A0A060YBI9_ONCMY Loading...

Iron-binding zinc finger CDGSH type domain-containing protein

Regulator of autophagy that contributes to antagonize becn1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of bcl2 with becn1 and is required for bcl2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy.

AlphaFold DB , UniProt , Accession A0A060YBI9, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene cisd1, Length 106 aa.

						>A0A060YBI9_ONCMY|A0A060YBI9|cisd1
MSSNVSLSKAELAAAIGVTAGATAAGILLFQYLSKGSGVKPKVNLDLQKDNPKVVHAFDIEDLGDKAVYCRCWRSKKFPYCDGAHAKHNQETGDNVGPLIIKRKEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.9	Very low	67.2	Low	240 Å²	240	125.7 Å²	125.7	100%	1.182	73%	0.725	S	S	*	*				0	96.6	0	-82.4	149.8	132.6	0	0	107.5
2	S	47.8	Very low	68.4	Low	118 Å²	118	123.3 Å²	123.3	83%	0.825	71%	0.706	S	S	*	*			trans	-99.6	107.3	172.8	-64.2	0	0	0	0	107.6	N4	S2-N4 PolarHBondContact O-N 3.43Å
3	S	54.8	Low	69.6	Low	108 Å²	108	118.5 Å²	118.5	76%	0.755	69%	0.691	S	S	*	*			trans	-74.4	110.6	174.6	-43.7	0	0	0	0	108.2	V5	S3-V5 PolarHBondContact O-N 3.33Å
4	N	59.3	Low	70.8	Confident	161 Å²	161	114.2 Å²	114.2	86%	0.861	68%	0.676	S	S	*	*			trans	-75.4	109.6	168.7	-82.9	-48.3	0	0	0	108.2	S2	S2-N4 PolarHBondContact O-N 3.43Å
5	V	65.6	Low	71.8	Confident	120 Å²	120	109.7 Å²	109.7	73%	0.727	66%	0.657	S	S	*	*			trans	-87.9	110.9	174	-179.1	0	0	0	0	108.1	S3 L7	S3-V5 PolarHBondContact O-N 3.33Å; V5-L7 HydrophobicContact CG1-CD1 4.14Å
6	S	71.6	Confident	72.9	Confident	115 Å²	115	109.5 Å²	109.5	80%	0.804	65%	0.65	S	S	*	*			trans	-87.3	104.6	172.1	60.9	0	0	0	0	109.6
7	L	71	Confident	73.8	Confident	99 Å²	99	105.8 Å²	105.8	52%	0.518	64%	0.639	S	S	.	*			trans	-76.4	131.1	179.6	-133.7	76.1	0	0	0	110.5	V5 E11 L12	V5-L7 HydrophobicContact CG1-CD1 4.14Å; L7-E11 HydrophobicContact CD1-CB 4.46Å; L7-E11 HydrophobicContact CD2-CB 3.99Å; L7-E11 HydrophobicContact CG-CB 3.71Å; L7-L12 HydrophobicContact CD2-CB 4.47Å
8	S	82.4	Confident	74.8	Confident	54 Å²	54	105.8 Å²	105.8	38%	0.378	64%	0.64	S	S	.	*			trans	-69.7	158.4	175.1	71.3	0	0	0	0	111.4	A10 E11 L12	S8-A10 PolarHBondContact O-N 3.3Å; S8-A10 VanDerWaalsContact O-N 3.16Å; S8-E11 VanDerWaalsContact CB-OE2 3.27Å; S8-E11 WeakPolarHBondContact CB-OE2 3.08Å; S8-E11 PolarHBondContact N-OE2 2.9Å; S8-E11 PolarHBondContact O-N 3.43Å; S8-E11 WeakPolarHBondContact OG-CG 3.4Å; S8-E11 PolarHBondContact OG-N 3.48Å; S8-E11 PolarHBondContact OG-OE2 2.91Å; S8-L12 PolarHBondContact O-N 3.25Å
9	K	79.7	Confident	75.6	Confident	194 Å²	194	104.8 Å²	104.8	84%	0.843	63%	0.634	S	S	*	*	H	α-helix	trans	-56.2	-31.8	175	-67	-178.7	178.7	178.8	0	112.4	A13	K9-A13 WeakPolarHBondContact O-CB 3.36Å; K9-A13 PolarHBondContact O-N 3.02Å
10	A	83.3	Confident	76.5	Confident	73 Å²	73	102.6 Å²	102.6	60%	0.603	63%	0.627	S	S	*	*	H	α-helix	trans	-72.9	-42.9	178.8	0	0	0	0	0	112.1	S8 L12 A13 A14	S8-A10 PolarHBondContact O-N 3.3Å; S8-A10 VanDerWaalsContact O-N 3.16Å; A10-L12 VanDerWaalsContact C-N 3.34Å; A10-A13 PolarHBondContact O-N 3.37Å; A10-A14 WeakPolarHBondContact O-CB 3.41Å; A10-A14 PolarHBondContact O-N 3.13Å
11	E	80.9	Confident	77.2	Confident	101 Å²	101	99.8 Å²	99.8	47%	0.472	62%	0.619	S	S	.	*	H	α-helix	trans	-65.7	-37.9	175.3	-71.3	164.3	124.8	0	0	111.7	L7 S8 A14 A15	L7-E11 HydrophobicContact CD1-CB 4.46Å; L7-E11 HydrophobicContact CD2-CB 3.99Å; L7-E11 HydrophobicContact CG-CB 3.71Å; S8-E11 VanDerWaalsContact CB-OE2 3.27Å; S8-E11 WeakPolarHBondContact CB-OE2 3.08Å; S8-E11 PolarHBondContact N-OE2 2.9Å; S8-E11 PolarHBondContact O-N 3.43Å; S8-E11 WeakPolarHBondContact OG-CG 3.4Å; S8-E11 PolarHBondContact OG-N 3.48Å; S8-E11 PolarHBondContact OG-OE2 2.91Å; E11-A14 PolarHBondContact O-N 3.39Å; E11-A15 WeakPolarHBondContact O-CB 3.49Å; E11-A15 PolarHBondContact O-N 2.9Å
12	L	82.1	Confident	79.7	Confident	96 Å²	96	91.4 Å²	91.4	50%	0.503	59%	0.588	S	S	.	*	H	α-helix	trans	-65	-43.8	174.1	-174.3	62.1	0	0	0	111.7	L7 S8 A10 A15 I16	L7-L12 HydrophobicContact CD2-CB 4.47Å; S8-L12 PolarHBondContact O-N 3.25Å; A10-L12 VanDerWaalsContact C-N 3.34Å; L12-A15 PolarHBondContact O-N 2.9Å; L12-I16 HydrophobicContact CD1-CD1 4.36Å; L12-I16 HydrophobicContact CG-CD1 4.1Å; L12-I16 VanDerWaalsContact O-CG1 3.27Å; L12-I16 WeakPolarHBondContact O-CG1 3.48Å; L12-I16 PolarHBondContact O-N 3.44Å
13	A	83.1	Confident	81.9	Confident	62 Å²	62	89.5 Å²	89.5	51%	0.512	57%	0.572	S	S	.	*	H	α-helix	trans	-64.3	-41.2	176.8	0	0	0	0	0	112.2	K9 A10 I16 G17	K9-A13 WeakPolarHBondContact O-CB 3.36Å; K9-A13 PolarHBondContact O-N 3.02Å; A10-A13 PolarHBondContact O-N 3.37Å; A13-I16 PolarHBondContact O-N 3.02Å; A13-G17 PolarHBondContact O-N 2.93Å
14	A	87.2	Confident	83.9	Confident	58 Å²	58	86.8 Å²	86.8	48%	0.479	56%	0.555	S	S	.	*	H	α-helix	trans	-63.6	-44.8	175.7	0	0	0	0	0	111.7	A10 E11 I16 G17 V18	A10-A14 WeakPolarHBondContact O-CB 3.41Å; A10-A14 PolarHBondContact O-N 3.13Å; E11-A14 PolarHBondContact O-N 3.39Å; A14-I16 PolarHBondContact O-N 3.03Å; A14-G17 PolarHBondContact O-N 2.77Å; A14-V18 WeakPolarHBondContact O-CG2 3.33Å; A14-V18 PolarHBondContact O-N 2.85Å
15	A	86.1	Confident	85.6	Confident	47 Å²	47	82 Å²	82	39%	0.388	54%	0.538	S	S	.	.	H	α-helix	trans	-61.5	-41.9	177.5	0	0	0	0	0	112.3	E11 L12 T19	E11-A15 WeakPolarHBondContact O-CB 3.49Å; E11-A15 PolarHBondContact O-N 2.9Å; L12-A15 PolarHBondContact O-N 2.9Å; A15-T19 WeakPolarHBondContact O-CB 3.45Å; A15-T19 PolarHBondContact O-N 2.83Å; A15-T19 PolarHBondContact O-OG1 2.84Å
16	I	88.1	Confident	87	Confident	106 Å²	106	78.2 Å²	78.2	54%	0.544	52%	0.523	S	S	.	.	H	α-helix	trans	-64.4	-46.1	176.2	-67.9	165.7	0	0	0	110.8	L12 A13 A14 V18 T19 A20	L12-I16 HydrophobicContact CD1-CD1 4.36Å; L12-I16 HydrophobicContact CG-CD1 4.1Å; L12-I16 VanDerWaalsContact O-CG1 3.27Å; L12-I16 WeakPolarHBondContact O-CG1 3.48Å; L12-I16 PolarHBondContact O-N 3.44Å; A13-I16 PolarHBondContact O-N 3.02Å; A14-I16 PolarHBondContact O-N 3.03Å; I16-V18 PolarHBondContact O-N 3.5Å; I16-T19 PolarHBondContact O-N 3.15Å; I16-A20 VanDerWaalsContact O-CB 3.31Å; I16-A20 WeakPolarHBondContact O-CB 3.46Å; I16-A20 PolarHBondContact O-N 3.37Å
