A0A060Z3C0_ONCMY Loading...

Small integral membrane protein 12

AlphaFold DB , UniProt , Accession A0A060Z3C0, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene smim12, Length 92 aa.

						>A0A060Z3C0_ONCMY|A0A060Z3C0|smim12
MWPVLWMSMRTYAPYITFPVAFVVGAVGYHLEWFIRGDTTLKPGEEKSIVELREDRKLEEGAGRDSTQVLSLKEKLEFTPRAALDRNRPEKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	70.9	Confident	84.5	Confident	200 Å²	200	121.1 Å²	121.1	99%	0.985	59%	0.592	S	S	*	*				0	-36.2	0	-59.3	-163.6	78.6	0	0	113.2	V4 L5	M1-V4 PolarHBondContact O-N 3.29Å; M1-L5 PolarHBondContact O-N 3.26Å
2	W	81.4	Confident	84.8	Confident	178 Å²	178	122.8 Å²	122.8	67%	0.674	59%	0.589	S	S	*	*	H	α-helix	trans	-59.5	-41.9	176.2	-171.5	-112.4	0	0	0	115.9	V4 L5 W6	W2-V4 VanDerWaalsContact C-N 3.26Å; W2-V4 PolarHBondContact O-N 3.34Å; W2-L5 HydrophobicContact CE3-CD1 4.34Å; W2-L5 PolarHBondContact O-N 3.18Å; W2-W6 AromaticContact CD1-CD1 3.76Å; W2-W6 AromaticContact CD1-NE1 3.87Å; W2-W6 AromaticContact CD2-NE1 3.86Å; W2-W6 AromaticContact CE2-CD1 3.68Å; W2-W6 AromaticContact CE2-NE1 3.07Å; W2-W6 HydrophobicContact CZ2-CZ2 4.28Å; W2-W6 AromaticContact CZ2-NE1 3.22Å; W2-W6 AromaticContact NE1-CD1 3.47Å; W2-W6 AromaticContact NE1-NE1 3.09Å; W2-W6 PolarHBondContact O-N 3.34Å
3	P	85.3	Confident	85	Confident	97 Å²	97	116.3 Å²	116.3	63%	0.63	57%	0.568	S	S	*	*	H	α-helix	trans	-65.1	-30	178.6	-22.9	35.4	0	0	0	113.5	W6 M7	P3-W6 PolarHBondContact O-N 3.04Å; P3-M7 WeakPolarHBondContact O-CB 3.42Å; P3-M7 PolarHBondContact O-N 2.89Å
4	V	86.1	Confident	85.3	Confident	104 Å²	104	113.4 Å²	113.4	63%	0.63	56%	0.563	S	S	*	*	H	α-helix	trans	-69.2	-38.3	179.1	-179.5	0	0	0	0	110.8	M1 W2 M7 S8	M1-V4 PolarHBondContact O-N 3.29Å; W2-V4 VanDerWaalsContact C-N 3.26Å; W2-V4 PolarHBondContact O-N 3.34Å; V4-M7 PolarHBondContact O-N 3.07Å; V4-S8 WeakPolarHBondContact O-CB 3.5Å; V4-S8 PolarHBondContact O-N 2.75Å; V4-S8 PolarHBondContact O-OG 3.12Å
5	L	85.7	Confident	85.7	Confident	104 Å²	104	117.5 Å²	117.5	55%	0.545	57%	0.571	S	S	.	*	H	α-helix	trans	-66	-41.4	174.9	-69.1	171.1	0	0	0	112.1	M1 W2 M7 S8 M9	M1-L5 PolarHBondContact O-N 3.26Å; W2-L5 HydrophobicContact CE3-CD1 4.34Å; W2-L5 PolarHBondContact O-N 3.18Å; L5-M7 VanDerWaalsContact C-N 3.34Å; L5-S8 PolarHBondContact O-OG 3.33Å; L5-M9 VanDerWaalsContact O-CB 3.26Å; L5-M9 WeakPolarHBondContact O-CB 3.39Å; L5-M9 PolarHBondContact O-N 2.94Å
