A0A060YIZ6_ONCMY Loading...

Small integral membrane protein 19

AlphaFold DB , UniProt , Accession A0A060YIZ6, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110488811, Length 106 aa.

						>A0A060YIZ6_ONCMY|A0A060YIZ6|LOC110488811
MGGHGVMESEESLDYSVHEAWNEATNVYLLVILVSFGLLMYARKNKRKIMRIFALPPTAGATAEPNFYDSLQKVRLRQQLEMYSLARKFDQQQHQGQSESVQLSME
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.4	Very low	51.7	Low	253 Å²	253	120.9 Å²	120.9	100%	1.246	70%	0.702	S	S	*	*				0	90.2	0	-78.4	154.4	132.1	0	0	107.4
2	G	49.5	Very low	51.9	Low	87 Å²	87	116.8 Å²	116.8	90%	0.897	69%	0.685	S	S	*	*			trans	-144.2	83	-176.5	0	0	0	0	0	108
3	G	47.3	Very low	52	Low	64 Å²	64	116 Å²	116	66%	0.66	68%	0.675	S	S	*	*			trans	-165.1	22.3	-173.3	0	0	0	0	0	113.5
4	H	47.8	Very low	52.3	Low	163 Å²	163	115.1 Å²	115.1	76%	0.755	67%	0.666	S	S	*	*	S	Bend	trans	-113.1	-3.5	179.3	-150	-67.2	0	0	0	113.3
5	G	53.4	Low	52.5	Low	53 Å²	53	119.4 Å²	119.4	55%	0.546	67%	0.669	S	S	.	*	S	Bend	trans	-96.5	-13	178.9	0	0	0	0	0	115.2	S9	G5-S9 PolarHBondContact O-OG 3.44Å
6	V	54.1	Low	53	Low	99 Å²	99	116.6 Å²	116.6	60%	0.6	66%	0.659	S	S	*	*	H	α-helix	trans	-89.9	-34	-174.9	178.8	0	0	0	0	112	S9 E10	V6-S9 PolarHBondContact O-OG 3.39Å; V6-S9 VanDerWaalsContact O-OG 3.12Å; V6-E10 PolarHBondContact O-N 2.95Å
7	M	54.4	Low	53.7	Low	147 Å²	147	114.8 Å²	114.8	72%	0.724	65%	0.652	S	S	*	*	H	α-helix	trans	-73.2	-35.4	177.8	-79.3	-173.3	155.9	0	0	113.1	S9 E10 E11	M7-S9 VanDerWaalsContact C-N 3.31Å; M7-S9 PolarHBondContact O-N 3.23Å; M7-E10 PolarHBondContact O-N 3.18Å; M7-E11 PolarHBondContact O-N 3.26Å
8	E	53.3	Low	54.4	Low	137 Å²	137	115.1 Å²	115.1	64%	0.64	65%	0.646	S	S	*	*	H	α-helix	trans	-72.7	-26.9	-179.1	-155.8	173.5	-162.5	0	0	112.4	S12	E8-S12 WeakPolarHBondContact O-CB 3.49Å; E8-S12 PolarHBondContact O-N 3.32Å; E8-S12 PolarHBondContact O-OG 3.36Å
9	S	53.9	Low	55.2	Low	53 Å²	53	115.1 Å²	115.1	37%	0.371	64%	0.641	S	S	.	*	H	α-helix	trans	-78.2	-33.8	174.5	34.2	0	0	0	0	112.5	G5 V6 M7 S12 L13	G5-S9 PolarHBondContact O-OG 3.44Å; V6-S9 PolarHBondContact O-OG 3.39Å; V6-S9 VanDerWaalsContact O-OG 3.12Å; M7-S9 VanDerWaalsContact C-N 3.31Å; M7-S9 PolarHBondContact O-N 3.23Å; S9-S12 WeakPolarHBondContact CA-OG 3.27Å; S9-S12 PolarHBondContact O-OG 2.88Å; S9-L13 VanDerWaalsContact O-CB 3.28Å; S9-L13 WeakPolarHBondContact O-CB 3.27Å; S9-L13 VanDerWaalsContact O-CD1 3.31Å; S9-L13 WeakPolarHBondContact O-CD1 3.38Å; S9-L13 WeakPolarHBondContact O-CG 3.25Å; S9-L13 PolarHBondContact O-N 3.46Å
10	E	55.7	Low	56.1	Low	129 Å²	129	112.1 Å²	112.1	60%	0.603	63%	0.631	S	S	*	*	H	α-helix	trans	-71.7	-41.3	174.7	-70.8	-164	141.7	0	0	112.9	V6 M7 S12 L13 D14	V6-E10 PolarHBondContact O-N 2.95Å; M7-E10 PolarHBondContact O-N 3.18Å; E10-S12 PolarHBondContact O-N 2.81Å; E10-L13 PolarHBondContact O-N 3.12Å; E10-D14 PolarHBondContact O-N 3.31Å
11	E	54.5	Low	57.1	Low	145 Å²	145	115.4 Å²	115.4	68%	0.678	63%	0.634	S	S	*	*	H	α-helix	trans	-67.8	-35.1	177.5	-74.5	-177.3	156.1	0	0	113.1	M7 Y15	M7-E11 PolarHBondContact O-N 3.26Å; E11-Y15 PolarHBondContact O-N 3.46Å
12	S	54.5	Low	58.6	Low	71 Å²	71	108 Å²	108	50%	0.497	60%	0.599	S	S	.	*	H	α-helix	trans	-75.1	-30.4	174.6	52.2	0	0	0	0	112.8	E8 S9 E10 S16	E8-S12 WeakPolarHBondContact O-CB 3.49Å; E8-S12 PolarHBondContact O-N 3.32Å; E8-S12 PolarHBondContact O-OG 3.36Å; S9-S12 WeakPolarHBondContact CA-OG 3.27Å; S9-S12 PolarHBondContact O-OG 2.88Å; E10-S12 PolarHBondContact O-N 2.81Å; S12-S16 WeakPolarHBondContact O-CB 3.5Å; S12-S16 PolarHBondContact O-N 3.37Å
13	L	53.2	Low	59.8	Low	107 Å²	107	110.3 Å²	110.3	56%	0.56	59%	0.587	S	S	*	*	H	α-helix	trans	-68.1	-41.2	170.6	-77.6	169.1	0	0	0	111.9	S9 E10 Y15 S16 V17	S9-L13 VanDerWaalsContact O-CB 3.28Å; S9-L13 WeakPolarHBondContact O-CB 3.27Å; S9-L13 VanDerWaalsContact O-CD1 3.31Å; S9-L13 WeakPolarHBondContact O-CD1 3.38Å; S9-L13 WeakPolarHBondContact O-CG 3.25Å; S9-L13 PolarHBondContact O-N 3.46Å; E10-L13 PolarHBondContact O-N 3.12Å; L13-Y15 VanDerWaalsContact C-N 3.31Å; L13-Y15 PolarHBondContact O-N 3.07Å; L13-S16 PolarHBondContact O-N 3.3Å; L13-V17 WeakPolarHBondContact O-CB 3.38Å; L13-V17 VanDerWaalsContact O-CG2 3.27Å; L13-V17 WeakPolarHBondContact O-CG2 3.31Å; L13-V17 PolarHBondContact O-N 3.44Å
14	D	55.7	Low	61.4	Low	103 Å²	103	109.2 Å²	109.2	55%	0.551	57%	0.571	S	S	*	*	H	α-helix	trans	-62.4	-40.4	175.4	-114.9	-2.5	0	0	0	111.1	E10 V17 H18	E10-D14 PolarHBondContact O-N 3.31Å; D14-V17 PolarHBondContact O-N 2.73Å; D14-H18 WeakPolarHBondContact O-CB 3.29Å; D14-H18 PolarHBondContact O-CD2 3.4Å; D14-H18 PolarHBondContact O-N 3.17Å
15	Y	56.2	Low	63.2	Low	180 Å²	180	103.3 Å²	103.3	71%	0.706	55%	0.547	S	S	*	.	H	α-helix	trans	-63.8	-42.2	173.4	-122.7	-88.3	0	0	0	112.6	E11 L13 V17 H18 E19	E11-Y15 PolarHBondContact O-N 3.46Å; L13-Y15 VanDerWaalsContact C-N 3.31Å; L13-Y15 PolarHBondContact O-N 3.07Å; Y15-V17 PolarHBondContact O-N 2.79Å; Y15-H18 PolarHBondContact O-N 3.47Å; Y15-E19 WeakPolarHBondContact O-CB 3.02Å; Y15-E19 PolarHBondContact O-N 2.82Å
16	S	60.8	Low	64.8	Low	74 Å²	74	105.1 Å²	105.1	52%	0.517	54%	0.544	S	S	.	.	H	α-helix	trans	-65.7	-35.4	175.8	-176	0	0	0	0	113	S12 L13 A20	S12-S16 WeakPolarHBondContact O-CB 3.5Å; S12-S16 PolarHBondContact O-N 3.37Å; L13-S16 PolarHBondContact O-N 3.3Å; S16-A20 WeakPolarHBondContact O-CB 3.28Å; S16-A20 PolarHBondContact O-N 3.43Å