17	G	88.7	Confident	88.1	Confident	46 Å²	46	76.8 Å²	76.8	47%	0.474	51%	0.506	S	S	.	.	H	α-helix	trans	-60.3	-45.4	178.9	0	0	0	0	0	112.9	A13 A14 G21	A13-G17 PolarHBondContact O-N 2.93Å; A14-G17 PolarHBondContact O-N 2.77Å; G17-G21 PolarHBondContact O-N 2.86Å
18	V	91.9	Very high	89.2	Confident	107 Å²	107	77.4 Å²	77.4	65%	0.648	51%	0.509	S	S	*	.	H	α-helix	trans	-63.8	-44.7	177.4	172.2	0	0	0	0	111	A14 I16 G21 A22	A14-V18 WeakPolarHBondContact O-CG2 3.33Å; A14-V18 PolarHBondContact O-N 2.85Å; I16-V18 PolarHBondContact O-N 3.5Å; V18-G21 PolarHBondContact O-N 2.78Å; V18-A22 WeakPolarHBondContact O-CB 3.44Å; V18-A22 PolarHBondContact O-N 3.17Å
19	T	90.2	Very high	89.7	Confident	87 Å²	87	79.7 Å²	79.7	53%	0.534	52%	0.516	S	S	.	.	H	α-helix	trans	-65	-45.6	-179.7	-53.2	0	0	0	0	111.1	A15 I16 G21 A22 T23	A15-T19 WeakPolarHBondContact O-CB 3.45Å; A15-T19 PolarHBondContact O-N 2.83Å; A15-T19 PolarHBondContact O-OG1 2.84Å; I16-T19 PolarHBondContact O-N 3.15Å; T19-G21 PolarHBondContact O-N 2.91Å; T19-A22 PolarHBondContact O-N 2.71Å; T19-T23 WeakPolarHBondContact O-CB 3.45Å; T19-T23 PolarHBondContact O-N 3.43Å; T19-T23 PolarHBondContact O-OG1 3.32Å
20	A	92.4	Very high	90.1	Very high	59 Å²	59	77.1 Å²	77.1	49%	0.488	51%	0.506	S	S	.	.	H	α-helix	trans	-62.2	-44.9	178	0	0	0	0	0	111.7	I16 T23 A24	I16-A20 VanDerWaalsContact O-CB 3.31Å; I16-A20 WeakPolarHBondContact O-CB 3.46Å; I16-A20 PolarHBondContact O-N 3.37Å; A20-T23 PolarHBondContact O-N 3.15Å; A20-A24 WeakPolarHBondContact O-CB 3.44Å; A20-A24 PolarHBondContact O-N 3.44Å
21	G	92.6	Very high	90.4	Very high	44 Å²	44	79 Å²	79	45%	0.454	50%	0.502	S	S	.	.	H	α-helix	trans	-62.5	-46.7	177.7	0	0	0	0	0	112.9	G17 V18 T19 T23 A24 A25	G17-G21 PolarHBondContact O-N 2.86Å; V18-G21 PolarHBondContact O-N 2.78Å; T19-G21 PolarHBondContact O-N 2.91Å; G21-T23 PolarHBondContact O-N 3.48Å; G21-A24 PolarHBondContact O-N 2.96Å; G21-A25 WeakPolarHBondContact O-CB 3.48Å; G21-A25 PolarHBondContact O-N 3.15Å
22	A	95.3	Very high	90.6	Very high	65 Å²	65	82.8 Å²	82.8	54%	0.537	51%	0.513	S	S	.	.	H	α-helix	trans	-63.5	-41	178.2	0	0	0	0	0	112.1	V18 T19 A25 G26	V18-A22 WeakPolarHBondContact O-CB 3.44Å; V18-A22 PolarHBondContact O-N 3.17Å; T19-A22 PolarHBondContact O-N 2.71Å; A22-A25 PolarHBondContact O-N 2.76Å; A22-G26 PolarHBondContact O-N 3.23Å
23	T	94.7	Very high	90.8	Very high	78 Å²	78	84.2 Å²	84.2	48%	0.479	52%	0.521	S	S	.	.	H	α-helix	trans	-66.7	-44.4	178.6	-45.2	0	0	0	0	111.1	T19 A20 G21 G26 I27	T19-T23 WeakPolarHBondContact O-CB 3.45Å; T19-T23 PolarHBondContact O-N 3.43Å; T19-T23 PolarHBondContact O-OG1 3.32Å; A20-T23 PolarHBondContact O-N 3.15Å; G21-T23 PolarHBondContact O-N 3.48Å; T23-G26 PolarHBondContact O-N 3.11Å; T23-I27 HydrophobicContact CG2-CD1 4.06Å; T23-I27 VanDerWaalsContact O-CG1 3.29Å; T23-I27 WeakPolarHBondContact O-CG1 3.44Å; T23-I27 PolarHBondContact O-N 2.75Å
24	A	95.9	Very high	90.6	Very high	50 Å²	50	84.5 Å²	84.5	41%	0.413	52%	0.519	S	S	.	.	H	α-helix	trans	-62.2	-44.8	177	0	0	0	0	0	111.8	A20 G21 I27 L28	A20-A24 WeakPolarHBondContact O-CB 3.44Å; A20-A24 PolarHBondContact O-N 3.44Å; G21-A24 PolarHBondContact O-N 2.96Å; A24-I27 PolarHBondContact O-N 3.45Å; A24-L28 WeakPolarHBondContact O-CB 3.44Å; A24-L28 VanDerWaalsContact O-CG 3.31Å; A24-L28 WeakPolarHBondContact O-CG 3.49Å; A24-L28 PolarHBondContact O-N 3.46Å
25	A	95.4	Very high	89.8	Confident	61 Å²	61	90 Å²	90	50%	0.504	53%	0.532	S	S	.	.	H	α-helix	trans	-62.5	-42.4	175.9	0	0	0	0	0	112	G21 A22 L28 L29	G21-A25 WeakPolarHBondContact O-CB 3.48Å; G21-A25 PolarHBondContact O-N 3.15Å; A22-A25 PolarHBondContact O-N 2.76Å; A25-L28 PolarHBondContact O-N 3.43Å; A25-L29 WeakPolarHBondContact O-CB 3.2Å; A25-L29 PolarHBondContact O-N 3.41Å
26	G	95.4	Very high	88.6	Confident	40 Å²	40	90.9 Å²	90.9	41%	0.412	55%	0.546	S	S	.	.	H	α-helix	trans	-62.2	-43.4	176.4	0	0	0	0	0	112.9	A22 T23 L29 F30	A22-G26 PolarHBondContact O-N 3.23Å; T23-G26 PolarHBondContact O-N 3.11Å; G26-L29 PolarHBondContact O-N 3.45Å; G26-F30 VanDerWaalsContact O-CB 3.32Å; G26-F30 WeakPolarHBondContact O-CB 3.21Å; G26-F30 PolarHBondContact O-N 3.39Å
27	I	94.1	Very high	87.3	Confident	86 Å²	86	90.7 Å²	90.7	44%	0.441	55%	0.553	S	S	.	*	H	α-helix	trans	-64.3	-45.9	176.6	-69.3	166.6	0	0	0	110.8	T23 A24 L29 F30 Q31	T23-I27 HydrophobicContact CG2-CD1 4.06Å; T23-I27 VanDerWaalsContact O-CG1 3.29Å; T23-I27 WeakPolarHBondContact O-CG1 3.44Å; T23-I27 PolarHBondContact O-N 2.75Å; A24-I27 PolarHBondContact O-N 3.45Å; I27-L29 PolarHBondContact O-N 2.75Å; I27-F30 PolarHBondContact O-N 2.86Å; I27-Q31 HydrophobicContact CG2-CG 4.37Å; I27-Q31 WeakPolarHBondContact O-CB 3.44Å; I27-Q31 VanDerWaalsContact O-CG 3.3Å; I27-Q31 WeakPolarHBondContact O-CG 3.42Å; I27-Q31 PolarHBondContact O-N 3.41Å
28	L	93.9	Very high	86.2	Confident	111 Å²	111	92.5 Å²	92.5	58%	0.581	57%	0.572	S	S	*	*	H	α-helix	trans	-63.5	-42.2	179	-72.5	172.5	0	0	0	111.8	A24 A25 Q31 Y32	A24-L28 WeakPolarHBondContact O-CB 3.44Å; A24-L28 VanDerWaalsContact O-CG 3.31Å; A24-L28 WeakPolarHBondContact O-CG 3.49Å; A24-L28 PolarHBondContact O-N 3.46Å; A25-L28 PolarHBondContact O-N 3.43Å; L28-Q31 PolarHBondContact O-N 3.26Å; L28-Y32 WeakPolarHBondContact O-CB 3.48Å; L28-Y32 PolarHBondContact O-N 3.49Å
29	L	92.8	Very high	85.5	Confident	102 Å²	102	93 Å²	93	53%	0.534	58%	0.575	S	S	.	*	H	α-helix	trans	-62.9	-45	174.9	-177.6	62.1	0	0	0	111	A25 G26 I27 Q31 Y32 L33	A25-L29 WeakPolarHBondContact O-CB 3.2Å; A25-L29 PolarHBondContact O-N 3.41Å; G26-L29 PolarHBondContact O-N 3.45Å; I27-L29 PolarHBondContact O-N 2.75Å; L29-Q31 PolarHBondContact O-N 3.16Å; L29-Y32 PolarHBondContact O-N 2.81Å; L29-L33 HydrophobicContact CD1-CD1 4.11Å; L29-L33 HydrophobicContact CD1-CG 4.18Å; L29-L33 HydrophobicContact CG-CD1 3.94Å; L29-L33 HydrophobicContact CG-CG 4.4Å; L29-L33 WeakPolarHBondContact O-CB 3.27Å; L29-L33 VanDerWaalsContact O-CG 3.25Å; L29-L33 WeakPolarHBondContact O-CG 3.27Å; L29-L33 PolarHBondContact O-N 3.47Å