6	W	86.9	Confident	86	Confident	108 Å²	108	117.1 Å²	117.1	41%	0.409	57%	0.571	S	S	.	*	H	α-helix	trans	-67.4	-36.1	176.2	-82.5	102.6	0	0	0	113	W2 P3 M9 R10	W2-W6 AromaticContact CD1-CD1 3.76Å; W2-W6 AromaticContact CD1-NE1 3.87Å; W2-W6 AromaticContact CD2-NE1 3.86Å; W2-W6 AromaticContact CE2-CD1 3.68Å; W2-W6 AromaticContact CE2-NE1 3.07Å; W2-W6 HydrophobicContact CZ2-CZ2 4.28Å; W2-W6 AromaticContact CZ2-NE1 3.22Å; W2-W6 AromaticContact NE1-CD1 3.47Å; W2-W6 AromaticContact NE1-NE1 3.09Å; W2-W6 PolarHBondContact O-N 3.34Å; P3-W6 PolarHBondContact O-N 3.04Å; W6-M9 HydrophobicContact CD2-CE 4.38Å; W6-M9 HydrophobicContact CE3-CE 3.48Å; W6-M9 VanDerWaalsContact CE3-CE 3.48Å; W6-M9 HydrophobicContact CH2-CE 3.96Å; W6-M9 HydrophobicContact CZ3-CE 3.24Å; W6-R10 PolarHBondContact O-N 3.39Å
7	M	87.1	Confident	86.4	Confident	137 Å²	137	115.1 Å²	115.1	68%	0.675	57%	0.567	S	S	*	*	H	α-helix	trans	-69.1	-48.7	176.2	-170.1	169.4	-178.9	0	0	110.7	P3 V4 L5 M9 R10 T11	P3-M7 WeakPolarHBondContact O-CB 3.42Å; P3-M7 PolarHBondContact O-N 2.89Å; V4-M7 PolarHBondContact O-N 3.07Å; L5-M7 VanDerWaalsContact C-N 3.34Å; M7-M9 PolarHBondContact O-N 3.24Å; M7-R10 PolarHBondContact O-N 3.45Å; M7-T11 PolarHBondContact O-N 3.41Å; M7-T11 PolarHBondContact O-OG1 2.98Å
8	S	85.6	Confident	86.7	Confident	45 Å²	45	116.8 Å²	116.8	32%	0.315	57%	0.571	S	S	.	*	H	α-helix	trans	-61.7	-43.5	178.2	66.5	0	0	0	0	111.8	V4 L5 R10 T11 Y12	V4-S8 WeakPolarHBondContact O-CB 3.5Å; V4-S8 PolarHBondContact O-N 2.75Å; V4-S8 PolarHBondContact O-OG 3.12Å; L5-S8 PolarHBondContact O-OG 3.33Å; S8-R10 VanDerWaalsContact C-N 3.32Å; S8-R10 PolarHBondContact O-N 3.27Å; S8-T11 PolarHBondContact O-N 2.9Å; S8-Y12 WeakPolarHBondContact O-CB 3.5Å; S8-Y12 WeakPolarHBondContact O-CD2 3.34Å; S8-Y12 PolarHBondContact O-N 3.41Å
9	M	86.8	Confident	87.2	Confident	105 Å²	105	114 Å²	114	52%	0.517	56%	0.563	S	S	.	*	H	α-helix	trans	-60.4	-41	178.1	-170.2	173.2	71.6	0	0	111.9	L5 W6 M7 A13	L5-M9 VanDerWaalsContact O-CB 3.26Å; L5-M9 WeakPolarHBondContact O-CB 3.39Å; L5-M9 PolarHBondContact O-N 2.94Å; W6-M9 HydrophobicContact CD2-CE 4.38Å; W6-M9 HydrophobicContact CE3-CE 3.48Å; W6-M9 VanDerWaalsContact CE3-CE 3.48Å; W6-M9 HydrophobicContact CH2-CE 3.96Å; W6-M9 HydrophobicContact CZ3-CE 3.24Å; M7-M9 PolarHBondContact O-N 3.24Å; M9-A13 WeakPolarHBondContact O-CA 3.37Å; M9-A13 WeakPolarHBondContact O-CB 3.43Å; M9-A13 PolarHBondContact O-N 3.47Å
10	R	86	Confident	87.6	Confident	180 Å²	180	112.6 Å²	112.6	68%	0.679	56%	0.56	S	S	*	*	H	α-helix	trans	-68.7	-40.7	175.3	-81.2	-174.7	164.2	103.3	-2.2	112.9	W6 M7 S8 P14	W6-R10 PolarHBondContact O-N 3.39Å; M7-R10 PolarHBondContact O-N 3.45Å; S8-R10 VanDerWaalsContact C-N 3.32Å; S8-R10 PolarHBondContact O-N 3.27Å; R10-P14 WeakPolarHBondContact O-CD 3.36Å
