A0A060YMI4_ONCMY Loading...

BBSome interacting protein 1

AlphaFold DB , UniProt , Accession A0A060YMI4, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110485629, Length 69 aa.

						>A0A060YMI4_ONCMY|A0A060YMI4|LOC110485629
MPEVKSMFREVLPKQGQLSMEDVPTMVLCKPKLMPLKSVTLEKLEKMQLEAQEAIKQQDLALKEQQETQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.8	Very low	68.9	Low	229 Å²	229	168.5 Å²	168.5	100%	1.128	84%	0.839	S	S	*	*				0	127.1	0	-73.7	178.1	166.3	0	0	107	E3	M1-E3 PolarHBondContact O-N 2.79Å
2	P	49	Very low	70.8	Confident	122 Å²	122	165.5 Å²	165.5	79%	0.792	83%	0.827	S	S	*	*			trans	-73.4	123.3	-177.4	30.3	-30.1	0	0	0	108.9	V4	P2-V4 PolarHBondContact O-N 3.33Å
3	E	58.7	Low	72.6	Confident	190 Å²	190	161.6 Å²	161.6	89%	0.888	82%	0.821	S	S	*	*			trans	-73.3	95.7	178.3	-57.6	-168.4	162.7	0	0	109.2	M1 K5	M1-E3 PolarHBondContact O-N 2.79Å; E3-K5 PolarHBondContact O-N 3.38Å
4	V	61.6	Low	74.1	Confident	133 Å²	133	165.2 Å²	165.2	81%	0.806	83%	0.828	S	S	*	*			trans	-65.5	106.9	164.7	-176.7	0	0	0	0	106.3	P2 S6	P2-V4 PolarHBondContact O-N 3.33Å; V4-S6 VanDerWaalsContact C-N 3.29Å; V4-S6 PolarHBondContact O-N 3.02Å
5	K	63.6	Low	75.4	Confident	203 Å²	203	166.1 Å²	166.1	88%	0.883	83%	0.828	S	S	*	*			trans	-67.4	85.6	-178.9	-160.5	172.5	-172.2	178.5	0	109.3	E3	E3-K5 PolarHBondContact O-N 3.38Å
6	S	65.5	Low	76.5	Confident	87 Å²	87	159.8 Å²	159.8	61%	0.608	82%	0.819	S	S	*	*			trans	-64.1	131.8	170.6	61.2	0	0	0	0	108.8	V4 F8	V4-S6 VanDerWaalsContact C-N 3.29Å; V4-S6 PolarHBondContact O-N 3.02Å; S6-F8 PolarHBondContact O-N 3.05Å; S6-F8 VanDerWaalsContact O-N 3.1Å; S6-F8 PolarHBondContact OG-O 3.47Å
7	M	72.1	Confident	77.6	Confident	200 Å²	200	161.9 Å²	161.9	99%	0.985	83%	0.825	S	S	*	*	S	Bend	trans	-63.4	-16.1	-179.5	-61.7	175.7	-156	0	0	112.8
8	F	76.1	Confident	78.6	Confident	183 Å²	183	161.1 Å²	161.1	80%	0.803	82%	0.822	S	S	*	*	S	Bend	trans	-108.1	130.6	172.5	-107	-99.3	0	0	0	110.6	S6	S6-F8 PolarHBondContact O-N 3.05Å; S6-F8 VanDerWaalsContact O-N 3.1Å; S6-F8 PolarHBondContact OG-O 3.47Å
9	R	85	Confident	79.3	Confident	215 Å²	215	158.9 Å²	158.9	81%	0.811	82%	0.822	S	S	*	*			trans	-95.2	114.6	169.4	-176.2	179.6	-179.4	-145.1	1.9	108.1	V11	R9-V11 PolarHBondContact O-N 3.16Å
10	E	87.3	Confident	80.1	Confident	173 Å²	173	160 Å²	160	81%	0.808	83%	0.826	S	S	*	*			trans	-61.4	119.9	171.6	-67.2	178.4	-175.6	0	0	109
11	V	90.9	Very high	80.9	Confident	119 Å²	119	160 Å²	160	72%	0.721	82%	0.822	S	S	*	*			trans	-104.7	111.7	175.4	-178.4	0	0	0	0	107.5	R9	R9-V11 PolarHBondContact O-N 3.16Å
12	L	91.8	Very high	83	Confident	132 Å²	132	156.9 Å²	156.9	69%	0.691	81%	0.81	S	S	*	*			trans	-89	152.4	175.1	-59.5	179.1	0	0	0	110.8	K14	L12-K14 PolarHBondContact O-N 3.37Å