30	F	88.5	Confident	85.1	Confident	141 Å²	141	97.7 Å²	97.7	62%	0.618	59%	0.588	S	S	*	*	H	α-helix	trans	-60.9	-44.4	177	177.7	-100.9	0	0	0	112.1	G26 I27 L33 S34	G26-F30 VanDerWaalsContact O-CB 3.32Å; G26-F30 WeakPolarHBondContact O-CB 3.21Å; G26-F30 PolarHBondContact O-N 3.39Å; I27-F30 PolarHBondContact O-N 2.86Å; F30-L33 PolarHBondContact O-N 3.47Å; F30-S34 WeakPolarHBondContact O-CB 3.02Å; F30-S34 PolarHBondContact O-N 3.15Å; F30-S34 PolarHBondContact O-OG 3.14Å
31	Q	88.4	Confident	84.8	Confident	112 Å²	112	100.8 Å²	100.8	52%	0.523	60%	0.603	S	S	.	*	H	α-helix	trans	-63.4	-41.6	176.4	-74.1	176.8	1.8	0	0	111.8	I27 L28 L29 S34 K35	I27-Q31 HydrophobicContact CG2-CG 4.37Å; I27-Q31 WeakPolarHBondContact O-CB 3.44Å; I27-Q31 VanDerWaalsContact O-CG 3.3Å; I27-Q31 WeakPolarHBondContact O-CG 3.42Å; I27-Q31 PolarHBondContact O-N 3.41Å; L28-Q31 PolarHBondContact O-N 3.26Å; L29-Q31 PolarHBondContact O-N 3.16Å; Q31-S34 PolarHBondContact O-N 3.49Å; Q31-K35 WeakPolarHBondContact O-CB 3.27Å; Q31-K35 PolarHBondContact O-N 2.85Å
32	Y	86.6	Confident	84.9	Confident	180 Å²	180	106.3 Å²	106.3	71%	0.706	62%	0.615	S	S	*	*	H	α-helix	trans	-64.1	-46.2	177	-179.2	-99.5	0	0	0	111.8	L28 L29 S34 K35	L28-Y32 WeakPolarHBondContact O-CB 3.48Å; L28-Y32 PolarHBondContact O-N 3.49Å; L29-Y32 PolarHBondContact O-N 2.81Å; Y32-S34 VanDerWaalsContact C-N 3.32Å; Y32-S34 PolarHBondContact O-N 3.43Å; Y32-K35 WeakPolarHBondContact O-CB 3.31Å; Y32-K35 PolarHBondContact O-N 2.82Å
33	L	85.1	Confident	85	Confident	127 Å²	127	107.9 Å²	107.9	67%	0.665	62%	0.618	S	S	*	*	H	α-helix	trans	-67.5	-32.3	177.1	-66.9	175.1	0	0	0	112.5	L29 F30 K35	L29-L33 HydrophobicContact CD1-CD1 4.11Å; L29-L33 HydrophobicContact CD1-CG 4.18Å; L29-L33 HydrophobicContact CG-CD1 3.94Å; L29-L33 HydrophobicContact CG-CG 4.4Å; L29-L33 WeakPolarHBondContact O-CB 3.27Å; L29-L33 VanDerWaalsContact O-CG 3.25Å; L29-L33 WeakPolarHBondContact O-CG 3.27Å; L29-L33 PolarHBondContact O-N 3.47Å; F30-L33 PolarHBondContact O-N 3.47Å; L33-K35 VanDerWaalsContact C-N 3.34Å
34	S	79.3	Confident	85.1	Confident	68 Å²	68	105.1 Å²	105.1	48%	0.476	60%	0.6	S	S	.	*	H	α-helix	trans	-85	-7.3	178.7	-58.5	0	0	0	0	113.2	F30 Q31 Y32 G36	F30-S34 WeakPolarHBondContact O-CB 3.02Å; F30-S34 PolarHBondContact O-N 3.15Å; F30-S34 PolarHBondContact O-OG 3.14Å; Q31-S34 PolarHBondContact O-N 3.49Å; Y32-S34 VanDerWaalsContact C-N 3.32Å; Y32-S34 PolarHBondContact O-N 3.43Å; S34-G36 PolarHBondContact O-N 3.4Å
35	K	70.1	Confident	85.2	Confident	174 Å²	174	107.7 Å²	107.7	76%	0.757	61%	0.606	S	S	*	*			trans	-74.6	75.6	177.7	-161.8	169.4	-176.7	174.8	0	109.4	Q31 Y32 L33 S37	Q31-K35 WeakPolarHBondContact O-CB 3.27Å; Q31-K35 PolarHBondContact O-N 2.85Å; Y32-K35 WeakPolarHBondContact O-CB 3.31Å; Y32-K35 PolarHBondContact O-N 2.82Å; L33-K35 VanDerWaalsContact C-N 3.34Å; K35-S37 PolarHBondContact O-N 3.37Å
36	G	60.6	Low	85.2	Confident	65 Å²	65	110.4 Å²	110.4	67%	0.67	61%	0.612	S	S	*	*			trans	-57.2	130.7	170.8	0	0	0	0	0	110	S34 G38	S34-G36 PolarHBondContact O-N 3.4Å; G36-G38 PolarHBondContact O-N 2.64Å
37	S	61.8	Low	85.3	Confident	101 Å²	101	110.1 Å²	110.1	71%	0.706	60%	0.601	S	S	*	*			trans	-54.1	124.9	171.1	55.4	0	0	0	0	108.9	K35 V39	K35-S37 PolarHBondContact O-N 3.37Å; S37-V39 PolarHBondContact O-N 2.99Å
38	G	66.4	Low	85.5	Confident	85 Å²	85	109.7 Å²	109.7	88%	0.876	60%	0.597	S	S	*	*	S	Bend	trans	-66.1	20.8	-176.9	0	0	0	0	0	115.7	G36 K40	G36-G38 PolarHBondContact O-N 2.64Å; G38-K40 PolarHBondContact O-N 3.49Å
39	V	75.9	Confident	85.7	Confident	117 Å²	117	109.6 Å²	109.6	71%	0.709	59%	0.592	S	S	*	*			trans	-80.8	113.8	175.2	-175	0	0	0	0	107.8	S37	S37-V39 PolarHBondContact O-N 2.99Å
40	K	81.1	Confident	85.9	Confident	186 Å²	186	111.9 Å²	111.9	81%	0.809	61%	0.605	S	S	*	*	P	Polyproline II helix	trans	-60.1	134.2	172.4	-64.3	-177.6	-178.9	-177.4	0	109.1	G38	G38-K40 PolarHBondContact O-N 3.49Å
41	P	87.7	Confident	86.4	Confident	123 Å²	123	108.1 Å²	108.1	80%	0.799	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-63.1	145.9	179	25.6	-33.2	0	0	0	111.1
42	K	94.4	Very high	86.8	Confident	160 Å²	160	109.3 Å²	109.3	70%	0.696	61%	0.609	S	S	*	*	P	Polyproline II helix	trans	-73.4	139.5	174.9	-65.8	178.4	-178	172	0	109.9	L45	K42-L45 HydrophobicContact CB-CD2 4.39Å; K42-L45 WeakPolarHBondContact O-CD2 3.5Å
43	V	97	Very high	87.3	Confident	98 Å²	98	108.3 Å²	108.3	59%	0.594	61%	0.608	S	S	*	*	S	Bend	trans	-69.3	-57.6	175.6	180	0	0	0	0	110.5	W73 R74	V43-W73 HydrophobicContact CG1-CG 4.23Å; V43-R74 PolarHBondContact O-NH1 2.88Å; V43-R74 PolarHBondContact O-NH2 2.9Å; V43-R74 VanDerWaalsContact O-NH2 3.11Å
44	N	97.7	Very high	88	Confident	21 Å²	21	103.3 Å²	103.3	11%	0.112	58%	0.583	C	S	.	*			trans	-83.4	123.6	172.9	175.7	9.7	0	0	0	109.5	D46 L47 K49 W73	N44-D46 PolarHBondContact OD1-N 3.41Å; N44-L47 PolarHBondContact ND2-O 3.34Å; N44-L47 WeakPolarHBondContact OD1-CB 3.18Å; N44-L47 PolarHBondContact OD1-N 3.39Å; N44-K49 VanDerWaalsContact C-NZ 3.33Å; N44-K49 PolarHBondContact ND2-NZ 3.36Å; N44-K49 VanDerWaalsContact ND2-NZ 3.15Å; N44-K49 PolarHBondContact O-NZ 3.26Å; N44-K49 PolarHBondContact OD1-NZ 3.41Å; N44-W73 HydrophobicContact CB-CB 4.15Å; N44-W73 HydrophobicContact CB-CD2 3.67Å; N44-W73 HydrophobicContact CB-CE3 3.46Å; N44-W73 VanDerWaalsContact CB-CE3 3.46Å; N44-W73 HydrophobicContact CB-CG 4.01Å; N44-W73 HydrophobicContact CB-CZ3 4.04Å; N44-W73 WeakPolarHBondContact ND2-CZ3 3.39Å
45	L	96.3	Very high	88.9	Confident	104 Å²	104	104.7 Å²	104.7	55%	0.545	59%	0.588	S	S	.	*	S	Bend	trans	-95	-40.4	-178.2	-60.1	-180	0	0	0	112.6	K42 K49	K42-L45 HydrophobicContact CB-CD2 4.39Å; K42-L45 WeakPolarHBondContact O-CD2 3.5Å; L45-K49 WeakPolarHBondContact O-CE 3.17Å
46	D	96.5	Very high	90.2	Very high	117 Å²	117	99.8 Å²	99.8	63%	0.626	57%	0.568	S	S	*	*	S	Bend	trans	-141.2	-16.3	-163.8	56.2	-11.3	0	0	0	115.3	N44 Q48	N44-D46 PolarHBondContact OD1-N 3.41Å; D46-Q48 PolarHBondContact O-N 3.48Å