17	V	64.5	Low	66.4	Low	87 Å²	87	104.3 Å²	104.3	53%	0.527	54%	0.539	S	S	.	.	H	α-helix	trans	-73.2	-40.4	177.8	170.3	0	0	0	0	110.4	L13 D14 Y15 E19 A20 W21	L13-V17 WeakPolarHBondContact O-CB 3.38Å; L13-V17 VanDerWaalsContact O-CG2 3.27Å; L13-V17 WeakPolarHBondContact O-CG2 3.31Å; L13-V17 PolarHBondContact O-N 3.44Å; D14-V17 PolarHBondContact O-N 2.73Å; Y15-V17 PolarHBondContact O-N 2.79Å; V17-E19 VanDerWaalsContact C-N 3.32Å; V17-E19 PolarHBondContact O-N 3.4Å; V17-A20 PolarHBondContact O-N 2.87Å; V17-W21 VanDerWaalsContact O-CB 3.3Å; V17-W21 WeakPolarHBondContact O-CB 3.48Å; V17-W21 PolarHBondContact O-N 2.8Å
18	H	66.6	Low	68.1	Low	119 Å²	119	104.9 Å²	104.9	55%	0.551	53%	0.534	S	S	*	.	H	α-helix	trans	-63.6	-37.4	173.4	-80.9	-60.8	0	0	0	112.5	D14 Y15 W21 N22	D14-H18 WeakPolarHBondContact O-CB 3.29Å; D14-H18 PolarHBondContact O-CD2 3.4Å; D14-H18 PolarHBondContact O-N 3.17Å; Y15-H18 PolarHBondContact O-N 3.47Å; H18-W21 PolarHBondContact O-N 3.16Å; H18-N22 VanDerWaalsContact O-CB 3.23Å; H18-N22 WeakPolarHBondContact O-CB 3.45Å; H18-N22 PolarHBondContact O-N 2.83Å
19	E	69	Low	69.9	Low	116 Å²	116	102.8 Å²	102.8	54%	0.542	53%	0.527	S	S	.	.	H	α-helix	trans	-63.6	-47.7	173.4	-157.5	82.6	-141.8	0	0	111.1	Y15 V17 W21 N22 E23	Y15-E19 WeakPolarHBondContact O-CB 3.02Å; Y15-E19 PolarHBondContact O-N 2.82Å; V17-E19 VanDerWaalsContact C-N 3.32Å; V17-E19 PolarHBondContact O-N 3.4Å; E19-W21 VanDerWaalsContact C-N 3.3Å; E19-W21 PolarHBondContact O-N 2.78Å; E19-N22 WeakPolarHBondContact O-CB 3.5Å; E19-N22 PolarHBondContact O-N 2.95Å; E19-E23 WeakPolarHBondContact O-CB 3.37Å; E19-E23 PolarHBondContact O-N 3.03Å
20	A	72.7	Confident	71.7	Confident	54 Å²	54	105 Å²	105	45%	0.446	53%	0.534	S	S	.	.	H	α-helix	trans	-65	-34.1	177.3	0	0	0	0	0	112.5	S16 V17 A24	S16-A20 WeakPolarHBondContact O-CB 3.28Å; S16-A20 PolarHBondContact O-N 3.43Å; V17-A20 PolarHBondContact O-N 2.87Å; A20-A24 VanDerWaalsContact O-CB 3.28Å; A20-A24 WeakPolarHBondContact O-CB 3.17Å; A20-A24 PolarHBondContact O-N 2.75Å
21	W	78	Confident	73.5	Confident	182 Å²	182	103.1 Å²	103.1	69%	0.689	53%	0.531	S	S	*	.	H	α-helix	trans	-72.1	-37.6	175.4	-156.1	81.8	0	0	0	111.6	V17 H18 E19 T25	V17-W21 VanDerWaalsContact O-CB 3.3Å; V17-W21 WeakPolarHBondContact O-CB 3.48Å; V17-W21 PolarHBondContact O-N 2.8Å; H18-W21 PolarHBondContact O-N 3.16Å; E19-W21 VanDerWaalsContact C-N 3.3Å; E19-W21 PolarHBondContact O-N 2.78Å; W21-T25 WeakPolarHBondContact O-CB 3.45Å; W21-T25 PolarHBondContact O-N 3.39Å; W21-T25 PolarHBondContact O-OG1 2.83Å
22	N	76.4	Confident	75.4	Confident	97 Å²	97	100.5 Å²	100.5	52%	0.519	52%	0.521	S	S	.	.	H	α-helix	trans	-66.2	-42.7	173.9	-179.7	52.2	0	0	0	111.4	H18 E19 T25 N26	H18-N22 VanDerWaalsContact O-CB 3.23Å; H18-N22 WeakPolarHBondContact O-CB 3.45Å; H18-N22 PolarHBondContact O-N 2.83Å; E19-N22 WeakPolarHBondContact O-CB 3.5Å; E19-N22 PolarHBondContact O-N 2.95Å; N22-T25 PolarHBondContact O-N 2.81Å; N22-N26 VanDerWaalsContact O-CB 3.31Å; N22-N26 WeakPolarHBondContact O-CB 3.17Å; N22-N26 PolarHBondContact O-N 3.4Å
23	E	74.3	Confident	77.3	Confident	136 Å²	136	102.8 Å²	102.8	64%	0.636	53%	0.527	S	S	*	.	H	α-helix	trans	-62.6	-48.8	175.3	-171.3	176.3	-177.4	0	0	111.1	E19 T25 N26 V27	E19-E23 WeakPolarHBondContact O-CB 3.37Å; E19-E23 PolarHBondContact O-N 3.03Å; E23-T25 VanDerWaalsContact C-N 3.33Å; E23-T25 PolarHBondContact O-N 2.84Å; E23-N26 PolarHBondContact O-N 2.74Å; E23-V27 WeakPolarHBondContact O-CG2 3.15Å; E23-V27 PolarHBondContact O-N 2.97Å
24	A	81.4	Confident	79.3	Confident	41 Å²	41	102 Å²	102	34%	0.339	53%	0.527	S	S	.	.	H	α-helix	trans	-59.4	-44.3	175.1	0	0	0	0	0	111.6	A20 N26 V27 Y28	A20-A24 VanDerWaalsContact O-CB 3.28Å; A20-A24 WeakPolarHBondContact O-CB 3.17Å; A20-A24 PolarHBondContact O-N 2.75Å; A24-N26 PolarHBondContact O-N 2.81Å; A24-V27 WeakPolarHBondContact O-CB 3.38Å; A24-V27 PolarHBondContact O-N 2.8Å; A24-Y28 HydrophobicContact CB-CE2 4.16Å; A24-Y28 WeakPolarHBondContact O-CD2 3.29Å; A24-Y28 PolarHBondContact O-N 2.94Å
25	T	84.1	Confident	81.1	Confident	40 Å²	40	100.4 Å²	100.4	25%	0.245	52%	0.523	C	S	.	.	H	α-helix	trans	-62.8	-43.6	178.4	-61.9	0	0	0	0	111.6	W21 N22 E23 V27 Y28 L29	W21-T25 WeakPolarHBondContact O-CB 3.45Å; W21-T25 PolarHBondContact O-N 3.39Å; W21-T25 PolarHBondContact O-OG1 2.83Å; N22-T25 PolarHBondContact O-N 2.81Å; E23-T25 VanDerWaalsContact C-N 3.33Å; E23-T25 PolarHBondContact O-N 2.84Å; T25-V27 VanDerWaalsContact C-N 3.31Å; T25-V27 PolarHBondContact O-N 2.88Å; T25-Y28 CarbonylContact O-C 3.59Å; T25-Y28 PolarHBondContact O-N 2.91Å; T25-Y28 VanDerWaalsContact O-N 3.12Å; T25-L29 HydrophobicContact CG2-CD1 4.01Å; T25-L29 HydrophobicContact CG2-CG 4.18Å; T25-L29 WeakPolarHBondContact O-CB 3.38Å; T25-L29 VanDerWaalsContact O-CG 3.24Å; T25-L29 WeakPolarHBondContact O-CG 3.16Å; T25-L29 PolarHBondContact O-N 2.88Å
26	N	86.5	Confident	82.9	Confident	90 Å²	90	98.3 Å²	98.3	48%	0.481	52%	0.518	S	S	.	.	H	α-helix	trans	-61.8	-41.2	177.9	-165.5	9.3	0	0	0	111.3	N22 E23 A24 Y28 L29 L30	N22-N26 VanDerWaalsContact O-CB 3.31Å; N22-N26 WeakPolarHBondContact O-CB 3.17Å; N22-N26 PolarHBondContact O-N 3.4Å; E23-N26 PolarHBondContact O-N 2.74Å; A24-N26 PolarHBondContact O-N 2.81Å; N26-Y28 PolarHBondContact O-N 3.48Å; N26-L29 PolarHBondContact O-N 3.48Å; N26-L30 WeakPolarHBondContact O-CG 3.48Å; N26-L30 PolarHBondContact O-N 3.24Å
27	V	88.4	Confident	84.3	Confident	83 Å²	83	96.8 Å²	96.8	50%	0.503	51%	0.514	S	S	.	.	H	α-helix	trans	-60	-46.4	172.1	174.9	0	0	0	0	111	E23 A24 T25 L29 L30 V31	E23-V27 WeakPolarHBondContact O-CG2 3.15Å; E23-V27 PolarHBondContact O-N 2.97Å; A24-V27 WeakPolarHBondContact O-CB 3.38Å; A24-V27 PolarHBondContact O-N 2.8Å; T25-V27 VanDerWaalsContact C-N 3.31Å; T25-V27 PolarHBondContact O-N 2.88Å; V27-L29 PolarHBondContact O-N 2.91Å; V27-L30 PolarHBondContact O-N 3.48Å; V27-V31 WeakPolarHBondContact O-CG2 3.46Å; V27-V31 PolarHBondContact O-N 3.44Å