11	T	87.4	Confident	88	Confident	74 Å²	74	110.2 Å²	110.2	45%	0.454	56%	0.559	S	S	.	*	H	α-helix	trans	-66.9	-39.1	179.8	-56.6	0	0	0	0	111.7	M7 S8 Y15	M7-T11 PolarHBondContact O-N 3.41Å; M7-T11 PolarHBondContact O-OG1 2.98Å; S8-T11 PolarHBondContact O-N 2.9Å; T11-Y15 WeakPolarHBondContact O-CE2 3.28Å
12	Y	88.2	Confident	89.1	Confident	142 Å²	142	107.3 Å²	107.3	56%	0.557	54%	0.541	S	S	*	.	H	α-helix	trans	-92.9	-11.6	-178.3	-65.8	-66.7	0	0	0	114.2	S8 Y15 I16	S8-Y12 WeakPolarHBondContact O-CB 3.5Å; S8-Y12 WeakPolarHBondContact O-CD2 3.34Å; S8-Y12 PolarHBondContact O-N 3.41Å; Y12-Y15 HydrophobicContact CD1-CD2 4.33Å; Y12-Y15 PolarHBondContact O-N 3.03Å; Y12-Y15 VanDerWaalsContact O-N 3.1Å; Y12-I16 PolarHBondContact O-N 3.05Å
13	A	87.4	Confident	89.9	Confident	38 Å²	38	103 Å²	103	31%	0.314	53%	0.534	S	S	.	.	H	α-helix	trans	-49.6	-51.8	179.4	0	0	0	0	0	112.4	M9 Y15 I16 T17	M9-A13 WeakPolarHBondContact O-CA 3.37Å; M9-A13 WeakPolarHBondContact O-CB 3.43Å; M9-A13 PolarHBondContact O-N 3.47Å; A13-Y15 PolarHBondContact O-N 3.19Å; A13-I16 PolarHBondContact O-N 3.35Å; A13-T17 WeakPolarHBondContact O-CB 3.44Å; A13-T17 WeakPolarHBondContact O-CG2 3.42Å; A13-T17 PolarHBondContact O-N 3.34Å; A13-T17 PolarHBondContact O-OG1 3.31Å
14	P	89.2	Confident	90.4	Very high	76 Å²	76	103 Å²	103	49%	0.494	53%	0.532	S	S	.	.	H	α-helix	trans	-60.6	-34.1	-177.2	-23.4	34.8	0	0	0	113.3	R10 I16 F18	R10-P14 WeakPolarHBondContact O-CD 3.36Å; P14-I16 VanDerWaalsContact C-N 3.26Å; P14-I16 PolarHBondContact O-N 2.63Å; P14-F18 WeakPolarHBondContact O-CB 3.49Å; P14-F18 PolarHBondContact O-N 3.36Å; P14-F18 VanDerWaalsContact O-N 3.14Å
15	Y	90.9	Very high	90.7	Very high	174 Å²	174	100.1 Å²	100.1	68%	0.682	52%	0.523	S	S	*	.	H	α-helix	trans	-73.6	-18.5	-179.1	-61.6	-82.8	0	0	0	113.2	T11 Y12 A13 P19	T11-Y15 WeakPolarHBondContact O-CE2 3.28Å; Y12-Y15 HydrophobicContact CD1-CD2 4.33Å; Y12-Y15 PolarHBondContact O-N 3.03Å; Y12-Y15 VanDerWaalsContact O-N 3.1Å; A13-Y15 PolarHBondContact O-N 3.19Å; Y15-P19 WeakPolarHBondContact O-CD 3.35Å; Y15-P19 WeakPolarHBondContact O-CG 3.4Å
16	I	90.8	Very high	91.1	Very high	111 Å²	111	96.9 Å²	96.9	57%	0.569	51%	0.512	S	S	*	.	H	α-helix	trans	-101.9	-45.1	178.5	-62.6	166	0	0	0	109.9	Y12 A13 P14 F18 P19 V20	Y12-I16 PolarHBondContact O-N 3.05Å; A13-I16 PolarHBondContact O-N 3.35Å; P14-I16 VanDerWaalsContact C-N 3.26Å; P14-I16 PolarHBondContact O-N 2.63Å; I16-F18 PolarHBondContact O-N 3.12Å; I16-P19 WeakPolarHBondContact O-CD 3.42Å; I16-V20 HydrophobicContact CG2-CG2 4.48Å; I16-V20 WeakPolarHBondContact O-CB 3.43Å; I16-V20 WeakPolarHBondContact O-CG2 3.41Å; I16-V20 PolarHBondContact O-N 3.35Å