13	P	95	Very high	85.2	Confident	115 Å²	115	155.5 Å²	155.5	75%	0.747	80%	0.799	S	S	*	*			trans	-53.5	129.7	168.7	-23.8	33.7	0	0	0	110.6	Q15	P13-Q15 VanDerWaalsContact C-N 3.27Å
14	K	92.6	Very high	86.9	Confident	212 Å²	212	152.5 Å²	152.5	92%	0.922	80%	0.796	S	S	*	*	S	Bend	trans	-77.9	-16.8	178.3	-62.4	-175.6	179.2	179.2	0	112.9	L12	L12-K14 PolarHBondContact O-N 3.37Å
15	Q	93.5	Very high	88.4	Confident	178 Å²	178	151.6 Å²	151.6	83%	0.832	79%	0.791	S	S	*	*	S	Bend	trans	-105.5	132.9	-177.9	-66.2	177.7	-17.7	0	0	109.3	P13	P13-Q15 VanDerWaalsContact C-N 3.27Å
16	G	94.2	Very high	90	Very high	66 Å²	66	150.5 Å²	150.5	68%	0.68	79%	0.791	S	S	*	*			trans	-91.5	171.7	177.9	0	0	0	0	0	112.9
17	Q	94.7	Very high	91.4	Very high	195 Å²	195	152.6 Å²	152.6	91%	0.911	80%	0.8	S	S	*	*			trans	-70.4	134.7	173.2	-177.3	172.4	-11.7	0	0	110.6
18	L	94.7	Very high	92.6	Very high	148 Å²	148	150 Å²	150	78%	0.775	79%	0.789	S	S	*	*			trans	-109.6	131.3	179.1	-58.3	178.6	0	0	0	110.2
19	S	93.6	Very high	93.6	Very high	119 Å²	119	147.5 Å²	147.5	83%	0.832	79%	0.793	S	S	*	*			trans	-83	113.3	168	-46.5	0	0	0	0	108.3
20	M	95.2	Very high	94.1	Very high	180 Å²	180	145.7 Å²	145.7	89%	0.887	79%	0.791	S	S	*	*			trans	-84.7	-24	-178.4	-59.5	-146.2	74.8	0	0	113.1
21	E	95.7	Very high	94.6	Very high	162 Å²	162	143.8 Å²	143.8	76%	0.757	79%	0.793	S	S	*	*	S	Bend	trans	-142.4	153.2	-175.5	-61.5	-179.9	-178	0	0	109.6
22	D	93	Very high	94.9	Very high	162 Å²	162	146.7 Å²	146.7	87%	0.866	80%	0.796	S	S	*	*			trans	-91.9	111.6	174.2	-169.9	7.1	0	0	0	109.6
23	V	94.3	Very high	95.2	Very high	94 Å²	94	148.2 Å²	148.2	57%	0.57	80%	0.804	S	S	*	*			trans	-101.3	123.8	179.9	-179	0	0	0	0	108.2	T25	V23-T25 PolarHBondContact O-N 3.34Å; V23-T25 VanDerWaalsContact O-N 3.16Å
24	P	94	Very high	95.2	Very high	126 Å²	126	149.7 Å²	149.7	82%	0.818	80%	0.803	S	S	*	*			trans	-62.6	122	179.6	25.7	-33.4	0	0	0	110.1
25	T	94.8	Very high	95.4	Very high	114 Å²	114	144.6 Å²	144.6	70%	0.699	79%	0.792	S	S	*	*			trans	-118.7	154.2	179.5	50.3	0	0	0	0	110.9	V23 V27	V23-T25 PolarHBondContact O-N 3.34Å; V23-T25 VanDerWaalsContact O-N 3.16Å; T25-V27 PolarHBondContact O-N 2.97Å
26	M	95.9	Very high	95.5	Very high	181 Å²	181	144.3 Å²	144.3	89%	0.892	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-67	122.3	175.6	-62.6	-63.1	-76.9	0	0	109.7
27	V	95.6	Very high	95.6	Very high	130 Å²	130	147.2 Å²	147.2	79%	0.788	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-87.5	122.8	-179.1	-177.1	0	0	0	0	110	T25	T25-V27 PolarHBondContact O-N 2.97Å
28	L	97.1	Very high	95.8	Very high	146 Å²	146	140.3 Å²	140.3	76%	0.764	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-84.9	149.8	171.2	-59.6	178.7	0	0	0	111	K30	L28-K30 PolarHBondContact O-N 3.1Å
29	C	96.7	Very high	95.9	Very high	130 Å²	130	139 Å²	139	88%	0.878	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-55.5	137.7	169.6	-66.8	0	0	0	0	110.2