28	Y	90.4	Very high	85.4	Confident	158 Å²	158	98 Å²	98	62%	0.62	52%	0.517	S	S	*	.	H	α-helix	trans	-62.5	-40.5	176.6	-69.6	-60.5	0	0	0	112.6	A24 T25 N26 L30 V31 I32	A24-Y28 HydrophobicContact CB-CE2 4.16Å; A24-Y28 WeakPolarHBondContact O-CD2 3.29Å; A24-Y28 PolarHBondContact O-N 2.94Å; T25-Y28 CarbonylContact O-C 3.59Å; T25-Y28 PolarHBondContact O-N 2.91Å; T25-Y28 VanDerWaalsContact O-N 3.12Å; N26-Y28 PolarHBondContact O-N 3.48Å; Y28-L30 VanDerWaalsContact C-N 3.34Å; Y28-L30 PolarHBondContact O-N 2.85Å; Y28-V31 PolarHBondContact O-N 3.37Å; Y28-I32 WeakPolarHBondContact O-CB 3.44Å; Y28-I32 WeakPolarHBondContact O-CD1 3.27Å; Y28-I32 WeakPolarHBondContact O-CG1 3.28Å; Y28-I32 PolarHBondContact O-N 2.64Å
29	L	91.6	Very high	86.3	Confident	93 Å²	93	97 Å²	97	49%	0.487	52%	0.515	S	S	.	.	H	α-helix	trans	-62.9	-40.4	177.6	-70.4	174.4	0	0	0	111.6	T25 N26 V27 I32 L33	T25-L29 HydrophobicContact CG2-CD1 4.01Å; T25-L29 HydrophobicContact CG2-CG 4.18Å; T25-L29 WeakPolarHBondContact O-CB 3.38Å; T25-L29 VanDerWaalsContact O-CG 3.24Å; T25-L29 WeakPolarHBondContact O-CG 3.16Å; T25-L29 PolarHBondContact O-N 2.88Å; N26-L29 PolarHBondContact O-N 3.48Å; V27-L29 PolarHBondContact O-N 2.91Å; L29-I32 PolarHBondContact O-N 3.26Å; L29-L33 WeakPolarHBondContact O-CB 3.38Å; L29-L33 WeakPolarHBondContact O-CG 3.4Å; L29-L33 PolarHBondContact O-N 2.65Å
30	L	91.8	Very high	87	Confident	100 Å²	100	98 Å²	98	52%	0.524	52%	0.522	S	S	.	.	H	α-helix	trans	-64.6	-44.4	173.6	-70.3	176.3	0	0	0	111.9	N26 V27 Y28 I32 L33 V34	N26-L30 WeakPolarHBondContact O-CG 3.48Å; N26-L30 PolarHBondContact O-N 3.24Å; V27-L30 PolarHBondContact O-N 3.48Å; Y28-L30 VanDerWaalsContact C-N 3.34Å; Y28-L30 PolarHBondContact O-N 2.85Å; L30-I32 VanDerWaalsContact C-N 3.31Å; L30-I32 PolarHBondContact O-N 2.65Å; L30-L33 PolarHBondContact O-N 3.38Å; L30-V34 WeakPolarHBondContact O-CB 3.32Å; L30-V34 VanDerWaalsContact O-CG2 3.27Å; L30-V34 WeakPolarHBondContact O-CG2 3.37Å; L30-V34 PolarHBondContact O-N 2.86Å
31	V	93.4	Very high	87.4	Confident	89 Å²	89	103.1 Å²	103.1	54%	0.539	53%	0.53	S	S	.	.	H	α-helix	trans	-60.9	-41.9	176.1	172.5	0	0	0	0	111	V27 Y28 V34 S35	V27-V31 WeakPolarHBondContact O-CG2 3.46Å; V27-V31 PolarHBondContact O-N 3.44Å; Y28-V31 PolarHBondContact O-N 3.37Å; V31-V34 PolarHBondContact O-N 2.77Å; V31-S35 WeakPolarHBondContact O-CB 3.1Å; V31-S35 PolarHBondContact O-N 3Å
32	I	93.4	Very high	87.3	Confident	90 Å²	90	96.4 Å²	96.4	46%	0.462	51%	0.514	S	S	.	.	H	α-helix	trans	-64.3	-44.6	176.8	-69.2	162.7	0	0	0	110.8	Y28 L29 L30 S35 F36	Y28-I32 WeakPolarHBondContact O-CB 3.44Å; Y28-I32 WeakPolarHBondContact O-CD1 3.27Å; Y28-I32 WeakPolarHBondContact O-CG1 3.28Å; Y28-I32 PolarHBondContact O-N 2.64Å; L29-I32 PolarHBondContact O-N 3.26Å; L30-I32 VanDerWaalsContact C-N 3.31Å; L30-I32 PolarHBondContact O-N 2.65Å; I32-S35 WeakPolarHBondContact O-CB 3.27Å; I32-S35 PolarHBondContact O-N 3.07Å; I32-F36 HydrophobicContact CG2-CD2 4.11Å; I32-F36 WeakPolarHBondContact O-CB 3.4Å; I32-F36 PolarHBondContact O-N 2.84Å
33	L	94.8	Very high	87.2	Confident	120 Å²	120	99.5 Å²	99.5	63%	0.628	52%	0.518	S	S	*	.	H	α-helix	trans	-63.3	-45	177.1	-82	168.2	0	0	0	112.2	L29 L30 S35 F36 G37	L29-L33 WeakPolarHBondContact O-CB 3.38Å; L29-L33 WeakPolarHBondContact O-CG 3.4Å; L29-L33 PolarHBondContact O-N 2.65Å; L30-L33 PolarHBondContact O-N 3.38Å; L33-S35 VanDerWaalsContact C-N 3.33Å; L33-F36 PolarHBondContact O-N 2.79Å; L33-G37 PolarHBondContact O-N 2.76Å
34	V	94.7	Very high	87.1	Confident	91 Å²	91	101.8 Å²	101.8	55%	0.552	53%	0.526	S	S	*	.	H	α-helix	trans	-62.8	-42.9	176.2	170.8	0	0	0	0	110.4	L30 V31 G37 L38	L30-V34 WeakPolarHBondContact O-CB 3.32Å; L30-V34 VanDerWaalsContact O-CG2 3.27Å; L30-V34 WeakPolarHBondContact O-CG2 3.37Å; L30-V34 PolarHBondContact O-N 2.86Å; V31-V34 PolarHBondContact O-N 2.77Å; V34-G37 PolarHBondContact O-N 3.47Å; V34-L38 HydrophobicContact CG1-CD1 3.76Å; V34-L38 WeakPolarHBondContact O-CB 3.16Å; V34-L38 WeakPolarHBondContact O-CD1 3.21Å; V34-L38 WeakPolarHBondContact O-CG 3.44Å; V34-L38 PolarHBondContact O-N 3.43Å
35	S	93.4	Very high	86.4	Confident	68 Å²	68	102 Å²	102	48%	0.476	52%	0.522	S	S	.	.	H	α-helix	trans	-60.1	-47	174.4	-177	0	0	0	0	111.8	V31 I32 L33 G37 L38 L39	V31-S35 WeakPolarHBondContact O-CB 3.1Å; V31-S35 PolarHBondContact O-N 3Å; I32-S35 WeakPolarHBondContact O-CB 3.27Å; I32-S35 PolarHBondContact O-N 3.07Å; L33-S35 VanDerWaalsContact C-N 3.33Å; S35-G37 PolarHBondContact O-N 2.85Å; S35-L38 PolarHBondContact O-N 2.83Å; S35-L39 WeakPolarHBondContact O-CB 3.15Å; S35-L39 PolarHBondContact O-N 3.14Å
36	F	94	Very high	85.5	Confident	136 Å²	136	105.1 Å²	105.1	60%	0.596	53%	0.532	S	S	*	.	H	α-helix	trans	-63.9	-38.7	175.6	-105.9	-83.1	0	0	0	112.6	I32 L33 L39 M40	I32-F36 HydrophobicContact CG2-CD2 4.11Å; I32-F36 WeakPolarHBondContact O-CB 3.4Å; I32-F36 PolarHBondContact O-N 2.84Å; L33-F36 PolarHBondContact O-N 2.79Å; F36-L39 PolarHBondContact O-N 2.77Å; F36-M40 VanDerWaalsContact O-CB 3.31Å; F36-M40 WeakPolarHBondContact O-CB 3.4Å; F36-M40 PolarHBondContact O-N 3.11Å
37	G	91.5	Very high	84.3	Confident	42 Å²	42	111.6 Å²	111.6	43%	0.433	55%	0.549	S	S	.	.	H	α-helix	trans	-63.8	-47	175.8	0	0	0	0	0	111.9	L33 V34 S35 M40 Y41	L33-G37 PolarHBondContact O-N 2.76Å; V34-G37 PolarHBondContact O-N 3.47Å; S35-G37 PolarHBondContact O-N 2.85Å; G37-M40 PolarHBondContact O-N 3.01Å; G37-Y41 WeakPolarHBondContact O-CB 2.99Å; G37-Y41 PolarHBondContact O-N 3.04Å