17	T	92.8	Very high	91.5	Very high	83 Å²	83	96 Å²	96	51%	0.509	52%	0.518	S	S	.	.	H	α-helix	trans	-68.1	-37.5	-176.7	58.4	0	0	0	0	111.9	A13 A21	A13-T17 WeakPolarHBondContact O-CB 3.44Å; A13-T17 WeakPolarHBondContact O-CG2 3.42Å; A13-T17 PolarHBondContact O-N 3.34Å; A13-T17 PolarHBondContact O-OG1 3.31Å; T17-A21 WeakPolarHBondContact O-CB 3.19Å; T17-A21 PolarHBondContact O-N 3.29Å
18	F	92.5	Very high	91.6	Very high	146 Å²	146	91 Å²	91	64%	0.64	50%	0.501	S	S	*	.	H	α-helix	trans	-66.5	-51	-179.3	177	-96.1	0	0	0	112.7	P14 I16 V20 A21 F22	P14-F18 WeakPolarHBondContact O-CB 3.49Å; P14-F18 PolarHBondContact O-N 3.36Å; P14-F18 VanDerWaalsContact O-N 3.14Å; I16-F18 PolarHBondContact O-N 3.12Å; F18-V20 VanDerWaalsContact C-N 3.32Å; F18-V20 PolarHBondContact O-N 3.08Å; F18-A21 PolarHBondContact O-N 3.3Å; F18-F22 WeakPolarHBondContact O-CB 3.45Å; F18-F22 PolarHBondContact O-N 2.86Å
19	P	94.9	Very high	91.6	Very high	64 Å²	64	96.2 Å²	96.2	42%	0.416	52%	0.515	S	S	.	.	H	α-helix	trans	-60.4	-39.9	175.1	-26.2	36.4	0	0	0	113.1	Y15 I16 F22 V23	Y15-P19 WeakPolarHBondContact O-CD 3.35Å; Y15-P19 WeakPolarHBondContact O-CG 3.4Å; I16-P19 WeakPolarHBondContact O-CD 3.42Å; P19-F22 PolarHBondContact O-N 3.17Å; P19-V23 WeakPolarHBondContact O-CG2 3.46Å; P19-V23 PolarHBondContact O-N 3.47Å
20	V	95.8	Very high	91.6	Very high	85 Å²	85	97 Å²	97	52%	0.515	52%	0.518	S	S	.	.	H	α-helix	trans	-63.4	-47.7	177.2	171.6	0	0	0	0	110.7	I16 F18 F22 V23 V24	I16-V20 HydrophobicContact CG2-CG2 4.48Å; I16-V20 WeakPolarHBondContact O-CB 3.43Å; I16-V20 WeakPolarHBondContact O-CG2 3.41Å; I16-V20 PolarHBondContact O-N 3.35Å; F18-V20 VanDerWaalsContact C-N 3.32Å; F18-V20 PolarHBondContact O-N 3.08Å; V20-F22 VanDerWaalsContact C-N 3.3Å; V20-F22 PolarHBondContact O-N 3.16Å; V20-V23 PolarHBondContact O-N 3.07Å; V20-V24 HydrophobicContact CG1-CG2 4.41Å; V20-V24 WeakPolarHBondContact O-CB 3.44Å; V20-V24 VanDerWaalsContact O-CG2 3.28Å; V20-V24 WeakPolarHBondContact O-CG2 3.44Å; V20-V24 PolarHBondContact O-N 3.03Å
21	A	95.2	Very high	91.6	Very high	63 Å²	63	93.3 Å²	93.3	52%	0.521	51%	0.511	S	S	.	.	H	α-helix	trans	-61.9	-39	177.3	0	0	0	0	0	111.8	T17 F18 V24 G25	T17-A21 WeakPolarHBondContact O-CB 3.19Å; T17-A21 PolarHBondContact O-N 3.29Å; F18-A21 PolarHBondContact O-N 3.3Å; A21-V24 PolarHBondContact O-N 2.83Å; A21-G25 PolarHBondContact O-N 3.4Å