47	L	97.6	Very high	91.9	Very high	35 Å²	35	101.3 Å²	101.3	18%	0.183	57%	0.574	C	S	.	*	T	Hydrogen-bonded Turn	trans	-76.8	122.7	-175.2	-64.7	165.7	0	0	0	112.1	N44 K49 W73 F78	N44-L47 PolarHBondContact ND2-O 3.34Å; N44-L47 WeakPolarHBondContact OD1-CB 3.18Å; N44-L47 PolarHBondContact OD1-N 3.39Å; L47-K49 PolarHBondContact O-N 3.38Å; L47-W73 HydrophobicContact CB-CE3 4.33Å; L47-W73 HydrophobicContact CD1-CB 4.25Å; L47-W73 HydrophobicContact CD1-CE3 4.1Å; L47-F78 HydrophobicContact CD1-CB 3.89Å; L47-F78 HydrophobicContact CD1-CD1 4.01Å; L47-F78 HydrophobicContact CD1-CD2 3.89Å; L47-F78 HydrophobicContact CD1-CE1 4.47Å; L47-F78 HydrophobicContact CD1-CE2 4.43Å; L47-F78 HydrophobicContact CD1-CG 3.67Å; L47-F78 HydrophobicContact CD2-CB 4.14Å
48	Q	97.6	Very high	93.4	Very high	76 Å²	76	100.5 Å²	100.5	36%	0.355	56%	0.557	S	S	.	*	T	Hydrogen-bonded Turn	trans	48.1	55.3	169.7	-60.8	177.4	35.3	0	0	113.7	D46 D50 N51 V54	D46-Q48 PolarHBondContact O-N 3.48Å; Q48-D50 VanDerWaalsContact C-N 3.3Å; Q48-D50 VanDerWaalsContact C-OD1 3.32Å; Q48-D50 PolarHBondContact O-N 3.32Å; Q48-N51 HydrophobicContact CB-CB 4.33Å; Q48-N51 WeakPolarHBondContact O-CB 3.42Å; Q48-N51 PolarHBondContact O-N 3.03Å; Q48-N51 VanDerWaalsContact O-N 3.15Å; Q48-V54 HydrophobicContact CB-CG2 3.55Å; Q48-V54 HydrophobicContact CG-CG2 4.49Å
49	K	97.9	Very high	94.7	Very high	110 Å²	110	101.6 Å²	101.6	48%	0.478	54%	0.543	S	S	.	.	T	Hydrogen-bonded Turn	trans	-75.1	-16	-174.4	-67	-52.7	-169.1	-173.7	0	115.4	N44 L45 L47 N51	N44-K49 VanDerWaalsContact C-NZ 3.33Å; N44-K49 PolarHBondContact ND2-NZ 3.36Å; N44-K49 VanDerWaalsContact ND2-NZ 3.15Å; N44-K49 PolarHBondContact O-NZ 3.26Å; N44-K49 PolarHBondContact OD1-NZ 3.41Å; L45-K49 WeakPolarHBondContact O-CE 3.17Å; L47-K49 PolarHBondContact O-N 3.38Å; K49-N51 VanDerWaalsContact C-N 3.28Å
50	D	98	Very high	95.3	Very high	150 Å²	150	101.9 Å²	101.9	80%	0.802	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.9	-22.6	168.3	59.2	-46.1	0	0	0	112.4	Q48	Q48-D50 VanDerWaalsContact C-N 3.3Å; Q48-D50 VanDerWaalsContact C-OD1 3.32Å; Q48-D50 PolarHBondContact O-N 3.32Å
51	N	97.6	Very high	95.7	Very high	61 Å²	61	99.7 Å²	99.7	33%	0.326	53%	0.532	S	S	.	.	S	Bend	trans	-88.6	117.5	175.7	-175.5	-14.7	0	0	0	110.9	Q48 K49 K53 V54	Q48-N51 HydrophobicContact CB-CB 4.33Å; Q48-N51 WeakPolarHBondContact O-CB 3.42Å; Q48-N51 PolarHBondContact O-N 3.03Å; Q48-N51 VanDerWaalsContact O-N 3.15Å; K49-N51 VanDerWaalsContact C-N 3.28Å; N51-K53 PolarHBondContact O-N 2.85Å; N51-K53 VanDerWaalsContact O-N 3.13Å; N51-K53 PolarHBondContact OD1-N 2.97Å; N51-K53 PolarHBondContact OD1-O 3.42Å; N51-V54 HydrophobicContact CB-CG2 3.96Å
52	P	97.7	Very high	95.7	Very high	137 Å²	137	100.3 Å²	100.3	89%	0.89	53%	0.529	S	S	*	.	S	Bend	trans	-63.3	-22	-179.1	26.6	-35.4	0	0	0	113.3
53	K	98	Very high	95.4	Very high	159 Å²	159	93.7 Å²	93.7	69%	0.691	50%	0.501	S	S	*	.	S	Bend	trans	-153.2	99.9	177.2	-172.9	-178.7	64.9	178.7	0	110.9	N51 V55	N51-K53 PolarHBondContact O-N 2.85Å; N51-K53 VanDerWaalsContact O-N 3.13Å; N51-K53 PolarHBondContact OD1-N 2.97Å; N51-K53 PolarHBondContact OD1-O 3.42Å; K53-V55 HydrophobicContact CD-CG2 4.33Å; K53-V55 HydrophobicContact CG-CG2 4.03Å; K53-V55 PolarHBondContact O-N 3.01Å
54	V	98.3	Very high	94.9	Very high	22 Å²	22	91.4 Å²	91.4	13%	0.133	50%	0.497	C	S	.	.			trans	-73.9	119.5	178.7	178	0	0	0	0	110.6	Q48 N51 W73 F78	Q48-V54 HydrophobicContact CB-CG2 3.55Å; Q48-V54 HydrophobicContact CG-CG2 4.49Å; N51-V54 HydrophobicContact CB-CG2 3.96Å; V54-W73 HydrophobicContact CB-CH2 3.76Å; V54-W73 HydrophobicContact CB-CZ3 3.87Å; V54-W73 HydrophobicContact CG1-CH2 3.98Å; V54-W73 HydrophobicContact CG1-CZ3 3.89Å; V54-W73 HydrophobicContact CG2-CZ3 4.3Å; V54-F78 HydrophobicContact CG1-CE1 3.9Å
55	V	98.1	Very high	94.5	Very high	97 Å²	97	96.9 Å²	96.9	59%	0.588	53%	0.526	S	S	*	.			trans	-133.3	141.3	-179.4	-178.2	0	0	0	0	108.6	K53	K53-V55 HydrophobicContact CD-CG2 4.33Å; K53-V55 HydrophobicContact CG-CG2 4.03Å; K53-V55 PolarHBondContact O-N 3.01Å
56	H	97.7	Very high	94.4	Very high	72 Å²	72	97.9 Å²	97.9	33%	0.333	53%	0.526	S	S	.	.			trans	-122.9	134.2	171.2	-62	83.8	0	0	0	108.9	F58 F78 P79	H56-F58 HydrophobicContact CB-CD2 4.47Å; H56-F58 HydrophobicContact CB-CE2 3.67Å; H56-F58 HydrophobicContact CB-CZ 4.21Å; H56-F78 AromaticContact CE1-CD1 3.76Å; H56-F78 AromaticContact CE1-CE1 3.33Å; H56-F78 WeakPolarHBondContact CE1-CE1 3.18Å; H56-F78 AromaticContact ND1-CE1 3.91Å; H56-P79 HydrophobicContact CB-CB 4.2Å; H56-P79 HydrophobicContact CB-CG 4.42Å; H56-P79 VanDerWaalsContact CD2-CG 3.48Å; H56-P79 WeakPolarHBondContact CD2-CG 3.32Å
57	A	96.4	Very high	94.3	Very high	96 Å²	96	92.8 Å²	92.8	79%	0.793	50%	0.5	S	S	*	.			trans	-120.3	138.5	174.9	0	0	0	0	0	108.3
58	F	94.1	Very high	94.4	Very high	84 Å²	84	93 Å²	93	37%	0.368	50%	0.503	S	S	.	.			trans	-137.6	135.1	178.7	-62.7	-80.7	0	0	0	108	H56 L63 Y69 P79 Y80	H56-F58 HydrophobicContact CB-CD2 4.47Å; H56-F58 HydrophobicContact CB-CE2 3.67Å; H56-F58 HydrophobicContact CB-CZ 4.21Å; F58-L63 HydrophobicContact CB-CD2 4.12Å; F58-Y69 AromaticContact CD2-CE1 3.63Å; F58-Y69 HydrophobicContact CD2-CE1 3.63Å; F58-Y69 AromaticContact CD2-CZ 3.67Å; F58-Y69 WeakPolarHBondContact CD2-OH 3.4Å; F58-Y69 HydrophobicContact CE1-CE1 4.34Å; F58-Y69 AromaticContact CE2-CD1 3.98Å; F58-Y69 HydrophobicContact CE2-CD1 3.98Å; F58-Y69 AromaticContact CE2-CE1 3.26Å; F58-Y69 HydrophobicContact CE2-CE1 3.26Å; F58-Y69 AromaticContact CE2-CZ 3.83Å; F58-Y69 HydrophobicContact CG-CE1 4.31Å; F58-Y69 WeakPolarHBondContact CG-OH 3.42Å; F58-Y69 AromaticContact CZ-CE1 3.67Å; F58-Y69 HydrophobicContact CZ-CE1 3.67Å; F58-P79 HydrophobicContact CE2-CG 4.16Å; F58-P79 HydrophobicContact CZ-CB 4.47Å; F58-P79 HydrophobicContact CZ-CG 3.64Å; F58-Y80 WeakPolarHBondContact CE1-OH 3.39Å
59	D	92.8	Very high	94.4	Very high	108 Å²	108	90.4 Å²	90.4	58%	0.578	49%	0.49	S	S	*	.			trans	-75.8	137.4	170.5	-64.6	-35.8	0	0	0	108.8	E61 D62	D59-E61 PolarHBondContact O-N 3.44Å; D59-D62 PolarHBondContact O-N 3.31Å