38	L	88.2	Confident	83.1	Confident	114 Å²	114	114.5 Å²	114.5	60%	0.597	56%	0.556	S	S	*	*	H	α-helix	trans	-62.3	-42.9	173.6	-77	160.4	0	0	0	111.5	V34 S35 Y41 A42	V34-L38 HydrophobicContact CG1-CD1 3.76Å; V34-L38 WeakPolarHBondContact O-CB 3.16Å; V34-L38 WeakPolarHBondContact O-CD1 3.21Å; V34-L38 WeakPolarHBondContact O-CG 3.44Å; V34-L38 PolarHBondContact O-N 3.43Å; S35-L38 PolarHBondContact O-N 2.83Å; L38-Y41 PolarHBondContact O-N 2.99Å; L38-A42 VanDerWaalsContact O-CB 3.24Å; L38-A42 WeakPolarHBondContact O-CB 3.19Å; L38-A42 PolarHBondContact O-N 3.43Å
39	L	84.3	Confident	81.7	Confident	96 Å²	96	110.8 Å²	110.8	50%	0.503	55%	0.546	S	S	.	.	H	α-helix	trans	-67	-42.2	178.4	-174.4	136.5	0	0	0	111.5	S35 F36 R43	S35-L39 WeakPolarHBondContact O-CB 3.15Å; S35-L39 PolarHBondContact O-N 3.14Å; F36-L39 PolarHBondContact O-N 2.77Å; L39-R43 WeakPolarHBondContact O-CA 3.13Å; L39-R43 WeakPolarHBondContact O-CB 3.2Å; L39-R43 PolarHBondContact O-N 3.45Å
40	M	84.7	Confident	80.2	Confident	138 Å²	138	112.9 Å²	112.9	68%	0.68	55%	0.554	S	S	*	*	H	α-helix	trans	-65.3	-40.9	172.6	-90.9	-140.3	152	0	0	111.7	F36 G37 R43 K44	F36-M40 VanDerWaalsContact O-CB 3.31Å; F36-M40 WeakPolarHBondContact O-CB 3.4Å; F36-M40 PolarHBondContact O-N 3.11Å; G37-M40 PolarHBondContact O-N 3.01Å; M40-R43 CarbonylContact O-C 3.42Å; M40-R43 PolarHBondContact O-N 3.18Å; M40-K44 VanDerWaalsContact O-CB 3.26Å; M40-K44 WeakPolarHBondContact O-CB 3.05Å; M40-K44 PolarHBondContact O-N 3.04Å
41	Y	81.1	Confident	78.8	Confident	161 Å²	161	117.9 Å²	117.9	63%	0.631	57%	0.566	S	S	*	*	H	α-helix	trans	-63.2	-48.9	177.1	-178.6	-95.4	0	0	0	111.2	G37 L38 R43 K44 N45	G37-Y41 WeakPolarHBondContact O-CB 2.99Å; G37-Y41 PolarHBondContact O-N 3.04Å; L38-Y41 PolarHBondContact O-N 2.99Å; Y41-R43 VanDerWaalsContact C-N 3.33Å; Y41-R43 PolarHBondContact O-N 3.06Å; Y41-K44 PolarHBondContact O-N 2.78Å; Y41-N45 WeakPolarHBondContact CE1-ND2 3.43Å; Y41-N45 VanDerWaalsContact CE2-ND2 3.31Å; Y41-N45 WeakPolarHBondContact CE2-ND2 3.32Å; Y41-N45 WeakPolarHBondContact O-CB 3.45Å; Y41-N45 PolarHBondContact O-N 3.09Å; Y41-N45 PolarHBondContact O-ND2 3.38Å
42	A	75	Confident	77.5	Confident	42 Å²	42	119.7 Å²	119.7	35%	0.347	57%	0.572	S	S	.	*	H	α-helix	trans	-61.6	-40.9	173.2	0	0	0	0	0	111.2	L38 K44 N45 K46	L38-A42 VanDerWaalsContact O-CB 3.24Å; L38-A42 WeakPolarHBondContact O-CB 3.19Å; L38-A42 PolarHBondContact O-N 3.43Å; A42-K44 VanDerWaalsContact C-N 3.32Å; A42-K44 PolarHBondContact O-N 3.22Å; A42-N45 CarbonylContact O-C 3.28Å; A42-N45 VanDerWaalsContact O-C 3.28Å; A42-N45 PolarHBondContact O-N 2.79Å; A42-K46 WeakPolarHBondContact O-CA 3.41Å; A42-K46 WeakPolarHBondContact O-CB 3.24Å; A42-K46 PolarHBondContact O-N 2.88Å
43	R	74.5	Confident	75.8	Confident	161 Å²	161	123.9 Å²	123.9	61%	0.608	59%	0.587	S	S	*	*	H	α-helix	trans	-73.4	-17.6	176.8	-171.8	175	-179.9	149.3	4.9	112.7	L39 M40 Y41 K46	L39-R43 WeakPolarHBondContact O-CA 3.13Å; L39-R43 WeakPolarHBondContact O-CB 3.2Å; L39-R43 PolarHBondContact O-N 3.45Å; M40-R43 CarbonylContact O-C 3.42Å; M40-R43 PolarHBondContact O-N 3.18Å; Y41-R43 VanDerWaalsContact C-N 3.33Å; Y41-R43 PolarHBondContact O-N 3.06Å; R43-K46 HydrophobicContact CG-CD 3.99Å; R43-K46 WeakPolarHBondContact O-CD 3.14Å; R43-K46 WeakPolarHBondContact O-CE 3.07Å; R43-K46 WeakPolarHBondContact O-CG 3.36Å; R43-K46 PolarHBondContact O-NZ 3.47Å
44	K	71.9	Confident	73.9	Confident	184 Å²	184	120.8 Å²	120.8	80%	0.8	58%	0.578	S	S	*	*	H	α-helix	trans	-88	-35.3	171.9	-165.3	170.2	-179	177.1	0	110.3	M40 Y41 A42	M40-K44 VanDerWaalsContact O-CB 3.26Å; M40-K44 WeakPolarHBondContact O-CB 3.05Å; M40-K44 PolarHBondContact O-N 3.04Å; Y41-K44 PolarHBondContact O-N 2.78Å; A42-K44 VanDerWaalsContact C-N 3.32Å; A42-K44 PolarHBondContact O-N 3.22Å
45	N	67.1	Low	71.7	Confident	46 Å²	46	123 Å²	123	25%	0.246	59%	0.586	C	S	.	*	S	Bend	trans	-94.7	15.9	176.4	-65.1	-36.6	0	0	0	113.8	Y41 A42 R47 K48 I49	Y41-N45 WeakPolarHBondContact CE1-ND2 3.43Å; Y41-N45 VanDerWaalsContact CE2-ND2 3.31Å; Y41-N45 WeakPolarHBondContact CE2-ND2 3.32Å; Y41-N45 WeakPolarHBondContact O-CB 3.45Å; Y41-N45 PolarHBondContact O-N 3.09Å; Y41-N45 PolarHBondContact O-ND2 3.38Å; A42-N45 CarbonylContact O-C 3.28Å; A42-N45 VanDerWaalsContact O-C 3.28Å; A42-N45 PolarHBondContact O-N 2.79Å; N45-R47 PolarHBondContact O-N 2.76Å; N45-R47 VanDerWaalsContact O-N 3.09Å; N45-K48 WeakPolarHBondContact O-CA 2.89Å; N45-K48 WeakPolarHBondContact O-CB 3.1Å; N45-K48 PolarHBondContact O-N 3.39Å; N45-I49 PolarHBondContact O-N 3.4Å
46	K	64.5	Low	69.7	Low	105 Å²	105	125 Å²	125	46%	0.457	60%	0.598	S	S	.	*	H	α-helix	trans	-56.6	-31.1	-173.5	47.8	-169.7	170.6	-140.6	0	113.7	A42 R43 K48 M50	A42-K46 WeakPolarHBondContact O-CA 3.41Å; A42-K46 WeakPolarHBondContact O-CB 3.24Å; A42-K46 PolarHBondContact O-N 2.88Å; R43-K46 HydrophobicContact CG-CD 3.99Å; R43-K46 WeakPolarHBondContact O-CD 3.14Å; R43-K46 WeakPolarHBondContact O-CE 3.07Å; R43-K46 WeakPolarHBondContact O-CG 3.36Å; R43-K46 PolarHBondContact O-NZ 3.47Å; K46-K48 VanDerWaalsContact C-N 3.33Å; K46-K48 PolarHBondContact O-N 3.44Å; K46-M50 WeakPolarHBondContact O-CB 3.31Å; K46-M50 PolarHBondContact O-N 2.86Å
47	R	61.5	Low	67.6	Low	226 Å²	226	123.4 Å²	123.4	85%	0.853	60%	0.601	S	S	*	*	H	α-helix	trans	-67.8	-27.9	172.6	-64.9	-173.3	-169.8	174.1	3.4	113.7	N45	N45-R47 PolarHBondContact O-N 2.76Å; N45-R47 VanDerWaalsContact O-N 3.09Å
48	K	62.3	Low	65.2	Low	145 Å²	145	126.4 Å²	126.4	63%	0.63	61%	0.611	S	S	*	*	H	α-helix	trans	-87.5	-42.4	178.5	-69.3	-172.7	177.8	-175.7	0	111.8	N45 K46 R51 I52	N45-K48 WeakPolarHBondContact O-CA 2.89Å; N45-K48 WeakPolarHBondContact O-CB 3.1Å; N45-K48 PolarHBondContact O-N 3.39Å; K46-K48 VanDerWaalsContact C-N 3.33Å; K46-K48 PolarHBondContact O-N 3.44Å; K48-R51 WeakPolarHBondContact O-CB 3.41Å; K48-R51 PolarHBondContact O-N 3.47Å; K48-I52 WeakPolarHBondContact O-CD1 3.35Å; K48-I52 WeakPolarHBondContact O-CG1 3.19Å; K48-I52 PolarHBondContact O-N 3.29Å