22	F	95.9	Very high	91.3	Very high	140 Å²	140	94.3 Å²	94.3	61%	0.614	51%	0.51	S	S	*	.	H	α-helix	trans	-62.5	-46.8	176	-179.3	-97.5	0	0	0	111.9	F18 P19 V20 G25 A26	F18-F22 WeakPolarHBondContact O-CB 3.45Å; F18-F22 PolarHBondContact O-N 2.86Å; P19-F22 PolarHBondContact O-N 3.17Å; V20-F22 VanDerWaalsContact C-N 3.3Å; V20-F22 PolarHBondContact O-N 3.16Å; F22-G25 PolarHBondContact O-N 3.3Å; F22-A26 WeakPolarHBondContact O-CB 3.48Å; F22-A26 PolarHBondContact O-N 3.07Å
23	V	96.5	Very high	90.6	Very high	87 Å²	87	96.1 Å²	96.1	53%	0.527	52%	0.516	S	S	.	.	H	α-helix	trans	-63.8	-45.5	177.6	172.3	0	0	0	0	111	P19 V20 G25 A26 V27	P19-V23 WeakPolarHBondContact O-CG2 3.46Å; P19-V23 PolarHBondContact O-N 3.47Å; V20-V23 PolarHBondContact O-N 3.07Å; V23-G25 VanDerWaalsContact C-N 3.31Å; V23-G25 PolarHBondContact O-N 3.06Å; V23-A26 PolarHBondContact O-N 3.18Å; V23-V27 HydrophobicContact CG1-CG2 4.37Å; V23-V27 WeakPolarHBondContact O-CB 3.5Å; V23-V27 VanDerWaalsContact O-CG2 3.31Å; V23-V27 WeakPolarHBondContact O-CG2 3.49Å; V23-V27 PolarHBondContact O-N 3.37Å
24	V	96.1	Very high	90.2	Very high	96 Å²	96	102.5 Å²	102.5	58%	0.582	54%	0.537	S	S	*	.	H	α-helix	trans	-61.3	-41.9	176.6	172.2	0	0	0	0	110.9	V20 A21 G28	V20-V24 HydrophobicContact CG1-CG2 4.41Å; V20-V24 WeakPolarHBondContact O-CB 3.44Å; V20-V24 VanDerWaalsContact O-CG2 3.28Å; V20-V24 WeakPolarHBondContact O-CG2 3.44Å; V20-V24 PolarHBondContact O-N 3.03Å; A21-V24 PolarHBondContact O-N 2.83Å; V24-G28 WeakPolarHBondContact O-CA 3.19Å; V24-G28 PolarHBondContact O-N 2.97Å
25	G	93.9	Very high	89.7	Confident	44 Å²	44	105 Å²	105	45%	0.454	55%	0.545	S	S	.	.	H	α-helix	trans	-63.7	-43.6	175.6	0	0	0	0	0	112.7	A21 F22 V23 G28 Y29	A21-G25 PolarHBondContact O-N 3.4Å; F22-G25 PolarHBondContact O-N 3.3Å; V23-G25 VanDerWaalsContact C-N 3.31Å; V23-G25 PolarHBondContact O-N 3.06Å; G25-G28 PolarHBondContact O-N 2.97Å; G25-Y29 VanDerWaalsContact O-CB 3.3Å; G25-Y29 WeakPolarHBondContact O-CB 3.49Å; G25-Y29 PolarHBondContact O-N 3.49Å
26	A	93.8	Very high	88.6	Confident	37 Å²	37	102.8 Å²	102.8	31%	0.306	54%	0.535	S	S	.	.	H	α-helix	trans	-64	-47.8	177.3	0	0	0	0	0	111.7	F22 V23 G28 Y29 H30	F22-A26 WeakPolarHBondContact O-CB 3.48Å; F22-A26 PolarHBondContact O-N 3.07Å; V23-A26 PolarHBondContact O-N 3.18Å; A26-G28 VanDerWaalsContact C-N 3.34Å; A26-Y29 PolarHBondContact O-N 3.04Å; A26-H30 PolarHBondContact O-CD2 2.86Å; A26-H30 PolarHBondContact O-N 3.3Å