30	K	96.7	Very high	96.2	Very high	178 Å²	178	138 Å²	138	77%	0.774	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-68.3	148.5	170.8	-59.9	-57.1	-176.7	-174	0	109.7	L28 K32	L28-K30 PolarHBondContact O-N 3.1Å; K30-K32 PolarHBondContact O-N 3.38Å
31	P	97.6	Very high	96.3	Very high	132 Å²	132	133.7 Å²	133.7	86%	0.857	73%	0.729	S	S	*	*	P	Polyproline II helix	trans	-58.6	134.3	176.4	24.7	-33.9	0	0	0	110.5
32	K	96.4	Very high	96.4	Very high	180 Å²	180	131.9 Å²	131.9	78%	0.783	72%	0.72	S	S	*	*	P	Polyproline II helix	trans	-96.2	125.6	-178.9	-172.7	175.6	-178.3	177.6	0	110.5	K30	K30-K32 PolarHBondContact O-N 3.38Å
33	L	97.1	Very high	96.6	Very high	164 Å²	164	131.7 Å²	131.7	86%	0.859	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-78.1	124.3	168.7	-172	64.1	0	0	0	109.3
34	M	96.3	Very high	96.8	Very high	146 Å²	146	131.5 Å²	131.5	72%	0.719	71%	0.707	S	S	*	*	P	Polyproline II helix	trans	-70.7	133.5	176.6	-67.9	-63.5	-74.4	0	0	109.8
35	P	95.6	Very high	97	Very high	105 Å²	105	129 Å²	129	68%	0.682	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-68.4	149.4	178.5	29.5	-34.4	0	0	0	110.7
36	L	96.4	Very high	97.2	Very high	172 Å²	172	129.6 Å²	129.6	90%	0.901	68%	0.678	S	S	*	*	P	Polyproline II helix	trans	-73.9	137.6	172.5	-59.9	177.7	0	0	0	109.6
37	K	96.8	Very high	97.2	Very high	128 Å²	128	126.5 Å²	126.5	56%	0.557	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-70.5	142.7	173.7	-62.5	-173.9	-176.9	-170.3	0	109.5	E45	K37-E45 WeakPolarHBondContact CD-OE2 3.47Å; K37-E45 IonicContact NZ-OE1 2.94Å; K37-E45 PolarHBondContact NZ-OE1 2.93Å; K37-E45 IonicContact NZ-OE2 2.62Å; K37-E45 PolarHBondContact NZ-OE2 3.09Å
38	S	97.9	Very high	97.3	Very high	50 Å²	50	126.5 Å²	126.5	35%	0.35	65%	0.654	S	S	.	*	P	Polyproline II helix	trans	-74.8	155.7	170.1	64.8	0	0	0	0	110.3	T40 L41 E42	S38-T40 PolarHBondContact O-N 2.94Å; S38-T40 VanDerWaalsContact O-N 3.15Å; S38-T40 PolarHBondContact OG-OG1 3.43Å; S38-L41 PolarHBondContact O-N 3.16Å; S38-L41 WeakPolarHBondContact OG-CB 3.43Å; S38-L41 WeakPolarHBondContact OG-CG 3.33Å; S38-L41 PolarHBondContact OG-N 3.36Å; S38-E42 PolarHBondContact O-N 3.02Å
39	V	98.1	Very high	97.4	Very high	120 Å²	120	124.9 Å²	124.9	73%	0.727	65%	0.645	S	S	*	*	H	α-helix	trans	-53.9	-35.8	174.3	176.3	0	0	0	0	111.6	K43	V39-K43 WeakPolarHBondContact O-CB 3.21Å; V39-K43 PolarHBondContact O-N 3.37Å
40	T	98.3	Very high	97.4	Very high	97 Å²	97	123.6 Å²	123.6	60%	0.595	63%	0.626	S	S	*	*	H	α-helix	trans	-67.7	-43.9	176.7	48.6	0	0	0	0	112.4	S38 K43 L44	S38-T40 PolarHBondContact O-N 2.94Å; S38-T40 VanDerWaalsContact O-N 3.15Å; S38-T40 PolarHBondContact OG-OG1 3.43Å; T40-K43 PolarHBondContact O-N 2.98Å; T40-L44 VanDerWaalsContact O-CG 3.31Å; T40-L44 WeakPolarHBondContact O-CG 3.48Å; T40-L44 PolarHBondContact O-N 3Å