60	I	88.9	Confident	94.4	Very high	123 Å²	123	85.8 Å²	85.8	63%	0.631	47%	0.472	S	S	*	.	S	Bend	trans	-67	-31	-173.6	-65.2	172.7	0	0	0	110	D62 L63	I60-D62 VanDerWaalsContact C-N 3.31Å; I60-D62 PolarHBondContact O-N 2.96Å; I60-L63 WeakPolarHBondContact O-CB 3.32Å; I60-L63 PolarHBondContact O-N 3.42Å
61	E	88.4	Confident	94.5	Very high	141 Å²	141	85.8 Å²	85.8	66%	0.659	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.4	-35.8	-179.6	-64.5	75.3	-168.2	0	0	111.9	D59 L63 R103	D59-E61 PolarHBondContact O-N 3.44Å; E61-L63 VanDerWaalsContact C-N 3.3Å; E61-R103 PolarHBondContact O-NH2 3.21Å
62	D	88.8	Confident	94.5	Very high	135 Å²	135	83.1 Å²	83.1	72%	0.722	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.2	-9.2	179.5	-69.7	-18.5	0	0	0	113	D59 I60 G64	D59-D62 PolarHBondContact O-N 3.31Å; I60-D62 VanDerWaalsContact C-N 3.31Å; I60-D62 PolarHBondContact O-N 2.96Å; D62-G64 PolarHBondContact O-N 3.48Å
63	L	87.5	Confident	94.6	Very high	22 Å²	22	79.5 Å²	79.5	12%	0.115	42%	0.415	C	S	.	.			trans	-71.2	128.1	172.6	-54.4	-178.9	0	0	0	109.3	F58 I60 E61 A67 Y69 I101 R103	F58-L63 HydrophobicContact CB-CD2 4.12Å; I60-L63 WeakPolarHBondContact O-CB 3.32Å; I60-L63 PolarHBondContact O-N 3.42Å; E61-L63 VanDerWaalsContact C-N 3.3Å; L63-A67 HydrophobicContact CD2-CB 4.15Å; L63-Y69 WeakPolarHBondContact CD2-OH 2.75Å; L63-I101 HydrophobicContact CD1-CB 4.42Å; L63-I101 HydrophobicContact CD1-CG2 3.76Å; L63-R103 PolarHBondContact O-NH2 3.17Å
64	G	86.9	Confident	94.6	Very high	50 Å²	50	75 Å²	75	52%	0.515	39%	0.394	S	S	.	.			trans	-62.2	-170.9	163.1	0	0	0	0	0	111.8	D62 K66	D62-G64 PolarHBondContact O-N 3.48Å; G64-K66 PolarHBondContact O-N 2.83Å
65	D	90	Very high	94.6	Very high	135 Å²	135	74.1 Å²	74.1	72%	0.722	39%	0.389	S	S	*	.	S	Bend	trans	-57.7	-29.9	-175.1	-59.9	-30.9	0	0	0	113.6	K102 R103	D65-K102 WeakPolarHBondContact O-CA 3.34Å; D65-R103 PolarHBondContact O-N 2.8Å
66	K	93.1	Very high	94.6	Very high	125 Å²	125	78.9 Å²	78.9	54%	0.543	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.3	127.3	-179.1	-178.5	-177.1	176.7	-171.1	0	111.2	G64 V68 I100 I101 K102	G64-K66 PolarHBondContact O-N 2.83Å; K66-V68 HydrophobicContact CD-CG2 4.47Å; K66-V68 HydrophobicContact CG-CG2 4.24Å; K66-I100 HydrophobicContact CG-CG2 4.17Å; K66-I101 WeakPolarHBondContact CA-O 3.27Å; K66-K102 HydrophobicContact CG-CG 4.22Å
67	A	95.6	Very high	94.6	Very high	10 Å²	10	82.5 Å²	82.5	8%	0.083	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	141.6	168.3	0	0	0	0	0	110.4	L63 Y69 I100 I101	L63-A67 HydrophobicContact CD2-CB 4.15Å; A67-Y69 HydrophobicContact CB-CD2 4.33Å; A67-Y69 HydrophobicContact CB-CE2 3.52Å; A67-I100 WeakPolarHBondContact O-CA 3.34Å; A67-I101 PolarHBondContact N-O 2.75Å; A67-I101 PolarHBondContact O-N 2.97Å
68	V	97.9	Very high	94.7	Very high	40 Å²	40	79.6 Å²	79.6	24%	0.242	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	111.5	179.6	-170.5	0	0	0	0	109	K66 Y80 C81 P98 L99 I100	K66-V68 HydrophobicContact CD-CG2 4.47Å; K66-V68 HydrophobicContact CG-CG2 4.24Å; V68-Y80 WeakPolarHBondContact O-CA 3.12Å; V68-C81 HydrophobicContact CB-CB 4.32Å; V68-C81 HydrophobicContact CG1-CB 3.56Å; V68-C81 PolarHBondContact O-N 2.86Å; V68-P98 HydrophobicContact CG1-CB 3.53Å; V68-P98 HydrophobicContact CG1-CG 3.87Å; V68-L99 CarbonylContact C-O 3.58Å; V68-L99 WeakPolarHBondContact CA-O 3.35Å; V68-I100 HydrophobicContact CG1-CG1 4.06Å; V68-I100 HydrophobicContact CG2-CG1 4.28Å; V68-I100 HydrophobicContact CG2-CG2 4.48Å
69	Y	98.5	Very high	94.9	Very high	21 Å²	21	76.6 Å²	76.6	8%	0.082	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	140	-174.7	-64.5	-71.7	0	0	0	112.4	F58 L63 A67 P79 Y80 P98 L99 I101	F58-Y69 AromaticContact CD2-CE1 3.63Å; F58-Y69 HydrophobicContact CD2-CE1 3.63Å; F58-Y69 AromaticContact CD2-CZ 3.67Å; F58-Y69 WeakPolarHBondContact CD2-OH 3.4Å; F58-Y69 HydrophobicContact CE1-CE1 4.34Å; F58-Y69 AromaticContact CE2-CD1 3.98Å; F58-Y69 HydrophobicContact CE2-CD1 3.98Å; F58-Y69 AromaticContact CE2-CE1 3.26Å; F58-Y69 HydrophobicContact CE2-CE1 3.26Å; F58-Y69 AromaticContact CE2-CZ 3.83Å; F58-Y69 HydrophobicContact CG-CE1 4.31Å; F58-Y69 WeakPolarHBondContact CG-OH 3.42Å; F58-Y69 AromaticContact CZ-CE1 3.67Å; F58-Y69 HydrophobicContact CZ-CE1 3.67Å; L63-Y69 WeakPolarHBondContact CD2-OH 2.75Å; A67-Y69 HydrophobicContact CB-CD2 4.33Å; A67-Y69 HydrophobicContact CB-CE2 3.52Å; Y69-P79 WeakPolarHBondContact CA-O 3.43Å; Y69-Y80 HydrophobicContact CD1-CD1 4.02Å; Y69-Y80 HydrophobicContact CD1-CE1 4.2Å; Y69-Y80 AromaticContact CE1-CD1 3.78Å; Y69-Y80 HydrophobicContact CE1-CD1 3.78Å; Y69-Y80 AromaticContact CE1-CE1 3.49Å; Y69-Y80 HydrophobicContact CE1-CE1 3.49Å; Y69-Y80 VanDerWaalsContact CE1-CE1 3.49Å; Y69-P98 CarbonylContact O-C 3.55Å; Y69-P98 WeakPolarHBondContact O-CA 3.32Å; Y69-P98 WeakPolarHBondContact O-CB 3.47Å; Y69-L99 PolarHBondContact N-O 2.8Å; Y69-L99 PolarHBondContact O-N 3.02Å; Y69-I101 HydrophobicContact CD2-CD1 4.14Å; Y69-I101 HydrophobicContact CD2-CG1 4.44Å; Y69-I101 HydrophobicContact CE2-CD1 3.94Å; Y69-I101 HydrophobicContact CE2-CG1 4.45Å
70	C	98.8	Very high	95.2	Very high	13 Å²	13	76.6 Å²	76.6	9%	0.088	37%	0.367	C	S	.	.			trans	-72.4	136.1	177.8	-176.5	0	0	0	0	110.7	C72 W73 F78 P79 Y80	C70-C72 PolarHBondContact SG-N 2.91Å; C70-C72 PolarHBondContact SG-SG 3.48Å; C70-W73 PolarHBondContact SG-N 3.5Å; C70-W73 VanDerWaalsContact SG-N 3.41Å; C70-F78 HydrophobicContact CB-CD2 3.73Å; C70-F78 HydrophobicContact CB-CE2 4.05Å; C70-P79 PolarHBondContact N-O 2.98Å; C70-Y80 WeakPolarHBondContact CB-O 3.35Å
71	R	98.8	Very high	95.6	Very high	150 Å²	150	72.1 Å²	72.1	57%	0.566	35%	0.347	S	S	*	.	S	Bend	trans	-119.2	-5.8	168.2	-60.7	-168.4	-64.7	173.2	-0.9	113.6	G97 P98 L99	R71-G97 PolarHBondContact NE-O 3.22Å; R71-G97 PolarHBondContact NH2-O 3.16Å; R71-G97 VanDerWaalsContact NH2-O 3.17Å; R71-P98 PolarHBondContact NH2-O 3.35Å; R71-L99 HydrophobicContact CG-CB 4.34Å