49	I	62.8	Low	63.1	Low	80 Å²	80	126.2 Å²	126.2	41%	0.41	63%	0.626	S	S	.	*	H	α-helix	trans	-72.6	-38.4	-179.6	-126.9	77.3	0	0	0	111.9	N45 R51 I52 F53	N45-I49 PolarHBondContact O-N 3.4Å; I49-R51 PolarHBondContact O-N 2.79Å; I49-I52 PolarHBondContact O-N 2.76Å; I49-F53 HydrophobicContact CG1-CD2 4.45Å; I49-F53 PolarHBondContact O-N 3.44Å
50	M	59.8	Low	61.1	Low	136 Å²	136	123.8 Å²	123.8	67%	0.67	62%	0.624	S	S	*	*	H	α-helix	trans	-62.4	-24.7	171.7	-169.4	-173.5	-74.2	0	0	111.1	K46 I52 A54	K46-M50 WeakPolarHBondContact O-CB 3.31Å; K46-M50 PolarHBondContact O-N 2.86Å; M50-I52 VanDerWaalsContact C-N 3.35Å; M50-A54 WeakPolarHBondContact O-CB 3.49Å; M50-A54 PolarHBondContact O-N 3.41Å; M50-A54 VanDerWaalsContact O-N 3.11Å
51	R	61.7	Low	59	Low	205 Å²	205	121.4 Å²	121.4	77%	0.774	63%	0.627	S	S	*	*	H	α-helix	trans	-75.7	-18.5	174.8	-116.6	-174.1	-174	163.5	2.3	114.5	K48 I49	K48-R51 WeakPolarHBondContact O-CB 3.41Å; K48-R51 PolarHBondContact O-N 3.47Å; I49-R51 PolarHBondContact O-N 2.79Å
52	I	66.7	Low	56.9	Low	128 Å²	128	118.2 Å²	118.2	66%	0.656	62%	0.624	S	S	*	*	H	α-helix	trans	-106.8	-32.5	-174.3	-56.4	160.5	0	0	0	110.7	K48 I49 M50	K48-I52 WeakPolarHBondContact O-CD1 3.35Å; K48-I52 WeakPolarHBondContact O-CG1 3.19Å; K48-I52 PolarHBondContact O-N 3.29Å; I49-I52 PolarHBondContact O-N 2.76Å; M50-I52 VanDerWaalsContact C-N 3.35Å
53	F	56.5	Low	55.4	Low	178 Å²	178	120.6 Å²	120.6	78%	0.781	64%	0.644	S	S	*	*	H	α-helix	trans	-97.8	-22.7	177.6	-85.9	-82.1	0	0	0	114.6	I49 L55	I49-F53 HydrophobicContact CG1-CD2 4.45Å; I49-F53 PolarHBondContact O-N 3.44Å; F53-L55 PolarHBondContact O-N 2.76Å
54	A	56.7	Low	53.8	Low	54 Å²	54	118.8 Å²	118.8	45%	0.446	64%	0.642	S	S	.	*	S	Bend	trans	-67.7	132.8	154.6	0	0	0	0	0	105.6	M50	M50-A54 WeakPolarHBondContact O-CB 3.49Å; M50-A54 PolarHBondContact O-N 3.41Å; M50-A54 VanDerWaalsContact O-N 3.11Å
55	L	48.2	Very low	52.9	Low	137 Å²	137	114.8 Å²	114.8	72%	0.717	64%	0.635	S	S	*	*			trans	-23.9	151.6	163.7	-87.6	56.4	0	0	0	112.9	F53	F53-L55 PolarHBondContact O-N 2.76Å
56	P	49.8	Very low	52.4	Low	110 Å²	110	116.6 Å²	116.6	71%	0.714	65%	0.645	S	S	*	*	S	Bend	trans	-37.4	123.9	170.7	18.7	-32.9	0	0	0	106.8	T58	P56-T58 PolarHBondContact O-N 3.34Å
57	P	50.8	Low	51.7	Low	104 Å²	104	117 Å²	117	68%	0.675	65%	0.647	S	S	*	*			trans	-43.7	115.9	-172.4	19.3	-31.8	0	0	0	104.2	A59	P57-A59 VanDerWaalsContact C-N 3.32Å; P57-A59 PolarHBondContact O-N 2.77Å
58	T	41.3	Very low	51.1	Low	104 Å²	104	114.7 Å²	114.7	64%	0.638	64%	0.639	S	S	*	*			trans	-39.5	113.6	172.4	41.6	0	0	0	0	104.1	P56 G60 A61	P56-T58 PolarHBondContact O-N 3.34Å; T58-G60 CarbonylContact O-C 3.51Å; T58-G60 VanDerWaalsContact O-CA 3.27Å; T58-G60 WeakPolarHBondContact O-CA 3.37Å; T58-G60 PolarHBondContact O-N 2.73Å; T58-A61 PolarHBondContact O-N 3.19Å
59	A	43.8	Very low	50.8	Low	111 Å²	111	111.2 Å²	111.2	92%	0.917	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.9	83.6	167.2	0	0	0	0	0	104.2	P57	P57-A59 VanDerWaalsContact C-N 3.32Å; P57-A59 PolarHBondContact O-N 2.77Å
60	G	43	Very low	50.6	Low	44 Å²	44	109.8 Å²	109.8	45%	0.454	63%	0.625	S	S	.	*	T	Hydrogen-bonded Turn	trans	165.7	-19.4	-146.5	0	0	0	0	0	114.8	T58 T62	T58-G60 CarbonylContact O-C 3.51Å; T58-G60 VanDerWaalsContact O-CA 3.27Å; T58-G60 WeakPolarHBondContact O-CA 3.37Å; T58-G60 PolarHBondContact O-N 2.73Å; G60-T62 PolarHBondContact O-N 3.46Å
61	A	39.1	Very low	50.4	Low	89 Å²	89	106.8 Å²	106.8	74%	0.736	61%	0.611	S	S	*	*				-81	59.6	130	0	0	0	0	0	106.8	T58 A63	T58-A61 PolarHBondContact O-N 3.19Å; A61-A63 VanDerWaalsContact C-N 3.25Å; A61-A63 PolarHBondContact O-N 3.3Å
62	T	39	Very low	50.1	Low	93 Å²	93	102.6 Å²	102.6	57%	0.571	60%	0.6	S	S	*	*			trans	-41.2	116.4	131.9	45.9	0	0	0	0	103.1	G60 E64	G60-T62 PolarHBondContact O-N 3.46Å; T62-E64 PolarHBondContact O-N 2.82Å
63	A	42.5	Very low	49.6	Very low	93 Å²	93	102.6 Å²	102.6	77%	0.769	60%	0.596	S	S	*	*			trans	-47.9	92.9	138.8	0	0	0	0	0	102.2	A61 P65	A61-A63 VanDerWaalsContact C-N 3.25Å; A61-A63 PolarHBondContact O-N 3.3Å; A63-P65 VanDerWaalsContact C-N 3.28Å; A63-P65 WeakPolarHBondContact O-CD 3.46Å
64	E	41.9	Very low	49.6	Very low	122 Å²	122	98.2 Å²	98.2	57%	0.57	58%	0.583	S	S	*	*			trans	-49.1	109.9	175.5	-172.4	-169.9	157.3	0	0	100.5	T62 N66 F67	T62-E64 PolarHBondContact O-N 2.82Å; E64-N66 WeakPolarHBondContact O-CA 3.39Å; E64-N66 PolarHBondContact O-N 3.45Å; E64-F67 HydrophobicContact CG-CB 4.4Å; E64-F67 HydrophobicContact CG-CD2 4.4Å; E64-F67 VanDerWaalsContact OE1-CB 3.28Å; E64-F67 WeakPolarHBondContact OE1-CB 3.18Å
65	P	51.8	Low	49.6	Very low	101 Å²	101	104.2 Å²	104.2	66%	0.656	59%	0.594	S	S	*	*			trans	-58.9	103.3	-167.6	19.7	-30.2	0	0	0	104.3	A63 F67	A63-P65 VanDerWaalsContact C-N 3.28Å; A63-P65 WeakPolarHBondContact O-CD 3.46Å; P65-F67 VanDerWaalsContact C-N 3.32Å; P65-F67 WeakPolarHBondContact O-CA 2.98Å; P65-F67 PolarHBondContact O-N 3.31Å
66	N	56.5	Low	50	Low	83 Å²	83	102.4 Å²	102.4	44%	0.444	59%	0.585	S	S	.	*			trans	-28.3	92.8	-152	-174.5	-16.4	0	0	0	110.5	E64 Y68 D69 S70	E64-N66 WeakPolarHBondContact O-CA 3.39Å; E64-N66 PolarHBondContact O-N 3.45Å; N66-Y68 PolarHBondContact O-N 2.91Å; N66-Y68 VanDerWaalsContact O-N 3.14Å; N66-D69 HydrophobicContact CB-CB 3.74Å; N66-D69 VanDerWaalsContact CG-OD2 3.27Å; N66-D69 PolarHBondContact ND2-OD2 2.84Å; N66-D69 CarbonylContact O-C 3.56Å; N66-D69 WeakPolarHBondContact O-CA 2.8Å; N66-D69 WeakPolarHBondContact O-CB 3.26Å; N66-D69 PolarHBondContact O-N 3.28Å; N66-D69 PolarHBondContact OD1-N 3.4Å; N66-D69 VanDerWaalsContact OD1-N 3.07Å; N66-S70 PolarHBondContact O-N 3.43Å