41	L	98.1	Very high	97.5	Very high	91 Å²	91	117.6 Å²	117.6	48%	0.476	61%	0.61	S	S	.	*	H	α-helix	trans	-65.7	-43.4	178	-75.4	174.7	0	0	0	111.1	S38 K43 L44 E45	S38-L41 PolarHBondContact O-N 3.16Å; S38-L41 WeakPolarHBondContact OG-CB 3.43Å; S38-L41 WeakPolarHBondContact OG-CG 3.33Å; S38-L41 PolarHBondContact OG-N 3.36Å; L41-K43 VanDerWaalsContact C-N 3.34Å; L41-K43 PolarHBondContact O-N 3.22Å; L41-L44 PolarHBondContact O-N 3.14Å; L41-E45 WeakPolarHBondContact O-CB 3.39Å; L41-E45 VanDerWaalsContact O-CG 3.31Å; L41-E45 WeakPolarHBondContact O-CG 3.5Å; L41-E45 PolarHBondContact O-N 3.38Å
42	E	97.5	Very high	97.4	Very high	123 Å²	123	116.4 Å²	116.4	58%	0.575	59%	0.593	S	S	*	*	H	α-helix	trans	-60.4	-43.8	176.8	-173.7	178.4	179.8	0	0	111.9	S38 E45 K46	S38-E42 PolarHBondContact O-N 3.02Å; E42-E45 PolarHBondContact O-N 3.41Å; E42-K46 WeakPolarHBondContact O-CB 3.43Å; E42-K46 PolarHBondContact O-N 2.9Å
43	K	98.3	Very high	97.4	Very high	158 Å²	158	113.1 Å²	113.1	69%	0.687	58%	0.58	S	S	*	*	H	α-helix	trans	-64.5	-41.1	177.2	-173.8	174.4	-178.7	179.9	0	112.4	V39 T40 L41 K46 M47	V39-K43 WeakPolarHBondContact O-CB 3.21Å; V39-K43 PolarHBondContact O-N 3.37Å; T40-K43 PolarHBondContact O-N 2.98Å; L41-K43 VanDerWaalsContact C-N 3.34Å; L41-K43 PolarHBondContact O-N 3.22Å; K43-K46 PolarHBondContact O-N 3.36Å; K43-M47 WeakPolarHBondContact O-CB 3.36Å; K43-M47 PolarHBondContact O-N 3.13Å
44	L	98.3	Very high	97.4	Very high	91 Å²	91	107.3 Å²	107.3	48%	0.476	56%	0.556	S	S	.	*	H	α-helix	trans	-66.6	-44.4	178.3	-73.3	174.2	0	0	0	111.7	T40 L41 K46 M47 Q48	T40-L44 VanDerWaalsContact O-CG 3.31Å; T40-L44 WeakPolarHBondContact O-CG 3.48Å; T40-L44 PolarHBondContact O-N 3Å; L41-L44 PolarHBondContact O-N 3.14Å; L44-K46 VanDerWaalsContact C-N 3.34Å; L44-K46 PolarHBondContact O-N 2.92Å; L44-M47 HydrophobicContact CD2-CE 4.28Å; L44-M47 PolarHBondContact O-N 3.18Å; L44-Q48 VanDerWaalsContact O-CG 3.31Å; L44-Q48 WeakPolarHBondContact O-CG 3.46Å; L44-Q48 PolarHBondContact O-N 3.23Å
45	E	97.5	Very high	97.4	Very high	72 Å²	72	104.9 Å²	104.9	34%	0.336	55%	0.545	S	S	.	.	H	α-helix	trans	-59.9	-44.7	175.3	-72.9	176.7	170.2	0	0	111.2	K37 L41 E42 Q48 L49	K37-E45 WeakPolarHBondContact CD-OE2 3.47Å; K37-E45 IonicContact NZ-OE1 2.94Å; K37-E45 PolarHBondContact NZ-OE1 2.93Å; K37-E45 IonicContact NZ-OE2 2.62Å; K37-E45 PolarHBondContact NZ-OE2 3.09Å; L41-E45 WeakPolarHBondContact O-CB 3.39Å; L41-E45 VanDerWaalsContact O-CG 3.31Å; L41-E45 WeakPolarHBondContact O-CG 3.5Å; L41-E45 PolarHBondContact O-N 3.38Å; E42-E45 PolarHBondContact O-N 3.41Å; E45-Q48 PolarHBondContact O-N 3.47Å; E45-L49 WeakPolarHBondContact O-CG 3.24Å; E45-L49 PolarHBondContact O-N 3.04Å
