25Å; T122-V126 PolarHBondContact O-N 3.4Å
123	M	86.4	Confident	83.6	Confident	146 Å²	146	80.8 Å²	80.8	72%	0.719	42%	0.42	S	S	*	.	H	α-helix	trans	-61.1	-42.8	173.5	-175.8	178.9	151.1	0	0	111.7	M119 Q120 V126 G127	M119-M123 WeakPolarHBondContact O-CB 3.3Å; M119-M123 PolarHBondContact O-N 2.82Å; Q120-M123 PolarHBondContact O-N 3.44Å; M123-V126 PolarHBondContact O-N 2.86Å; M123-G127 PolarHBondContact O-N 2.82Å
124	F	87.5	Confident	83	Confident	164 Å²	164	83.4 Å²	83.4	72%	0.719	43%	0.432	S	S	*	.	H	α-helix	trans	-63.9	-43.4	174.6	-176.3	-97.3	0	0	0	112	Q120 V121 T122 V126 G127 G128	Q120-F124 WeakPolarHBondContact O-CB 3.37Å; Q120-F124 PolarHBondContact O-N 3.4Å; V121-F124 PolarHBondContact O-N 3.46Å; T122-F124 VanDerWaalsContact C-N 3.34Å; T122-F124 PolarHBondContact O-N 3.5Å; F124-V126 PolarHBondContact O-N 2.92Å; F124-G127 PolarHBondContact O-N 3.34Å; F124-G128 PolarHBondContact O-N 3.22Å
125	L	86.7	Confident	82.4	Confident	68 Å²	68	81.2 Å²	81.2	36%	0.356	42%	0.423	S	S	.	.	H	α-helix	trans	-61.1	-42.1	177.3	-112.6	93.3	0	0	0	112	L73 V121 T122 G128 L129	L73-L125 HydrophobicContact CD2-CB 3.8Å; L73-L125 HydrophobicContact CD2-CD2 3.79Å; L73-L125 HydrophobicContact CD2-CG 4.44Å; L73-L125 HydrophobicContact CG-CD2 4.49Å; V121-L125 HydrophobicContact CG1-CD1 3.98Å; V121-L125 WeakPolarHBondContact O-CB 3.03Å; V121-L125 PolarHBondContact O-N 3.48Å; T122-L125 PolarHBondContact O-N 2.83Å; L125-G128 PolarHBondContact O-N 3.33Å; L125-L129 HydrophobicContact CB-CD1 4.38Å; L125-L129 HydrophobicContact CD2-CD1 3.78Å; L125-L129 HydrophobicContact CG-CD1 4.14Å; L125-L129 WeakPolarHBondContact O-CB 3.1Å; L125-L129 WeakPolarHBondContact O-CG 3.06Å; L125-L129 PolarHBondContact O-N 2.87Å
126	V	84.8	Confident	81.4	Confident	46 Å²	46	82.8 Å²	82.8	28%	0.279	43%	0.43	S	S	.	.	H	α-helix	trans	-63	-43.4	178.2	170.2	0	0	0	0	111.1	W70 L73 F77 T122 M123 F124 G130	W70-V126 HydrophobicContact CH2-CG1 4.43Å; L73-V126 HydrophobicContact CD1-CG2 4.17Å; L73-V126 HydrophobicContact CD2-CG2 4.27Å; F77-V126 HydrophobicContact CD2-CG2 4.21Å; F77-V126 HydrophobicContact CE2-CG2 3.32Å; F77-V126 HydrophobicContact CZ-CG2 3.97Å; T122-V126 WeakPolarHBondContact O-CG2 3.25Å; T122-V126 PolarHBondContact O-N 3.4Å; M123-V126 PolarHBondContact O-N 2.86Å; F124-V126 PolarHBondContact O-N 2.92Å; V126-G130 PolarHBondContact O-N 3.44Å
127	G	82.8	Confident	80.2	Confident	50 Å²	50	84.3 Å²	84.3	52%	0.515	44%	0.443	S	S	.	.	H	α-helix	trans	-62.4	-47.8	176.2	0	0	0	0	0	112.5	M123 F124 W131	M123-G127 PolarHBondContact O-N 2.82Å; F124-G127 PolarHBondContact O-N 3.34Å; G127-W131 PolarHBondContact O-N 3.41Å