67	F	50.7	Low	50.3	Low	115 Å²	115	105.4 Å²	105.4	50%	0.504	58%	0.582	S	S	.	*	H	α-helix	trans	-62.2	-29.9	-168.3	-139.7	-86.8	0	0	0	109.1	E64 P65 S70 L71	E64-F67 HydrophobicContact CG-CB 4.4Å; E64-F67 HydrophobicContact CG-CD2 4.4Å; E64-F67 VanDerWaalsContact OE1-CB 3.28Å; E64-F67 WeakPolarHBondContact OE1-CB 3.18Å; P65-F67 VanDerWaalsContact C-N 3.32Å; P65-F67 WeakPolarHBondContact O-CA 2.98Å; P65-F67 PolarHBondContact O-N 3.31Å; F67-S70 PolarHBondContact O-N 3.48Å; F67-S70 PolarHBondContact O-OG 3.32Å; F67-L71 HydrophobicContact CD1-CD1 3.99Å; F67-L71 HydrophobicContact CD1-CG 4.24Å; F67-L71 WeakPolarHBondContact O-CB 3.47Å; F67-L71 VanDerWaalsContact O-CG 3.27Å; F67-L71 WeakPolarHBondContact O-CG 3.31Å; F67-L71 PolarHBondContact O-N 3Å
68	Y	49	Very low	50.6	Low	176 Å²	176	106.7 Å²	106.7	69%	0.69	58%	0.579	S	S	*	*	H	α-helix	trans	-64.8	-44.1	168.2	-96.6	-92.4	0	0	0	113.8	N66 S70 L71 Q72	N66-Y68 PolarHBondContact O-N 2.91Å; N66-Y68 VanDerWaalsContact O-N 3.14Å; Y68-S70 VanDerWaalsContact C-N 3.3Å; Y68-S70 PolarHBondContact O-N 2.85Å; Y68-L71 PolarHBondContact O-N 3.35Å; Y68-Q72 WeakPolarHBondContact O-CB 3.27Å; Y68-Q72 WeakPolarHBondContact O-CG 3.43Å; Y68-Q72 PolarHBondContact O-N 2.87Å
69	D	56.3	Low	51.3	Low	72 Å²	72	107.8 Å²	107.8	39%	0.385	58%	0.577	S	S	.	*	H	α-helix	trans	-63.8	-36.8	171.6	-83.7	-17.6	0	0	0	111.7	N66 K73	N66-D69 HydrophobicContact CB-CB 3.74Å; N66-D69 VanDerWaalsContact CG-OD2 3.27Å; N66-D69 PolarHBondContact ND2-OD2 2.84Å; N66-D69 CarbonylContact O-C 3.56Å; N66-D69 WeakPolarHBondContact O-CA 2.8Å; N66-D69 WeakPolarHBondContact O-CB 3.26Å; N66-D69 PolarHBondContact O-N 3.28Å; N66-D69 PolarHBondContact OD1-N 3.4Å; N66-D69 VanDerWaalsContact OD1-N 3.07Å; D69-K73 WeakPolarHBondContact O-CB 3.33Å; D69-K73 WeakPolarHBondContact O-CG 3.21Å; D69-K73 PolarHBondContact O-N 2.82Å
70	S	57.8	Low	51.9	Low	50 Å²	50	107.6 Å²	107.6	35%	0.35	56%	0.56	S	S	.	*	H	α-helix	trans	-68.7	-43.5	177.9	80.8	0	0	0	0	110.9	N66 F67 Y68 K73 V74	N66-S70 PolarHBondContact O-N 3.43Å; F67-S70 PolarHBondContact O-N 3.48Å; F67-S70 PolarHBondContact O-OG 3.32Å; Y68-S70 VanDerWaalsContact C-N 3.3Å; Y68-S70 PolarHBondContact O-N 2.85Å; S70-K73 PolarHBondContact O-N 3.26Å; S70-V74 WeakPolarHBondContact O-CB 3.28Å; S70-V74 WeakPolarHBondContact O-CG2 3.24Å; S70-V74 PolarHBondContact O-N 2.83Å
71	L	55	Low	52.5	Low	74 Å²	74	111.5 Å²	111.5	39%	0.387	57%	0.566	S	S	.	*	H	α-helix	trans	-68.7	-39.1	175.7	-75.7	170.8	0	0	0	112.2	F67 Y68 V74 R75	F67-L71 HydrophobicContact CD1-CD1 3.99Å; F67-L71 HydrophobicContact CD1-CG 4.24Å; F67-L71 WeakPolarHBondContact O-CB 3.47Å; F67-L71 VanDerWaalsContact O-CG 3.27Å; F67-L71 WeakPolarHBondContact O-CG 3.31Å; F67-L71 PolarHBondContact O-N 3Å; Y68-L71 PolarHBondContact O-N 3.35Å; L71-V74 PolarHBondContact O-N 3.12Å; L71-R75 WeakPolarHBondContact O-CB 3.48Å; L71-R75 WeakPolarHBondContact O-CG 3.43Å; L71-R75 PolarHBondContact O-N 3.49Å
72	Q	56.6	Low	53.4	Low	117 Å²	117	114.1 Å²	114.1	55%	0.547	57%	0.565	S	S	.	*	H	α-helix	trans	-67.4	-41.2	173.7	-76.4	-179.1	-26.2	0	0	110.9	Y68 L76	Y68-Q72 WeakPolarHBondContact O-CB 3.27Å; Y68-Q72 WeakPolarHBondContact O-CG 3.43Å; Y68-Q72 PolarHBondContact O-N 2.87Å; Q72-L76 WeakPolarHBondContact O-CB 2.9Å; Q72-L76 PolarHBondContact O-N 3.42Å
73	K	55.9	Low	54.1	Low	128 Å²	128	118.7 Å²	118.7	56%	0.557	57%	0.573	S	S	*	*	H	α-helix	trans	-65.2	-36.8	172.4	-80.7	173.4	178.3	168.2	0	112.3	D69 S70 R77	D69-K73 WeakPolarHBondContact O-CB 3.33Å; D69-K73 WeakPolarHBondContact O-CG 3.21Å; D69-K73 PolarHBondContact O-N 2.82Å; S70-K73 PolarHBondContact O-N 3.26Å; K73-R77 WeakPolarHBondContact O-CB 3.44Å; K73-R77 VanDerWaalsContact O-CG 3.29Å; K73-R77 WeakPolarHBondContact O-CG 3.5Å; K73-R77 PolarHBondContact O-N 2.8Å
74	V	55.6	Low	54.9	Low	85 Å²	85	117.3 Å²	117.3	52%	0.515	56%	0.557	S	S	.	*	H	α-helix	trans	-69	-46.7	177	169.5	0	0	0	0	110.3	S70 L71 Q78	S70-V74 WeakPolarHBondContact O-CB 3.28Å; S70-V74 WeakPolarHBondContact O-CG2 3.24Å; S70-V74 PolarHBondContact O-N 2.83Å; L71-V74 PolarHBondContact O-N 3.12Å; V74-Q78 WeakPolarHBondContact O-CB 3.44Å; V74-Q78 PolarHBondContact O-N 2.97Å
75	R	56.8	Low	55.5	Low	180 Å²	180	116 Å²	116	68%	0.679	55%	0.554	S	S	*	*	H	α-helix	trans	-66.1	-40.1	176.8	-70.6	-178.9	179.8	174.6	1.5	112.7	L71 Q78 Q79	L71-R75 WeakPolarHBondContact O-CB 3.48Å; L71-R75 WeakPolarHBondContact O-CG 3.43Å; L71-R75 PolarHBondContact O-N 3.49Å; R75-Q78 PolarHBondContact O-N 3.5Å; R75-Q79 WeakPolarHBondContact O-CB 3.48Å; R75-Q79 PolarHBondContact O-N 3.29Å
76	L	56.5	Low	55.7	Low	100 Å²	100	113.8 Å²	113.8	52%	0.524	54%	0.544	S	S	.	.	H	α-helix	trans	-70.7	-40.7	178.4	-175.3	64.6	0	0	0	111.8	Q72 Q79 L80	Q72-L76 WeakPolarHBondContact O-CB 2.9Å; Q72-L76 PolarHBondContact O-N 3.42Å; L76-Q79 PolarHBondContact O-N 3.47Å; L76-L80 HydrophobicContact CD1-CD1 4.39Å; L76-L80 HydrophobicContact CG-CD1 4.18Å; L76-L80 WeakPolarHBondContact O-CB 3.18Å; L76-L80 PolarHBondContact O-N 2.98Å
77	R	56.3	Low	55.6	Low	173 Å²	173	119.5 Å²	119.5	65%	0.653	56%	0.56	S	S	*	*	H	α-helix	trans	-66.1	-40.2	172.7	-80.8	-164.3	175.7	153.3	-0.9	111.8	K73 Q79 L80 E81	K73-R77 WeakPolarHBondContact O-CB 3.44Å; K73-R77 VanDerWaalsContact O-CG 3.29Å; K73-R77 WeakPolarHBondContact O-CG 3.5Å; K73-R77 PolarHBondContact O-N 2.8Å; R77-Q79 VanDerWaalsContact C-N 3.33Å; R77-Q79 PolarHBondContact O-N 3.06Å; R77-L80 PolarHBondContact O-N 3.33Å; R77-E81 VanDerWaalsContact O-CB 3.29Å; R77-E81 WeakPolarHBondContact O-CB 3.17Å; R77-E81 VanDerWaalsContact O-CG 3.31Å; R77-E81 WeakPolarHBondContact O-CG 3.48Å; R77-E81 PolarHBondContact O-N 3.07Å