46	K	98.1	Very high	97.4	Very high	128 Å²	128	105.3 Å²	105.3	56%	0.557	54%	0.536	S	S	*	.	H	α-helix	trans	-61.1	-46.4	176.7	-176.9	176.5	171	175.2	0	112.2	E42 K43 L44 Q48 L49 E50	E42-K46 WeakPolarHBondContact O-CB 3.43Å; E42-K46 PolarHBondContact O-N 2.9Å; K43-K46 PolarHBondContact O-N 3.36Å; L44-K46 VanDerWaalsContact C-N 3.34Å; L44-K46 PolarHBondContact O-N 2.92Å; K46-Q48 VanDerWaalsContact C-N 3.28Å; K46-Q48 PolarHBondContact O-N 3.3Å; K46-L49 PolarHBondContact O-N 2.93Å; K46-E50 WeakPolarHBondContact CE-OE1 3.3Å; K46-E50 HydrophobicContact CG-CG 4.48Å; K46-E50 IonicContact NZ-OE1 3.85Å; K46-E50 WeakPolarHBondContact O-CG 3.47Å; K46-E50 PolarHBondContact O-N 3.48Å
47	M	97.8	Very high	97.2	Very high	115 Å²	115	102.8 Å²	102.8	57%	0.567	52%	0.52	S	S	*	.	H	α-helix	trans	-61.9	-37.4	178.3	-171.2	-178.5	76.7	0	0	111.9	K43 L44 A51	K43-M47 WeakPolarHBondContact O-CB 3.36Å; K43-M47 PolarHBondContact O-N 3.13Å; L44-M47 HydrophobicContact CD2-CE 4.28Å; L44-M47 PolarHBondContact O-N 3.18Å; M47-A51 WeakPolarHBondContact O-CB 3.46Å; M47-A51 PolarHBondContact O-N 3.19Å
48	Q	97.6	Very high	97	Very high	131 Å²	131	102.9 Å²	102.9	61%	0.612	52%	0.522	S	S	*	.	H	α-helix	trans	-65.9	-42.4	175.3	-73.6	174.4	-9.8	0	0	112	L44 E45 K46 Q52	L44-Q48 VanDerWaalsContact O-CG 3.31Å; L44-Q48 WeakPolarHBondContact O-CG 3.46Å; L44-Q48 PolarHBondContact O-N 3.23Å; E45-Q48 PolarHBondContact O-N 3.47Å; K46-Q48 VanDerWaalsContact C-N 3.28Å; K46-Q48 PolarHBondContact O-N 3.3Å; Q48-Q52 WeakPolarHBondContact O-CB 3.34Å; Q48-Q52 PolarHBondContact O-N 3.06Å
49	L	97.9	Very high	96.6	Very high	112 Å²	112	104.5 Å²	104.5	59%	0.586	53%	0.527	S	S	*	.	H	α-helix	trans	-63.1	-47.7	177.1	-71.9	168.9	0	0	0	111.5	E45 K46 A51 Q52 E53	E45-L49 WeakPolarHBondContact O-CG 3.24Å; E45-L49 PolarHBondContact O-N 3.04Å; K46-L49 PolarHBondContact O-N 2.93Å; L49-A51 PolarHBondContact O-N 3.45Å; L49-Q52 PolarHBondContact O-N 2.98Å; L49-E53 WeakPolarHBondContact O-CB 3.35Å; L49-E53 PolarHBondContact O-N 3.38Å
50	E	97.6	Very high	96.3	Very high	103 Å²	103	103.7 Å²	103.7	48%	0.481	52%	0.518	S	S	.	.	H	α-helix	trans	-61.5	-43.3	178.7	-72.2	173.7	177.8	0	0	111.9	K46 Q52 E53 A54	K46-E50 WeakPolarHBondContact CE-OE1 3.3Å; K46-E50 HydrophobicContact CG-CG 4.48Å; K46-E50 IonicContact NZ-OE1 3.85Å; K46-E50 WeakPolarHBondContact O-CG 3.47Å; K46-E50 PolarHBondContact O-N 3.48Å; E50-Q52 VanDerWaalsContact C-N 3.33Å; E50-Q52 PolarHBondContact O-N 3.34Å; E50-E53 PolarHBondContact O-N 2.95Å; E50-A54 WeakPolarHBondContact O-CB 2.83Å; E50-A54 PolarHBondContact O-N 3Å