72	C	98.6	Very high	96.1	Very high	6 Å²	6	68.5 Å²	68.5	4%	0.041	33%	0.332	C	S	.	.	S	Bend	trans	-92.1	-11.4	-176.6	69.7	0	0	0	0	114.2	C70 R74 H85 V96	C70-C72 PolarHBondContact SG-N 2.91Å; C70-C72 PolarHBondContact SG-SG 3.48Å; C72-R74 PolarHBondContact O-N 3.42Å; C72-R74 PolarHBondContact O-NH1 3.44Å; C72-R74 PolarHBondContact SG-N 2.92Å; C72-H85 HydrophobicContact CB-CB 3.89Å; C72-V96 HydrophobicContact CB-CG2 3.74Å
73	W	98.6	Very high	96.6	Very high	60 Å²	60	63.7 Å²	63.7	23%	0.227	31%	0.314	C	S	.	.	S	Bend	trans	57.3	31.3	-176.1	-58.1	79.5	0	0	0	114.1	V43 N44 L47 V54 C70 F78	V43-W73 HydrophobicContact CG1-CG 4.23Å; N44-W73 HydrophobicContact CB-CB 4.15Å; N44-W73 HydrophobicContact CB-CD2 3.67Å; N44-W73 HydrophobicContact CB-CE3 3.46Å; N44-W73 VanDerWaalsContact CB-CE3 3.46Å; N44-W73 HydrophobicContact CB-CG 4.01Å; N44-W73 HydrophobicContact CB-CZ3 4.04Å; N44-W73 WeakPolarHBondContact ND2-CZ3 3.39Å; L47-W73 HydrophobicContact CB-CE3 4.33Å; L47-W73 HydrophobicContact CD1-CB 4.25Å; L47-W73 HydrophobicContact CD1-CE3 4.1Å; V54-W73 HydrophobicContact CB-CH2 3.76Å; V54-W73 HydrophobicContact CB-CZ3 3.87Å; V54-W73 HydrophobicContact CG1-CH2 3.98Å; V54-W73 HydrophobicContact CG1-CZ3 3.89Å; V54-W73 HydrophobicContact CG2-CZ3 4.3Å; C70-W73 PolarHBondContact SG-N 3.5Å; C70-W73 VanDerWaalsContact SG-N 3.41Å; W73-F78 HydrophobicContact CD2-CE2 4.14Å; W73-F78 AromaticContact CD2-CZ 3.95Å; W73-F78 HydrophobicContact CD2-CZ 3.95Å; W73-F78 HydrophobicContact CE3-CE1 4.03Å; W73-F78 HydrophobicContact CE3-CE2 4.1Å; W73-F78 AromaticContact CE3-CZ 3.61Å; W73-F78 HydrophobicContact CE3-CZ 3.61Å; W73-F78 HydrophobicContact CH2-CE1 4.41Å; W73-F78 AromaticContact CH2-CZ 3.98Å; W73-F78 HydrophobicContact CH2-CZ 3.98Å; W73-F78 HydrophobicContact CZ2-CZ 4.28Å; W73-F78 AromaticContact CZ3-CE1 3.83Å; W73-F78 HydrophobicContact CZ3-CE1 3.83Å; W73-F78 AromaticContact CZ3-CZ 3.64Å; W73-F78 HydrophobicContact CZ3-CZ 3.64Å
74	R	98.4	Very high	97.1	Very high	66 Å²	66	63.9 Å²	63.9	25%	0.249	32%	0.319	C	S	.	.			trans	-117.3	-4.8	174.9	-59.4	-68	175	-85.7	-4.7	113.3	V43 C72 A84 H88	V43-R74 PolarHBondContact O-NH1 2.88Å; V43-R74 PolarHBondContact O-NH2 2.9Å; V43-R74 VanDerWaalsContact O-NH2 3.11Å; C72-R74 PolarHBondContact O-N 3.42Å; C72-R74 PolarHBondContact O-NH1 3.44Å; C72-R74 PolarHBondContact SG-N 2.92Å; R74-A84 HydrophobicContact CB-CB 3.84Å; R74-A84 WeakPolarHBondContact O-CB 3.34Å; R74-H88 HydrophobicContact CG-CB 4.15Å
75	S	98.6	Very high	97.7	Very high	2 Å²	2	63.4 Å²	63.4	1%	0.014	30%	0.303	C	S	.	.			trans	-71.5	134.7	-175.9	-170.5	0	0	0	0	111.4	K77 F78 Y80 D82	S75-K77 PolarHBondContact O-N 3.28Å; S75-K77 PolarHBondContact OG-N 3.48Å; S75-K77 VanDerWaalsContact OG-N 3.15Å; S75-F78 PolarHBondContact O-N 2.78Å; S75-Y80 VanDerWaalsContact CB-O 3.27Å; S75-Y80 WeakPolarHBondContact CB-O 3.45Å; S75-Y80 PolarHBondContact OG-O 3.4Å; S75-D82 VanDerWaalsContact CA-OD1 3.27Å; S75-D82 WeakPolarHBondContact CA-OD1 3.3Å; S75-D82 VanDerWaalsContact CB-OD1 3.27Å; S75-D82 WeakPolarHBondContact CB-OD1 3.31Å; S75-D82 WeakPolarHBondContact OG-CB 3.36Å; S75-D82 PolarHBondContact OG-N 2.93Å; S75-D82 PolarHBondContact OG-OD1 3.41Å; S75-D82 PolarHBondContact OG-OD2 2.89Å; S75-D82 VanDerWaalsContact OG-OD2 3.14Å
76	K	98.3	Very high	98.1	Very high	198 Å²	198	59.9 Å²	59.9	86%	0.861	29%	0.292	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.5	-15.3	169.9	-63.4	-177	178.9	-177.7	0	112.2	D82	K76-D82 PolarHBondContact N-OD2 3.29Å
77	K	98.2	Very high	98.3	Very high	148 Å²	148	60 Å²	60	64%	0.643	29%	0.293	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.9	22.3	176.4	-60.6	-175.1	179.1	-178.6	0	112.1	S75 Y80 D82	S75-K77 PolarHBondContact O-N 3.28Å; S75-K77 PolarHBondContact OG-N 3.48Å; S75-K77 VanDerWaalsContact OG-N 3.15Å; K77-Y80 WeakPolarHBondContact O-CA 3.48Å; K77-Y80 WeakPolarHBondContact O-CB 3.25Å; K77-Y80 PolarHBondContact O-N 2.98Å; K77-D82 HydrophobicContact CB-CB 4.44Å; K77-D82 HydrophobicContact CD-CB 4.34Å; K77-D82 HydrophobicContact CG-CB 4.36Å
78	F	98.4	Very high	98.5	Very high	34 Å²	34	60.8 Å²	60.8	15%	0.149	30%	0.295	C	S	.	.	T	Hydrogen-bonded Turn	trans	-50.5	128.6	178.9	-167.4	-101.1	0	0	0	110	L47 V54 H56 C70 W73 S75	L47-F78 HydrophobicContact CD1-CB 3.89Å; L47-F78 HydrophobicContact CD1-CD1 4.01Å; L47-F78 HydrophobicContact CD1-CD2 3.89Å; L47-F78 HydrophobicContact CD1-CE1 4.47Å; L47-F78 HydrophobicContact CD1-CE2 4.43Å; L47-F78 HydrophobicContact CD1-CG 3.67Å; L47-F78 HydrophobicContact CD2-CB 4.14Å; V54-F78 HydrophobicContact CG1-CE1 3.9Å; H56-F78 AromaticContact CE1-CD1 3.76Å; H56-F78 AromaticContact CE1-CE1 3.33Å; H56-F78 WeakPolarHBondContact CE1-CE1 3.18Å; H56-F78 AromaticContact ND1-CE1 3.91Å; C70-F78 HydrophobicContact CB-CD2 3.73Å; C70-F78 HydrophobicContact CB-CE2 4.05Å; W73-F78 HydrophobicContact CD2-CE2 4.14Å; W73-F78 AromaticContact CD2-CZ 3.95Å; W73-F78 HydrophobicContact CD2-CZ 3.95Å; W73-F78 HydrophobicContact CE3-CE1 4.03Å; W73-F78 HydrophobicContact CE3-CE2 4.1Å; W73-F78 AromaticContact CE3-CZ 3.61Å; W73-F78 HydrophobicContact CE3-CZ 3.61Å; W73-F78 HydrophobicContact CH2-CE1 4.41Å; W73-F78 AromaticContact CH2-CZ 3.98Å; W73-F78 HydrophobicContact CH2-CZ 3.98Å; W73-F78 HydrophobicContact CZ2-CZ 4.28Å; W73-F78 AromaticContact CZ3-CE1 3.83Å; W73-F78 HydrophobicContact CZ3-CE1 3.83Å; W73-F78 AromaticContact CZ3-CZ 3.64Å; W73-F78 HydrophobicContact CZ3-CZ 3.64Å; S75-F78 PolarHBondContact O-N 2.78Å
79	P	98.1	Very high	98.5	Very high	21 Å²	21	60.4 Å²	60.4	14%	0.136	29%	0.291	C	S	.	.	T	Hydrogen-bonded Turn	cis	-87.2	-3.5	19.3	33.4	-36.8	0	0	0	116.6	H56 F58 Y69 C70	H56-P79 HydrophobicContact CB-CB 4.2Å; H56-P79 HydrophobicContact CB-CG 4.42Å; H56-P79 VanDerWaalsContact CD2-CG 3.48Å; H56-P79 WeakPolarHBondContact CD2-CG 3.32Å; F58-P79 HydrophobicContact CE2-CG 4.16Å; F58-P79 HydrophobicContact CZ-CB 4.47Å; F58-P79 HydrophobicContact CZ-CG 3.64Å; Y69-P79 WeakPolarHBondContact CA-O 3.43Å; C70-P79 PolarHBondContact N-O 2.98Å