78	Q	57.9	Low	55.8	Low	130 Å²	130	120.4 Å²	120.4	61%	0.607	56%	0.563	S	S	*	*	H	α-helix	trans	-67	-35.9	177.8	-158.8	169.9	13.4	0	0	111.7	V74 R75 M82	V74-Q78 WeakPolarHBondContact O-CB 3.44Å; V74-Q78 PolarHBondContact O-N 2.97Å; R75-Q78 PolarHBondContact O-N 3.5Å; Q78-M82 WeakPolarHBondContact O-CB 3.45Å; Q78-M82 PolarHBondContact O-N 3.3Å
79	Q	55.1	Low	56	Low	127 Å²	127	118 Å²	118	59%	0.593	56%	0.556	S	S	*	*	H	α-helix	trans	-67.7	-40.4	170.5	-82.9	-178.4	-20.7	0	0	112.9	R75 L76 R77 M82 Y83	R75-Q79 WeakPolarHBondContact O-CB 3.48Å; R75-Q79 PolarHBondContact O-N 3.29Å; L76-Q79 PolarHBondContact O-N 3.47Å; R77-Q79 VanDerWaalsContact C-N 3.33Å; R77-Q79 PolarHBondContact O-N 3.06Å; Q79-M82 PolarHBondContact O-N 3.41Å; Q79-Y83 WeakPolarHBondContact O-CB 3.38Å; Q79-Y83 WeakPolarHBondContact O-CD2 3.4Å; Q79-Y83 PolarHBondContact O-N 2.96Å
80	L	56.2	Low	55.9	Low	108 Å²	108	118.7 Å²	118.7	57%	0.565	56%	0.561	S	S	*	*	H	α-helix	trans	-70.1	-36.1	176	-97.2	148.8	0	0	0	112.9	L76 R77 Y83 S84	L76-L80 HydrophobicContact CD1-CD1 4.39Å; L76-L80 HydrophobicContact CG-CD1 4.18Å; L76-L80 WeakPolarHBondContact O-CB 3.18Å; L76-L80 PolarHBondContact O-N 2.98Å; R77-L80 PolarHBondContact O-N 3.33Å; L80-Y83 PolarHBondContact O-N 2.85Å; L80-S84 VanDerWaalsContact O-CB 3.28Å; L80-S84 WeakPolarHBondContact O-CB 3.31Å; L80-S84 PolarHBondContact O-N 3.23Å; L80-S84 PolarHBondContact O-OG 2.67Å
81	E	55.9	Low	55.7	Low	125 Å²	125	123.2 Å²	123.2	58%	0.584	58%	0.576	S	S	*	*	H	α-helix	trans	-66	-41.1	171.3	-76.6	178.4	-172.3	0	0	110.1	R77 S84 L85	R77-E81 VanDerWaalsContact O-CB 3.29Å; R77-E81 WeakPolarHBondContact O-CB 3.17Å; R77-E81 VanDerWaalsContact O-CG 3.31Å; R77-E81 WeakPolarHBondContact O-CG 3.48Å; R77-E81 PolarHBondContact O-N 3.07Å; E81-S84 WeakPolarHBondContact CA-OG 3.47Å; E81-S84 PolarHBondContact O-N 2.82Å; E81-S84 PolarHBondContact O-OG 3.34Å; E81-L85 WeakPolarHBondContact O-CA 3.27Å; E81-L85 WeakPolarHBondContact O-CB 3.47Å; E81-L85 PolarHBondContact O-N 3.42Å
82	M	57.4	Low	55.6	Low	145 Å²	145	125.9 Å²	125.9	71%	0.714	59%	0.587	S	S	*	*	H	α-helix	trans	-67.7	-39.5	174.7	-153.1	-163.7	-169.6	0	0	112.3	Q78 Q79 A86	Q78-M82 WeakPolarHBondContact O-CB 3.45Å; Q78-M82 PolarHBondContact O-N 3.3Å; Q79-M82 PolarHBondContact O-N 3.41Å; M82-A86 WeakPolarHBondContact O-CB 3.46Å; M82-A86 PolarHBondContact O-N 3.4Å
83	Y	55.1	Low	55.4	Low	189 Å²	189	126 Å²	126	74%	0.741	59%	0.587	S	S	*	*	H	α-helix	trans	-67.9	-39.1	175.6	-100.5	-85.9	0	0	0	112.7	Q79 L80 R87	Q79-Y83 WeakPolarHBondContact O-CB 3.38Å; Q79-Y83 WeakPolarHBondContact O-CD2 3.4Å; Q79-Y83 PolarHBondContact O-N 2.96Å; L80-Y83 PolarHBondContact O-N 2.85Å; Y83-R87 WeakPolarHBondContact O-CB 3.3Å; Y83-R87 PolarHBondContact O-N 3.3Å
84	S	57.8	Low	55	Low	63 Å²	63	125.6 Å²	125.6	44%	0.441	59%	0.587	S	S	.	*	H	α-helix	trans	-74.9	-35.7	176.9	60.8	0	0	0	0	112.4	L80 E81 R87 K88	L80-S84 VanDerWaalsContact O-CB 3.28Å; L80-S84 WeakPolarHBondContact O-CB 3.31Å; L80-S84 PolarHBondContact O-N 3.23Å; L80-S84 PolarHBondContact O-OG 2.67Å; E81-S84 WeakPolarHBondContact CA-OG 3.47Å; E81-S84 PolarHBondContact O-N 2.82Å; E81-S84 PolarHBondContact O-OG 3.34Å; S84-R87 PolarHBondContact O-N 2.85Å; S84-K88 WeakPolarHBondContact O-CB 3.23Å; S84-K88 WeakPolarHBondContact O-CG 3.42Å; S84-K88 PolarHBondContact O-N 2.97Å
85	L	54.8	Low	54.5	Low	94 Å²	94	128 Å²	128	49%	0.492	59%	0.593	S	S	.	*	H	α-helix	trans	-67.7	-43.4	172.8	-168.6	64.9	0	0	0	110.5	E81 R87 K88 F89	E81-L85 WeakPolarHBondContact O-CA 3.27Å; E81-L85 WeakPolarHBondContact O-CB 3.47Å; E81-L85 PolarHBondContact O-N 3.42Å; L85-R87 VanDerWaalsContact C-N 3.31Å; L85-R87 PolarHBondContact O-N 3.21Å; L85-K88 PolarHBondContact O-N 2.83Å; L85-K88 VanDerWaalsContact O-N 3.16Å; L85-F89 HydrophobicContact CD1-CD2 4.06Å; L85-F89 HydrophobicContact CD1-CE2 3.72Å; L85-F89 HydrophobicContact CD2-CE2 4.13Å; L85-F89 HydrophobicContact CG-CD2 3.78Å; L85-F89 HydrophobicContact CG-CE2 3.65Å; L85-F89 VanDerWaalsContact O-CD2 3.27Å; L85-F89 WeakPolarHBondContact O-CD2 3.31Å; L85-F89 PolarHBondContact O-N 3.49Å
86	A	56.1	Low	54	Low	55 Å²	55	121.6 Å²	121.6	46%	0.455	58%	0.582	S	S	.	*	H	α-helix	trans	-59.2	-41.3	173.3	0	0	0	0	0	111.7	M82 F89 D90	M82-A86 WeakPolarHBondContact O-CB 3.46Å; M82-A86 PolarHBondContact O-N 3.4Å; A86-F89 PolarHBondContact O-N 2.98Å; A86-D90 WeakPolarHBondContact O-CB 3.46Å; A86-D90 PolarHBondContact O-N 2.82Å
87	R	54	Low	53.4	Low	204 Å²	204	122.1 Å²	122.1	77%	0.77	58%	0.582	S	S	*	*	H	α-helix	trans	-68.5	-34.6	175.9	-139	-173.1	-157.5	165.3	5.7	113	Y83 S84 L85 Q91	Y83-R87 WeakPolarHBondContact O-CB 3.3Å; Y83-R87 PolarHBondContact O-N 3.3Å; S84-R87 PolarHBondContact O-N 2.85Å; L85-R87 VanDerWaalsContact C-N 3.31Å; L85-R87 PolarHBondContact O-N 3.21Å; R87-Q91 WeakPolarHBondContact O-CB 3.07Å; R87-Q91 PolarHBondContact O-N 3.21Å
88	K	54.9	Low	52.8	Low	134 Å²	134	116.8 Å²	116.8	58%	0.583	57%	0.571	S	S	*	*	H	α-helix	trans	-70.3	-38.4	173.8	-77.4	-175.6	175.7	-167.3	0	112.1	S84 L85 Q91 Q92	S84-K88 WeakPolarHBondContact O-CB 3.23Å; S84-K88 WeakPolarHBondContact O-CG 3.42Å; S84-K88 PolarHBondContact O-N 2.97Å; L85-K88 PolarHBondContact O-N 2.83Å; L85-K88 VanDerWaalsContact O-N 3.16Å; K88-Q91 PolarHBondContact O-N 3.45Å; K88-Q92 PolarHBondContact O-N 2.86Å