51	A	97.4	Very high	95.8	Very high	52 Å²	52	100.8 Å²	100.8	43%	0.43	50%	0.504	S	S	.	.	H	α-helix	trans	-61.4	-42.9	176.2	0	0	0	0	0	111.7	M47 L49 E53 A54 I55	M47-A51 WeakPolarHBondContact O-CB 3.46Å; M47-A51 PolarHBondContact O-N 3.19Å; L49-A51 PolarHBondContact O-N 3.45Å; A51-E53 VanDerWaalsContact C-N 3.34Å; A51-A54 PolarHBondContact O-N 3.3Å; A51-I55 VanDerWaalsContact O-CG1 3.3Å; A51-I55 WeakPolarHBondContact O-CG1 3.4Å; A51-I55 PolarHBondContact O-N 2.99Å
52	Q	96.9	Very high	95.3	Very high	106 Å²	106	101.1 Å²	101.1	50%	0.495	51%	0.506	S	S	.	.	H	α-helix	trans	-67.7	-36.4	178.6	-165.3	-177.7	21.7	0	0	112	Q48 L49 E50 K56	Q48-Q52 WeakPolarHBondContact O-CB 3.34Å; Q48-Q52 PolarHBondContact O-N 3.06Å; L49-Q52 PolarHBondContact O-N 2.98Å; E50-Q52 VanDerWaalsContact C-N 3.33Å; E50-Q52 PolarHBondContact O-N 3.34Å; Q52-K56 WeakPolarHBondContact O-CG 3.49Å; Q52-K56 PolarHBondContact O-N 3.07Å; Q52-K56 VanDerWaalsContact O-N 3.13Å
53	E	96.8	Very high	94.8	Very high	111 Å²	111	101.2 Å²	101.2	52%	0.519	50%	0.504	S	S	.	.	H	α-helix	trans	-68	-43	176.9	-172.5	168.3	-160.9	0	0	111.8	L49 E50 A51 I55 K56 Q57	L49-E53 WeakPolarHBondContact O-CB 3.35Å; L49-E53 PolarHBondContact O-N 3.38Å; E50-E53 PolarHBondContact O-N 2.95Å; A51-E53 VanDerWaalsContact C-N 3.34Å; E53-I55 VanDerWaalsContact C-N 3.3Å; E53-I55 PolarHBondContact O-N 3.49Å; E53-K56 PolarHBondContact O-N 2.96Å; E53-K56 VanDerWaalsContact O-N 3.14Å; E53-Q57 WeakPolarHBondContact O-CG 3.36Å; E53-Q57 PolarHBondContact O-N 3.48Å
54	A	95.8	Very high	94	Very high	43 Å²	43	99.7 Å²	99.7	36%	0.355	50%	0.5	S	S	.	.	H	α-helix	trans	-58.4	-41.8	175.3	0	0	0	0	0	112.1	E50 A51 Q57 Q58	E50-A54 WeakPolarHBondContact O-CB 2.83Å; E50-A54 PolarHBondContact O-N 3Å; A51-A54 PolarHBondContact O-N 3.3Å; A54-Q57 PolarHBondContact O-N 2.94Å; A54-Q58 WeakPolarHBondContact O-CG 3.34Å; A54-Q58 PolarHBondContact O-N 3.27Å
55	I	95.9	Very high	92.9	Very high	95 Å²	95	101.5 Å²	101.5	49%	0.487	51%	0.506	S	S	.	.	H	α-helix	trans	-61.8	-47.5	175.3	-66.3	166.6	0	0	0	110.5	A51 E53 Q57 Q58 D59	A51-I55 VanDerWaalsContact O-CG1 3.3Å; A51-I55 WeakPolarHBondContact O-CG1 3.4Å; A51-I55 PolarHBondContact O-N 2.99Å; E53-I55 VanDerWaalsContact C-N 3.3Å; E53-I55 PolarHBondContact O-N 3.49Å; I55-Q57 VanDerWaalsContact C-N 3.31Å; I55-Q57 PolarHBondContact O-N 2.62Å; I55-Q58 PolarHBondContact O-N 3.01Å; I55-D59 PolarHBondContact O-N 3.43Å
56	K	95.8	Very high	91.5	Very high	113 Å²	113	105 Å²	105	49%	0.491	52%	0.522	S	S	.	.	H	α-helix	trans	-60.4	-40.2	178.4	-71.9	169.6	-178.8	170.7	0	112.3	Q52 E53 D59 L60	Q52-K56 WeakPolarHBondContact O-CG 3.49Å; Q52-K56 PolarHBondContact O-N 3.07Å; Q52-K56 VanDerWaalsContact O-N 3.13Å; E53-K56 PolarHBondContact O-N 2.96Å; E53-K56 VanDerWaalsContact O-N 3.14Å; K56-D59 PolarHBondContact O-N 3.05Å; K56-L60 VanDerWaalsContact O-CG 3.3Å; K56-L60 WeakPolarHBondContact O-CG 3.4Å; K56-L60 PolarHBondContact O-N 3.43Å