128	G	82.8	Confident	78.7	Confident	34 Å²	34	84.4 Å²	84.4	35%	0.351	45%	0.453	S	S	.	.	H	α-helix	trans	-66.7	-46.4	-180	0	0	0	0	0	113.3	F124 L125 G130 W131 C132	F124-G128 PolarHBondContact O-N 3.22Å; L125-G128 PolarHBondContact O-N 3.33Å; G128-G130 VanDerWaalsContact C-N 3.35Å; G128-W131 PolarHBondContact O-N 2.88Å; G128-C132 PolarHBondContact O-N 3.42Å; G128-C132 PolarHBondContact O-SG 3.47Å
129	L	80.6	Confident	77.4	Confident	31 Å²	31	91.4 Å²	91.4	16%	0.162	48%	0.484	C	S	.	.	H	α-helix	trans	-71.3	-29.3	179.9	-75.1	162.2	0	0	0	112.5	L69 L73 L125 W131 C132 F133	L69-L129 HydrophobicContact CB-CD2 4.43Å; L69-L129 HydrophobicContact CD1-CD2 4.02Å; L73-L129 HydrophobicContact CD1-CB 4.13Å; L73-L129 HydrophobicContact CD1-CD1 3.36Å; L73-L129 HydrophobicContact CD1-CG 4.35Å; L73-L129 HydrophobicContact CG-CD1 4.11Å; L125-L129 HydrophobicContact CB-CD1 4.38Å; L125-L129 HydrophobicContact CD2-CD1 3.78Å; L125-L129 HydrophobicContact CG-CD1 4.14Å; L125-L129 WeakPolarHBondContact O-CB 3.1Å; L125-L129 WeakPolarHBondContact O-CG 3.06Å; L125-L129 PolarHBondContact O-N 2.87Å; L129-W131 VanDerWaalsContact C-N 3.34Å; L129-C132 PolarHBondContact O-N 2.95Å; L129-F133 PolarHBondContact O-N 3.07Å
130	G	79.7	Confident	76.9	Confident	23 Å²	23	92.6 Å²	92.6	24%	0.237	49%	0.492	C	S	.	.	H	α-helix	trans	-62.8	-40.3	169.8	0	0	0	0	0	112.5	V126 G128 F133 M134	V126-G130 PolarHBondContact O-N 3.44Å; G128-G130 VanDerWaalsContact C-N 3.35Å; G130-F133 WeakPolarHBondContact O-CB 3.43Å; G130-F133 PolarHBondContact O-N 3.29Å; G130-M134 PolarHBondContact O-N 3.48Å
131	W	77.6	Confident	76.3	Confident	192 Å²	192	91.5 Å²	91.5	73%	0.727	49%	0.49	S	S	*	.	H	α-helix	trans	-67.5	-41.8	175.1	-165.5	58.9	0	0	0	112.2	G127 G128 L129 F133 M134 V135	G127-W131 PolarHBondContact O-N 3.41Å; G128-W131 PolarHBondContact O-N 2.88Å; L129-W131 VanDerWaalsContact C-N 3.34Å; W131-F133 PolarHBondContact O-N 3.13Å; W131-M134 PolarHBondContact O-N 3.13Å; W131-V135 PolarHBondContact O-N 2.71Å
132	C	72.3	Confident	75.7	Confident	55 Å²	55	91.8 Å²	91.8	37%	0.372	49%	0.488	S	S	.	.	H	α-helix	trans	-58.1	-35.8	172	-68.5	0	0	0	0	112.3	G128 L129 V135 F136	G128-C132 PolarHBondContact O-N 3.42Å; G128-C132 PolarHBondContact O-SG 3.47Å; L129-C132 PolarHBondContact O-N 2.95Å; C132-V135 PolarHBondContact O-N 2.95Å; C132-F136 WeakPolarHBondContact O-CD2 3.47Å; C132-F136 PolarHBondContact O-N 3.02Å
133	F	70.9	Confident	75.1	Confident	83 Å²	83	96.6 Å²	96.6	36%	0.364	51%	0.513	S	S	.	.	