89	F	54.8	Low	52.2	Low	124 Å²	124	117.8 Å²	117.8	54%	0.544	58%	0.576	S	S	.	*	H	α-helix	trans	-65.9	-40.1	172.2	-87.7	-74.1	0	0	0	111.6	L85 A86 Q91 Q92 Q93	L85-F89 HydrophobicContact CD1-CD2 4.06Å; L85-F89 HydrophobicContact CD1-CE2 3.72Å; L85-F89 HydrophobicContact CD2-CE2 4.13Å; L85-F89 HydrophobicContact CG-CD2 3.78Å; L85-F89 HydrophobicContact CG-CE2 3.65Å; L85-F89 VanDerWaalsContact O-CD2 3.27Å; L85-F89 WeakPolarHBondContact O-CD2 3.31Å; L85-F89 PolarHBondContact O-N 3.49Å; A86-F89 PolarHBondContact O-N 2.98Å; F89-Q91 VanDerWaalsContact C-N 3.32Å; F89-Q91 PolarHBondContact O-N 2.92Å; F89-Q92 PolarHBondContact O-N 3.45Å; F89-Q93 VanDerWaalsContact O-CB 3.27Å; F89-Q93 WeakPolarHBondContact O-CB 3.46Å; F89-Q93 PolarHBondContact O-N 3.36Å
90	D	54	Low	51.7	Low	88 Å²	88	115.2 Å²	115.2	47%	0.471	57%	0.572	S	S	.	*	H	α-helix	trans	-64.8	-37.4	174.5	-159.4	53.9	0	0	0	111.4	A86 Q93 H94	A86-D90 WeakPolarHBondContact O-CB 3.46Å; A86-D90 PolarHBondContact O-N 2.82Å; D90-Q93 PolarHBondContact O-N 3.06Å; D90-H94 PolarHBondContact O-N 3.33Å; D90-H94 VanDerWaalsContact O-N 3.12Å; D90-H94 PolarHBondContact O-ND1 3.49Å; D90-H94 IonicContact OD1-CE1 3.81Å; D90-H94 IonicContact OD2-CE1 3.72Å; D90-H94 IonicContact OD2-ND1 3.97Å
91	Q	53.1	Low	51.2	Low	144 Å²	144	114.9 Å²	114.9	67%	0.673	57%	0.574	S	S	*	*	H	α-helix	trans	-70.1	-37.7	174.9	-158.2	173.9	33.5	0	0	112.8	R87 K88 F89 Q95	R87-Q91 WeakPolarHBondContact O-CB 3.07Å; R87-Q91 PolarHBondContact O-N 3.21Å; K88-Q91 PolarHBondContact O-N 3.45Å; F89-Q91 VanDerWaalsContact C-N 3.32Å; F89-Q91 PolarHBondContact O-N 2.92Å; Q91-Q95 PolarHBondContact O-N 3.5Å
92	Q	52.5	Low	50.5	Low	131 Å²	131	116.4 Å²	116.4	61%	0.612	58%	0.581	S	S	*	*	H	α-helix	trans	-71	-32.5	172.4	-86.2	-176.9	-86.2	0	0	112.7	K88 F89 Q95 G96	K88-Q92 PolarHBondContact O-N 2.86Å; F89-Q92 PolarHBondContact O-N 3.45Å; Q92-Q95 PolarHBondContact O-N 2.67Å; Q92-G96 PolarHBondContact O-N 3.18Å
93	Q	51.9	Low	49.7	Very low	120 Å²	120	116.7 Å²	116.7	56%	0.561	59%	0.585	S	S	*	*	H	α-helix	trans	-69.8	-34.2	177.6	-162	176.2	-24.8	0	0	111.5	F89 D90 Q97	F89-Q93 VanDerWaalsContact O-CB 3.27Å; F89-Q93 WeakPolarHBondContact O-CB 3.46Å; F89-Q93 PolarHBondContact O-N 3.36Å; D90-Q93 PolarHBondContact O-N 3.06Å; Q93-Q97 PolarHBondContact O-N 2.96Å; Q93-Q97 VanDerWaalsContact O-N 3.07Å
94	H	47.5	Very low	49.1	Very low	118 Å²	118	112.4 Å²	112.4	55%	0.546	58%	0.582	S	S	.	*	H	α-helix	trans	-71.3	-28.8	172.2	-74.5	98.3	0	0	0	113.6	D90 S98	D90-H94 PolarHBondContact O-N 3.33Å; D90-H94 VanDerWaalsContact O-N 3.12Å; D90-H94 PolarHBondContact O-ND1 3.49Å; D90-H94 IonicContact OD1-CE1 3.81Å; D90-H94 IonicContact OD2-CE1 3.72Å; D90-H94 IonicContact OD2-ND1 3.97Å; H94-S98 PolarHBondContact O-N 3.05Å; H94-S98 PolarHBondContact O-OG 3.35Å
95	Q	46.8	Very low	48.5	Very low	137 Å²	137	117.9 Å²	117.9	64%	0.64	60%	0.603	S	S	*	*	H	α-helix	trans	-80.2	-32	175.7	-153.4	167.1	18.5	0	0	112.4	Q91 Q92 S98	Q91-Q95 PolarHBondContact O-N 3.5Å; Q92-Q95 PolarHBondContact O-N 2.67Å; Q95-S98 WeakPolarHBondContact CA-OG 3.43Å; Q95-S98 PolarHBondContact O-OG 3.33Å
96	G	45.6	Very low	47.8	Very low	44 Å²	44	125.3 Å²	125.3	45%	0.454	64%	0.635	S	S	.	*	H	α-helix	trans	-74.9	-31.8	173.6	0	0	0	0	0	114.5	Q92 S100	Q92-G96 PolarHBondContact O-N 3.18Å; G96-S100 WeakPolarHBondContact O-CB 3.41Å; G96-S100 PolarHBondContact O-N 3.12Å; G96-S100 PolarHBondContact O-OG 2.77Å
97	Q	44.4	Very low	47.4	Very low	112 Å²	112	128.9 Å²	128.9	52%	0.523	65%	0.645	S	S	.	*	H	α-helix	trans	-78.2	-25.7	175	-84.1	-168.1	-3.1	0	0	113.9	Q93 S100 V101	Q93-Q97 PolarHBondContact O-N 2.96Å; Q93-Q97 VanDerWaalsContact O-N 3.07Å; Q97-S100 PolarHBondContact O-OG 3.41Å; Q97-V101 VanDerWaalsContact O-CG2 3.25Å; Q97-V101 WeakPolarHBondContact O-CG2 3.28Å; Q97-V101 PolarHBondContact O-N 3.45Å
98	S	43	Very low	47.1	Very low	61 Å²	61	124.9 Å²	124.9	43%	0.427	64%	0.638	S	S	.	*	H	α-helix	trans	-74.4	-26.9	177.2	37.2	0	0	0	0	112.8	H94 Q95	H94-S98 PolarHBondContact O-N 3.05Å; H94-S98 PolarHBondContact O-OG 3.35Å; Q95-S98 WeakPolarHBondContact CA-OG 3.43Å; Q95-S98 PolarHBondContact O-OG 3.33Å
99	E	44.5	Very low	46.6	Very low	151 Å²	151	124.4 Å²	124.4	71%	0.706	64%	0.641	S	S	*	*	H	α-helix	trans	-84.3	-31.8	171.3	-67.9	-166.3	159.6	0	0	113
100	S	45.7	Very low	46.1	Very low	72 Å²	72	124.4 Å²	124.4	50%	0.503	65%	0.647	S	S	.	*	H	α-helix	trans	-77.6	-23.2	-179.4	73.9	0	0	0	0	114.4	G96 Q97	G96-S100 WeakPolarHBondContact O-CB 3.41Å; G96-S100 PolarHBondContact O-N 3.12Å; G96-S100 PolarHBondContact O-OG 2.77Å; Q97-S100 PolarHBondContact O-OG 3.41Å
101	V	45.2	Very low	45.7	Very low	101 Å²	101	126.7 Å²	126.7	61%	0.612	66%	0.658	S	S	*	*	H	α-helix	trans	-82.9	-24.4	178.5	175.2	0	0	0	0	112.1	Q97	Q97-V101 VanDerWaalsContact O-CG2 3.25Å; Q97-V101 WeakPolarHBondContact O-CG2 3.28Å; Q97-V101 PolarHBondContact O-N 3.45Å
102	Q	41.7	Very low	45.2	Very low	157 Å²	157	125.5 Å²	125.5	73%	0.734	66%	0.657	S	S	*	*	H	α-helix	trans	-79	-23.7	176.2	-76.4	-174.3	57.5	0	0	113.6	S104	Q102-S104 VanDerWaalsContact C-N 3.32Å; Q102-S104 PolarHBondContact O-N 3.18Å
103	L	41.4	Very low	44.6	Very low	151 Å²	151	125.1 Å²	125.1	79%	0.791	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	2.7	179.6	-120.9	99.1	0	0	0	114.9
104	S	41.1	Very low	44.1	Very low	99 Å²	99	125.5 Å²	125.5	69%	0.692	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.3	8.4	-178.2	-169.3	0	0	0	0	113.8	Q102	Q102-S104 VanDerWaalsContact C-N 3.32Å; Q102-S104 PolarHBondContact O-N 3.18Å
105	M	46.6	Very low	43.8	Very low	178 Å²	178	126.2 Å²	126.2	88%	0.877	68%	0.678	S	S	*	*			trans	-120.3	38.9	175.8	-75	-151.3	176.5	0	0	113.1
106	E	39.6	Very low	43.5	Very low	251 Å²	251	125.2 Å²	125.2	100%	1.173	68%	0.681	S	S	*	*			trans	-122.7	0	162.3	-75.6	-175.8	97.8	0	0	110.7

Retrieved 106 of 106 residues in 42.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).