80	Y	98.3	Very high	98.5	Very high	109 Å²	109	67.4 Å²	67.4	43%	0.427	33%	0.325	S	S	.	.	B	Isolated β-bridge	trans	-78.8	155	179.5	-58.1	-72.7	0	0	0	111.7	F58 V68 Y69 C70 S75 K77	F58-Y80 WeakPolarHBondContact CE1-OH 3.39Å; V68-Y80 WeakPolarHBondContact O-CA 3.12Å; Y69-Y80 HydrophobicContact CD1-CD1 4.02Å; Y69-Y80 HydrophobicContact CD1-CE1 4.2Å; Y69-Y80 AromaticContact CE1-CD1 3.78Å; Y69-Y80 HydrophobicContact CE1-CD1 3.78Å; Y69-Y80 AromaticContact CE1-CE1 3.49Å; Y69-Y80 HydrophobicContact CE1-CE1 3.49Å; Y69-Y80 VanDerWaalsContact CE1-CE1 3.49Å; C70-Y80 WeakPolarHBondContact CB-O 3.35Å; S75-Y80 VanDerWaalsContact CB-O 3.27Å; S75-Y80 WeakPolarHBondContact CB-O 3.45Å; S75-Y80 PolarHBondContact OG-O 3.4Å; K77-Y80 WeakPolarHBondContact O-CA 3.48Å; K77-Y80 WeakPolarHBondContact O-CB 3.25Å; K77-Y80 PolarHBondContact O-N 2.98Å
81	C	98.6	Very high	98.5	Very high	29 Å²	29	73.1 Å²	73.1	20%	0.196	35%	0.35	C	S	.	.			trans	-83.8	132	173.6	-172.1	0	0	0	0	110.9	V68 G83 H85 P98	V68-C81 HydrophobicContact CB-CB 4.32Å; V68-C81 HydrophobicContact CG1-CB 3.56Å; V68-C81 PolarHBondContact O-N 2.86Å; C81-G83 PolarHBondContact SG-N 3.49Å; C81-H85 PolarHBondContact SG-ND1 3.48Å; C81-P98 HydrophobicContact CB-CB 3.83Å
82	D	98.6	Very high	98.4	Very high	65 Å²	65	69.9 Å²	69.9	35%	0.348	35%	0.347	S	S	.	.			trans	-115.6	9.9	173.3	65.8	-13.5	0	0	0	112.9	S75 K76 K77 A84	S75-D82 VanDerWaalsContact CA-OD1 3.27Å; S75-D82 WeakPolarHBondContact CA-OD1 3.3Å; S75-D82 VanDerWaalsContact CB-OD1 3.27Å; S75-D82 WeakPolarHBondContact CB-OD1 3.31Å; S75-D82 WeakPolarHBondContact OG-CB 3.36Å; S75-D82 PolarHBondContact OG-N 2.93Å; S75-D82 PolarHBondContact OG-OD1 3.41Å; S75-D82 PolarHBondContact OG-OD2 2.89Å; S75-D82 VanDerWaalsContact OG-OD2 3.14Å; K76-D82 PolarHBondContact N-OD2 3.29Å; K77-D82 HydrophobicContact CB-CB 4.44Å; K77-D82 HydrophobicContact CD-CB 4.34Å; K77-D82 HydrophobicContact CG-CB 4.36Å; D82-A84 VanDerWaalsContact OD1-CB 3.31Å; D82-A84 WeakPolarHBondContact OD1-CB 3.32Å; D82-A84 PolarHBondContact OD1-N 2.97Å; D82-A84 VanDerWaalsContact OD1-N 3.16Å
83	G	98.5	Very high	98.3	Very high	34 Å²	34	73 Å²	73	35%	0.351	38%	0.381	S	S	.	.	S	Bend	trans	90	-3.3	-178.7	0	0	0	0	0	115.6	C81 H85 A86	C81-G83 PolarHBondContact SG-N 3.49Å; G83-H85 PolarHBondContact O-N 3.42Å; G83-A86 PolarHBondContact O-N 3.31Å
84	A	98.7	Very high	98.3	Very high	25 Å²	25	73.3 Å²	73.3	21%	0.207	39%	0.387	C	S	.	.	H	α-helix	trans	-57.6	-20.8	-178	0	0	0	0	0	115.1	R74 D82 A86 K87 H88	R74-A84 HydrophobicContact CB-CB 3.84Å; R74-A84 WeakPolarHBondContact O-CB 3.34Å; D82-A84 VanDerWaalsContact OD1-CB 3.31Å; D82-A84 WeakPolarHBondContact OD1-CB 3.32Å; D82-A84 PolarHBondContact OD1-N 2.97Å; D82-A84 VanDerWaalsContact OD1-N 3.16Å; A84-A86 PolarHBondContact O-N 2.9Å; A84-K87 PolarHBondContact O-N 2.97Å; A84-H88 PolarHBondContact O-N 2.64Å
85	H	98.6	Very high	98.3	Very high	41 Å²	41	77.1 Å²	77.1	19%	0.19	41%	0.412	C	S	.	.	H	α-helix	trans	-59.8	-31.3	174.7	64.7	-86.4	0	0	0	113.1	C72 C81 G83 H88 N89 V96	C72-H85 HydrophobicContact CB-CB 3.89Å; C81-H85 PolarHBondContact SG-ND1 3.48Å; G83-H85 PolarHBondContact O-N 3.42Å; H85-H88 PolarHBondContact O-N 3.44Å; H85-N89 WeakPolarHBondContact O-CB 3.4Å; H85-N89 PolarHBondContact O-N 2.94Å; H85-N89 PolarHBondContact O-OD1 2.96Å; H85-V96 HydrophobicContact CB-CG2 4.36Å
86	A	98.7	Very high	98.3	Very high	60 Å²	60	79 Å²	79	50%	0.496	42%	0.423	S	S	.	.	H	α-helix	trans	-63.8	-46.3	-179.8	0	0	0	0	0	111.7	G83 A84 N89 Q90	G83-A86 PolarHBondContact O-N 3.31Å; A84-A86 PolarHBondContact O-N 2.9Å; A86-N89 PolarHBondContact O-N 3.45Å; A86-Q90 PolarHBondContact O-N 3.31Å
87	K	98.6	Very high	98.3	Very high	129 Å²	129	70.4 Å²	70.4	56%	0.561	39%	0.391	S	S	*	.	H	α-helix	trans	-62.5	-46.6	175.6	-178.9	177.5	173.1	-179.6	0	111.2	A84 N89 Q90 E91	A84-K87 PolarHBondContact O-N 2.97Å; K87-N89 VanDerWaalsContact C-N 3.34Å; K87-N89 PolarHBondContact O-N 2.99Å; K87-Q90 PolarHBondContact O-N 3.5Å; K87-E91 VanDerWaalsContact CE-CD 3.43Å; K87-E91 WeakPolarHBondContact CE-OE1 3.38Å; K87-E91 HydrophobicContact CG-CG 4.38Å; K87-E91 IonicContact NZ-OE1 2.81Å; K87-E91 WeakPolarHBondContact O-CG 3.29Å; K87-E91 PolarHBondContact O-N 3.44Å
88	H	98.3	Very high	98.3	Very high	26 Å²	26	65 Å²	65	12%	0.12	37%	0.371	C	S	.	.	H	α-helix	trans	-56.4	-46.9	176.3	169.2	85.6	0	0	0	112	R74 A84 H85 Q90 E91 T92 D94	R74-H88 HydrophobicContact CG-CB 4.15Å; A84-H88 PolarHBondContact O-N 2.64Å; H85-H88 PolarHBondContact O-N 3.44Å; H88-Q90 PolarHBondContact O-N 2.98Å; H88-E91 PolarHBondContact O-N 3.46Å; H88-T92 WeakPolarHBondContact O-CB 3.31Å; H88-T92 WeakPolarHBondContact O-CG2 3.41Å; H88-T92 PolarHBondContact O-N 2.88Å; H88-T92 PolarHBondContact O-OG1 3.01Å; H88-D94 IonicContact CD2-OD2 3.58Å; H88-D94 IonicContact CE1-OD2 3.62Å; H88-D94 IonicContact NE2-OD2 3.9Å; H88-D94 PolarHBondContact NE2-OD2 3.41Å
89	N	98.6	Very high	98.3	Very high	31 Å²	31	67.2 Å²	67.2	17%	0.166	38%	0.384	C	S	.	.	H	α-helix	trans	-61.1	-44.5	177.3	-71.4	-5.3	0	0	0	111.7	H85 A86 K87 E91 T92 G93 D94 V96	H85-N89 WeakPolarHBondContact O-CB 3.4Å; H85-N89 PolarHBondContact O-N 2.94Å; H85-N89 PolarHBondContact O-OD1 2.96Å; A86-N89 PolarHBondContact O-N 3.45Å; K87-N89 VanDerWaalsContact C-N 3.34Å; K87-N89 PolarHBondContact O-N 2.99Å; N89-E91 VanDerWaalsContact C-N 3.35Å; N89-E91 PolarHBondContact O-N 3.49Å; N89-T92 PolarHBondContact O-N 3.34Å; N89-G93 WeakPolarHBondContact O-CA 3.38Å; N89-G93 PolarHBondContact O-N 2.91Å; N89-D94 WeakPolarHBondContact CB-O 3.27Å; N89-D94 PolarHBondContact O-N 3.47Å; N89-D94 PolarHBondContact OD1-O 2.73Å; N89-V96 PolarHBondContact ND2-N 2.94Å; N89-V96 PolarHBondContact ND2-O 2.97Å; N89-V96 WeakPolarHBondContact OD1-CG2 3.39Å; N89-V96 PolarHBondContact OD1-N 3.45Å; N89-V96 VanDerWaalsContact OD1-N 3.15Å
90	Q	98.5	Very high	98.3	Very high	169 Å²	169	70.2 Å²	70.2	79%	0.79	40%	0.398	S	S	*	.	H	α-helix	trans	-61.5	-41.5	178.1	-173.9	-179.4	14.4	0	0	112.5	A86 K87 H88	A86-Q90 PolarHBondContact O-N 3.31Å; K87-Q90 PolarHBondContact O-N 3.5Å; H88-Q90 PolarHBondContact O-N 2.98Å