57	Q	93.2	Very high	89.7	Confident	120 Å²	120	106.8 Å²	106.8	56%	0.561	53%	0.532	S	S	*	.	H	α-helix	trans	-67.1	-39.9	177.8	-72	-176.3	-1.6	0	0	111.9	E53 A54 I55 L60 A61	E53-Q57 WeakPolarHBondContact O-CG 3.36Å; E53-Q57 PolarHBondContact O-N 3.48Å; A54-Q57 PolarHBondContact O-N 2.94Å; I55-Q57 VanDerWaalsContact C-N 3.31Å; I55-Q57 PolarHBondContact O-N 2.62Å; Q57-L60 PolarHBondContact O-N 3.48Å; Q57-A61 WeakPolarHBondContact O-CB 3.46Å; Q57-A61 PolarHBondContact O-N 3.1Å
58	Q	91.5	Very high	87.9	Confident	130 Å²	130	107.1 Å²	107.1	61%	0.607	54%	0.541	S	S	*	.	H	α-helix	trans	-60.8	-45.2	173.7	-72.7	176.6	14.5	0	0	111.3	A54 I55 L60 A61 L62	A54-Q58 WeakPolarHBondContact O-CG 3.34Å; A54-Q58 PolarHBondContact O-N 3.27Å; I55-Q58 PolarHBondContact O-N 3.01Å; Q58-L60 VanDerWaalsContact C-N 3.34Å; Q58-L60 PolarHBondContact O-N 2.91Å; Q58-A61 PolarHBondContact O-N 2.79Å; Q58-L62 WeakPolarHBondContact O-CB 3.3Å; Q58-L62 VanDerWaalsContact O-CG 3.24Å; Q58-L62 WeakPolarHBondContact O-CG 3.37Å; Q58-L62 PolarHBondContact O-N 2.96Å
59	D	90.7	Very high	85.5	Confident	84 Å²	84	112.1 Å²	112.1	45%	0.449	57%	0.565	S	S	.	*	H	α-helix	trans	-62.1	-39.6	177.6	-72.4	-22.6	0	0	0	112.6	I55 K56 K63	I55-D59 PolarHBondContact O-N 3.43Å; K56-D59 PolarHBondContact O-N 3.05Å; D59-K63 WeakPolarHBondContact O-CG 3.32Å; D59-K63 PolarHBondContact O-N 3.15Å; D59-K63 VanDerWaalsContact O-N 3.16Å
60	L	90.6	Very high	84.9	Confident	102 Å²	102	112.2 Å²	112.2	53%	0.534	56%	0.564	S	S	.	*	H	α-helix	trans	-67.8	-46.7	176.9	-72	168.8	0	0	0	111.6	K56 Q57 Q58 L62 K63 E64	K56-L60 VanDerWaalsContact O-CG 3.3Å; K56-L60 WeakPolarHBondContact O-CG 3.4Å; K56-L60 PolarHBondContact O-N 3.43Å; Q57-L60 PolarHBondContact O-N 3.48Å; Q58-L60 VanDerWaalsContact C-N 3.34Å; Q58-L60 PolarHBondContact O-N 2.91Å; L60-L62 VanDerWaalsContact C-N 3.27Å; L60-L62 PolarHBondContact O-N 3.02Å; L60-K63 WeakPolarHBondContact O-CB 3.31Å; L60-K63 PolarHBondContact O-N 3.06Å; L60-K63 VanDerWaalsContact O-N 3.09Å; L60-E64 WeakPolarHBondContact O-CG 3.49Å; L60-E64 PolarHBondContact O-N 3.39Å
61	A	88.5	Confident	84.3	Confident	37 Å²	37	112.6 Å²	112.6	31%	0.306	57%	0.568	S	S	.	*	H	α-helix	trans	-61.4	-36.2	178	0	0	0	0	0	112.1	Q57 Q58 Q65	Q57-A61 WeakPolarHBondContact O-CB 3.46Å; Q57-A61 PolarHBondContact O-N 3.1Å; Q58-A61 PolarHBondContact O-N 2.79Å; A61-Q65 WeakPolarHBondContact O-CB 3.42Å; A61-Q65 WeakPolarHBondContact O-CG 3.31Å; A61-Q65 PolarHBondContact O-N 2.83Å; A61-Q65 VanDerWaalsContact O-N 3.1Å
62	L	88.6	Confident	83.5	Confident	98 Å²	98	116 Å²	116	51%	0.513	58%	0.576	S	S	.	*	H	α-helix	trans	-66.3	-38.7	174.3	-72.8	169.5	0	0	0	112.2	Q58 L60 Q66	Q58-L62 WeakPolarHBondContact O-CB 3.3Å; Q58-L62 VanDerWaalsContact O-CG 3.24Å; Q58-L62 WeakPolarHBondContact O-CG 3.37Å; Q58-L62 PolarHBondContact O-N 2.96Å; L60-L62 VanDerWaalsContact C-N 3.27Å; L60-L62 PolarHBondContact O-N 3.02Å; L62-Q66 WeakPolarHBondContact O-CG 3.31Å; L62-Q66 PolarHBondContact O-N 2.83Å; L62-Q66 VanDerWaalsContact O-N 3.16Å