H	α-helix	trans	-65.8	-41.9	178.1	-151.6	-91.4	0	0	0	112.3	W70 L129 G130 W131 V135 F136 V137	W70-F133 AromaticContact CD1-CD2 3.53Å; W70-F133 AromaticContact CD1-CE2 3.91Å; W70-F133 AromaticContact NE1-CD2 3.5Å; W70-F133 AromaticContact NE1-CG 3.92Å; L129-F133 PolarHBondContact O-N 3.07Å; G130-F133 WeakPolarHBondContact O-CB 3.43Å; G130-F133 PolarHBondContact O-N 3.29Å; W131-F133 PolarHBondContact O-N 3.13Å; F133-V135 VanDerWaalsContact C-N 3.33Å; F133-V135 PolarHBondContact O-N 2.73Å; F133-F136 PolarHBondContact O-N 3.02Å; F133-V137 HydrophobicContact CD1-CG2 3.85Å; F133-V137 HydrophobicContact CE1-CG2 3.88Å; F133-V137 VanDerWaalsContact O-CG2 3.28Å; F133-V137 WeakPolarHBondContact O-CG2 3.44Å; F133-V137 PolarHBondContact O-N 2.82Å; F133-V137 VanDerWaalsContact O-N 3.1Å
134	M	72.6	Confident	74.4	Confident	145 Å²	145	93.5 Å²	93.5	71%	0.714	50%	0.5	S	S	*	.	H	α-helix	trans	-62.9	-39	177.1	-76.1	-148.1	141.7	0	0	112.6	G130 W131 F136 V137 D138	G130-M134 PolarHBondContact O-N 3.48Å; W131-M134 PolarHBondContact O-N 3.13Å; M134-F136 VanDerWaalsContact C-N 3.31Å; M134-F136 PolarHBondContact O-N 3.15Å; M134-V137 PolarHBondContact O-N 3.32Å; M134-D138 PolarHBondContact O-N 3.49Å
135	V	72.3	Confident	73.5	Confident	73 Å²	73	88.8 Å²	88.8	44%	0.442	49%	0.486	S	S	.	.	H	α-helix	trans	-64.9	-35.3	178.1	175.9	0	0	0	0	112.1	W131 C132 F133	W131-V135 PolarHBondContact O-N 2.71Å; C132-V135 PolarHBondContact O-N 2.95Å; F133-V135 VanDerWaalsContact C-N 3.33Å; F133-V135 PolarHBondContact O-N 2.73Å
136	F	63.4	Low	72.5	Confident	84 Å²	84	90.3 Å²	90.3	37%	0.368	50%	0.495	S	S	.	.	H	α-helix	trans	-79.4	-25.5	178.3	-87.7	-74.2	0	0	0	114	C62 T66 C132 F133 M134 D138	C62-F136 HydrophobicContact CB-CD1 4.15Å; C62-F136 HydrophobicContact CB-CE1 3.4Å; C62-F136 HydrophobicContact CB-CE2 4.47Å; C62-F136 HydrophobicContact CB-CZ 3.6Å; T66-F136 HydrophobicContact CG2-CD2 4.19Å; T66-F136 HydrophobicContact CG2-CE2 4.42Å; C132-F136 WeakPolarHBondContact O-CD2 3.47Å; C132-F136 PolarHBondContact O-N 3.02Å; F133-F136 PolarHBondContact O-N 3.02Å; M134-F136 VanDerWaalsContact C-N 3.31Å; M134-F136 PolarHBondContact O-N 3.15Å; F136-D138 VanDerWaalsContact C-N 3.35Å
137	V	61.7	Low	71.6	Confident	109 Å²	109	93.7 Å²	93.7	66%	0.661	51%	0.511	S	S	*	.	H	α-helix	trans	-75	-27.9	174.7	171.3	0	0	0	0	111.6	F133 M134	F133-V137 HydrophobicContact CD1-CG2 3.85Å; F133-V137 HydrophobicContact CE1-CG2 3.88Å; F133-V137 VanDerWaalsContact O-CG2 3.28Å; F133-V137 WeakPolarHBondContact O-CG2 3.44Å; F133-V137 PolarHBondContact O-N 2.82Å; F133-V137 VanDerWaalsContact O-N 3.1Å; M134-V137 PolarHBondContact O-N 3.32Å
138	D	57.4	Low	70.7	Confident	154 Å²	154	97.3 Å²	97.3	82%	0.824	51%	0.511	S	S	*	.			trans	-87.2	-10.5	-177.5	-148.1	6.9	0	0	0	113.8	M134 F136	M134-D138 PolarHBondContact O-N 3.49Å; F136-D138 VanDerWaalsContact C-N 3.35Å
139	M	56.8	Low	69.6	Low	185 Å²	185	103.1 Å²	103.1	91%	0.911	53%	0.526	S	S	*	.			trans	-93.9	0	179.4	-91.3	-93.5	174.3	0	0	112.9

Retrieved 139 of 139 residues in 479.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).