91	E	97.9	Very high	98.2	Very high	133 Å²	133	68.2 Å²	68.2	62%	0.621	39%	0.394	S	S	*	.	H	α-helix	trans	-76.9	-30.2	-177	-70.8	175.7	156.5	0	0	113.1	K87 H88 N89	K87-E91 VanDerWaalsContact CE-CD 3.43Å; K87-E91 WeakPolarHBondContact CE-OE1 3.38Å; K87-E91 HydrophobicContact CG-CG 4.38Å; K87-E91 IonicContact NZ-OE1 2.81Å; K87-E91 WeakPolarHBondContact O-CG 3.29Å; K87-E91 PolarHBondContact O-N 3.44Å; H88-E91 PolarHBondContact O-N 3.46Å; N89-E91 VanDerWaalsContact C-N 3.35Å; N89-E91 PolarHBondContact O-N 3.49Å
92	T	96.5	Very high	97.9	Very high	82 Å²	82	73.8 Å²	73.8	50%	0.503	42%	0.415	S	S	.	.	H	α-helix	trans	-110	-12.3	-171.3	62.7	0	0	0	0	114.2	H88 N89 D94	H88-T92 WeakPolarHBondContact O-CB 3.31Å; H88-T92 WeakPolarHBondContact O-CG2 3.41Å; H88-T92 PolarHBondContact O-N 2.88Å; H88-T92 PolarHBondContact O-OG1 3.01Å; N89-T92 PolarHBondContact O-N 3.34Å; T92-D94 WeakPolarHBondContact OG1-CB 3.34Å; T92-D94 PolarHBondContact OG1-N 3.04Å
93	G	97.6	Very high	97.5	Very high	72 Å²	72	77 Å²	77	74%	0.742	42%	0.423	S	S	*	.			trans	73.2	13.9	-169.9	0	0	0	0	0	113.8	N89	N89-G93 WeakPolarHBondContact O-CA 3.38Å; N89-G93 PolarHBondContact O-N 2.91Å
94	D	98.1	Very high	96.9	Very high	65 Å²	65	84.7 Å²	84.7	35%	0.348	45%	0.446	S	S	.	.			trans	-77.4	170.8	178	-161.7	0.6	0	0	0	111.8	H88 N89 T92	H88-D94 IonicContact CD2-OD2 3.58Å; H88-D94 IonicContact CE1-OD2 3.62Å; H88-D94 IonicContact NE2-OD2 3.9Å; H88-D94 PolarHBondContact NE2-OD2 3.41Å; N89-D94 WeakPolarHBondContact CB-O 3.27Å; N89-D94 PolarHBondContact O-N 3.47Å; N89-D94 PolarHBondContact OD1-O 2.73Å; T92-D94 WeakPolarHBondContact OG1-CB 3.34Å; T92-D94 PolarHBondContact OG1-N 3.04Å
95	N	98.5	Very high	95.9	Very high	146 Å²	146	92.3 Å²	92.3	78%	0.781	48%	0.477	S	S	*	.			trans	-134	26.3	-175.9	69.3	-12.1	0	0	0	113.6
96	V	98.7	Very high	94.5	Very high	41 Å²	41	98.7 Å²	98.7	25%	0.248	54%	0.537	C	S	.	.			trans	-71.1	153.3	-179	-67.5	0	0	0	0	112.5	C72 H85 N89	C72-V96 HydrophobicContact CB-CG2 3.74Å; H85-V96 HydrophobicContact CB-CG2 4.36Å; N89-V96 PolarHBondContact ND2-N 2.94Å; N89-V96 PolarHBondContact ND2-O 2.97Å; N89-V96 WeakPolarHBondContact OD1-CG2 3.39Å; N89-V96 PolarHBondContact OD1-N 3.45Å; N89-V96 VanDerWaalsContact OD1-N 3.15Å
97	G	98.7	Very high	94.2	Very high	19 Å²	19	100.6 Å²	100.6	20%	0.196	54%	0.539	C	S	.	.			trans	-149.9	169	177.4	0	0	0	0	0	112.4	R71	R71-G97 PolarHBondContact NE-O 3.22Å; R71-G97 PolarHBondContact NH2-O 3.16Å; R71-G97 VanDerWaalsContact NH2-O 3.17Å
98	P	98.8	Very high	94	Very high	33 Å²	33	99.1 Å²	99.1	21%	0.214	54%	0.538	C	S	.	.			trans	-68.9	167.3	-178.4	29.6	-34.5	0	0	0	112.9	V68 Y69 R71 C81 I100	V68-P98 HydrophobicContact CG1-CB 3.53Å; V68-P98 HydrophobicContact CG1-CG 3.87Å; Y69-P98 CarbonylContact O-C 3.55Å; Y69-P98 WeakPolarHBondContact O-CA 3.32Å; Y69-P98 WeakPolarHBondContact O-CB 3.47Å; R71-P98 PolarHBondContact NH2-O 3.35Å; C81-P98 HydrophobicContact CB-CB 3.83Å; P98-I100 HydrophobicContact CG-CG1 4.49Å
99	L	98.3	Very high	93.8	Very high	81 Å²	81	103.2 Å²	103.2	42%	0.424	56%	0.561	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.4	126.3	160.2	173.1	64	0	0	0	108.1	V68 Y69 R71 I101	V68-L99 CarbonylContact C-O 3.58Å; V68-L99 WeakPolarHBondContact CA-O 3.35Å; Y69-L99 PolarHBondContact N-O 2.8Å; Y69-L99 PolarHBondContact O-N 3.02Å; R71-L99 HydrophobicContact CG-CB 4.34Å; L99-I101 HydrophobicContact CD2-CD1 4.26Å; L99-I101 HydrophobicContact CD2-CG1 4.39Å; L99-I101 HydrophobicContact CG-CG1 4.21Å
100	I	97	Very high	93.5	Very high	85 Å²	85	107.4 Å²	107.4	44%	0.436	59%	0.585	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-108.8	121.9	176.6	-58.3	173.2	0	0	0	108	K66 A67 V68 P98 K102	K66-I100 HydrophobicContact CG-CG2 4.17Å; A67-I100 WeakPolarHBondContact O-CA 3.34Å; V68-I100 HydrophobicContact CG1-CG1 4.06Å; V68-I100 HydrophobicContact CG2-CG1 4.28Å; V68-I100 HydrophobicContact CG2-CG2 4.48Å; P98-I100 HydrophobicContact CG-CG1 4.49Å; I100-K102 HydrophobicContact CG2-CG 3.97Å
101	I	95.4	Very high	93.2	Very high	67 Å²	67	103.6 Å²	103.6	34%	0.344	57%	0.572	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109	124.9	172.2	-58.3	-179.6	0	0	0	106.8	L63 K66 A67 Y69 L99	L63-I101 HydrophobicContact CD1-CB 4.42Å; L63-I101 HydrophobicContact CD1-CG2 3.76Å; K66-I101 WeakPolarHBondContact CA-O 3.27Å; A67-I101 PolarHBondContact N-O 2.75Å; A67-I101 PolarHBondContact O-N 2.97Å; Y69-I101 HydrophobicContact CD2-CD1 4.14Å; Y69-I101 HydrophobicContact CD2-CG1 4.44Å; Y69-I101 HydrophobicContact CE2-CD1 3.94Å; Y69-I101 HydrophobicContact CE2-CG1 4.45Å; L99-I101 HydrophobicContact CD2-CD1 4.26Å; L99-I101 HydrophobicContact CD2-CG1 4.39Å; L99-I101 HydrophobicContact CG-CG1 4.21Å
102	K	93.4	Very high	92.9	Very high	146 Å²	146	101.6 Å²	101.6	64%	0.635	57%	0.568	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-119.5	138.4	176.4	-65.4	-177.6	-179.6	-178	0	108.8	D65 K66 I100	D65-K102 WeakPolarHBondContact O-CA 3.34Å; K66-K102 HydrophobicContact CG-CG 4.22Å; I100-K102 HydrophobicContact CG2-CG 3.97Å
103	R	89.3	Confident	92.6	Very high	133 Å²	133	103 Å²	103	50%	0.502	57%	0.573	S	S	.	*	P	Polyproline II helix	trans	-66.3	135.2	166.5	-167.9	174.1	-70.1	-121.9	3.8	107.7	E61 L63 D65 E105	E61-R103 PolarHBondContact O-NH2 3.21Å; L63-R103 PolarHBondContact O-NH2 3.17Å; D65-R103 PolarHBondContact O-N 2.8Å; R103-E105 PolarHBondContact O-N 3.32Å
104	K	85.9	Confident	92.2	Very high	195 Å²	195	105.4 Å²	105.4	85%	0.848	56%	0.56	S	S	*	*	P	Polyproline II helix	trans	-65.8	127.4	173.9	-171.5	-177.3	172.5	-176.1	0	107.5	A106	K104-A106 PolarHBondContact O-N 3.31Å
105	E	79.1	Confident	91.7	Very high	184 Å²	184	108.8 Å²	108.8	86%	0.86	58%	0.578	S	S	*	*	P	Polyproline II helix	trans	-60.2	132.3	169.5	-66.1	177.7	-171.5	0	0	108.3	R103	R103-E105 PolarHBondContact O-N 3.32Å
106	A	67.7	Low	91.1	Very high	175 Å²	175	105.4 Å²	105.4	100%	1.446	56%	0.559	S	S	*	*			trans	-70.3	0	-176.8	0	0	0	0	0	111.8	K104	K104-A106 PolarHBondContact O-N 3.31Å

Retrieved 106 of 106 residues in 606.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).