63	K	86.1	Confident	82.7	Confident	124 Å²	124	116.6 Å²	116.6	54%	0.539	58%	0.58	S	S	.	*	H	α-helix	trans	-68.3	-44.8	176.5	-74.3	172.4	179.6	178.6	0	112.2	D59 L60 Q65 Q66 E67	D59-K63 WeakPolarHBondContact O-CG 3.32Å; D59-K63 PolarHBondContact O-N 3.15Å; D59-K63 VanDerWaalsContact O-N 3.16Å; L60-K63 WeakPolarHBondContact O-CB 3.31Å; L60-K63 PolarHBondContact O-N 3.06Å; L60-K63 VanDerWaalsContact O-N 3.09Å; K63-Q65 VanDerWaalsContact C-N 3.28Å; K63-Q65 PolarHBondContact O-N 3.17Å; K63-Q66 WeakPolarHBondContact O-CB 3.46Å; K63-Q66 PolarHBondContact O-N 3.19Å; K63-E67 PolarHBondContact O-N 3.45Å
64	E	82.1	Confident	81.9	Confident	126 Å²	126	116.9 Å²	116.9	59%	0.589	58%	0.584	S	S	*	*	H	α-helix	trans	-61.7	-37.4	177	-69.4	178.4	155.5	0	0	111.7	L60 Q66 E67 T68	L60-E64 WeakPolarHBondContact O-CG 3.49Å; L60-E64 PolarHBondContact O-N 3.39Å; E64-Q66 VanDerWaalsContact C-N 3.31Å; E64-Q66 PolarHBondContact O-N 3.39Å; E64-E67 PolarHBondContact O-N 3.31Å; E64-T68 PolarHBondContact O-N 3.3Å; E64-T68 PolarHBondContact O-OG1 3.16Å
65	Q	74	Confident	80.9	Confident	130 Å²	130	121.9 Å²	121.9	61%	0.607	60%	0.599	S	S	*	*	H	α-helix	trans	-68	-28.9	174.2	-73.6	174.6	25.4	0	0	113.3	A61 K63	A61-Q65 WeakPolarHBondContact O-CB 3.42Å; A61-Q65 WeakPolarHBondContact O-CG 3.31Å; A61-Q65 PolarHBondContact O-N 2.83Å; A61-Q65 VanDerWaalsContact O-N 3.1Å; K63-Q65 VanDerWaalsContact C-N 3.28Å; K63-Q65 PolarHBondContact O-N 3.17Å
66	Q	68.4	Low	79.9	Confident	146 Å²	146	123.8 Å²	123.8	68%	0.682	61%	0.607	S	S	*	*	H	α-helix	trans	-77.6	-30.1	174.8	-75.8	177.6	-20.5	0	0	112.9	L62 K63 E64	L62-Q66 WeakPolarHBondContact O-CG 3.31Å; L62-Q66 PolarHBondContact O-N 2.83Å; L62-Q66 VanDerWaalsContact O-N 3.16Å; K63-Q66 WeakPolarHBondContact O-CB 3.46Å; K63-Q66 PolarHBondContact O-N 3.19Å; E64-Q66 VanDerWaalsContact C-N 3.31Å; E64-Q66 PolarHBondContact O-N 3.39Å
67	E	61.3	Low	78.6	Confident	164 Å²	164	124.6 Å²	124.6	77%	0.766	62%	0.616	S	S	*	*	H	α-helix	trans	-80.5	-14.2	178.9	-71.9	178.4	171.8	0	0	113.8	K63 E64	K63-E67 PolarHBondContact O-N 3.45Å; E64-E67 PolarHBondContact O-N 3.31Å
68	T	58.4	Low	77.4	Confident	123 Å²	123	125 Å²	125	76%	0.755	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.1	5.6	179.9	-40.7	0	0	0	0	113.1	E64	E64-T68 PolarHBondContact O-N 3.3Å; E64-T68 PolarHBondContact O-OG1 3.16Å
69	Q	48.9	Very low	76.1	Confident	236 Å²	236	124.5 Å²	124.5	100%	1.103	62%	0.622	S	S	*	*			trans	-107.7	0	169.3	-77.2	-175.8	22.1	0	0	111

Retrieved 69 of 69 residues in 69.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).