27	V	94.1	Very high	87.4	Confident	88 Å²	88	99.4 Å²	99.4	53%	0.533	53%	0.528	S	S	.	.	H	α-helix	trans	-63.3	-43.2	176.3	174.2	0	0	0	0	110.7	V23 Y29 H30 L31	V23-V27 HydrophobicContact CG1-CG2 4.37Å; V23-V27 WeakPolarHBondContact O-CB 3.5Å; V23-V27 VanDerWaalsContact O-CG2 3.31Å; V23-V27 WeakPolarHBondContact O-CG2 3.49Å; V23-V27 PolarHBondContact O-N 3.37Å; V27-Y29 PolarHBondContact O-N 2.93Å; V27-H30 PolarHBondContact O-N 3.24Å; V27-L31 VanDerWaalsContact O-CB 3.3Å; V27-L31 WeakPolarHBondContact O-CB 3.18Å; V27-L31 PolarHBondContact O-N 3.39Å
28	G	90.1	Very high	85.7	Confident	32 Å²	32	103.9 Å²	103.9	33%	0.33	55%	0.549	S	S	.	.	H	α-helix	trans	-59.5	-44.2	175.9	0	0	0	0	0	112.3	V24 G25 A26 L31 E32	V24-G28 WeakPolarHBondContact O-CA 3.19Å; V24-G28 PolarHBondContact O-N 2.97Å; G25-G28 PolarHBondContact O-N 2.97Å; A26-G28 VanDerWaalsContact C-N 3.34Å; G28-L31 PolarHBondContact O-N 3.05Å; G28-E32 WeakPolarHBondContact O-CB 3.36Å; G28-E32 PolarHBondContact O-N 3.41Å
29	Y	85.8	Confident	84	Confident	155 Å²	155	103.1 Å²	103.1	61%	0.608	56%	0.556	S	S	*	*	H	α-helix	trans	-61.9	-43.4	176	177.9	-101.2	0	0	0	112.2	G25 A26 V27 W33	G25-Y29 VanDerWaalsContact O-CB 3.3Å; G25-Y29 WeakPolarHBondContact O-CB 3.49Å; G25-Y29 PolarHBondContact O-N 3.49Å; A26-Y29 PolarHBondContact O-N 3.04Å; V27-Y29 PolarHBondContact O-N 2.93Å; Y29-W33 WeakPolarHBondContact O-CB 3.48Å; Y29-W33 PolarHBondContact O-N 3.26Å
30	H	86.2	Confident	82.1	Confident	122 Å²	122	103.6 Å²	103.6	57%	0.565	56%	0.558	S	S	*	*	H	α-helix	trans	-68	-38.3	176.4	-76.5	-65.5	0	0	0	112.8	A26 V27 W33 F34	A26-H30 PolarHBondContact O-CD2 2.86Å; A26-H30 PolarHBondContact O-N 3.3Å; V27-H30 PolarHBondContact O-N 3.24Å; H30-W33 PolarHBondContact O-N 2.65Å; H30-F34 WeakPolarHBondContact O-CB 3.3Å; H30-F34 PolarHBondContact O-N 3.37Å
31	L	86.5	Confident	80.1	Confident	102 Å²	102	105 Å²	105	53%	0.534	56%	0.562	S	S	.	*	H	α-helix	trans	-71	-39.5	177.2	-170	123.1	0	0	0	111.5	V27 G28 W33 F34 I35	V27-L31 VanDerWaalsContact O-CB 3.3Å; V27-L31 WeakPolarHBondContact O-CB 3.18Å; V27-L31 PolarHBondContact O-N 3.39Å; G28-L31 PolarHBondContact O-N 3.05Å; L31-W33 VanDerWaalsContact C-N 3.32Å; L31-F34 PolarHBondContact O-N 2.88Å; L31-I35 HydrophobicContact CD2-CD1 3.49Å; L31-I35 VanDerWaalsContact CD2-CD1 3.49Å; L31-I35 HydrophobicContact CG-CD1 4.02Å; L31-I35 WeakPolarHBondContact O-CB 3.35Å; L31-I35 VanDerWaalsContact O-CG1 3.31Å; L31-I35 WeakPolarHBondContact O-CG1 3.02Å; L31-I35 PolarHBondContact O-N 2.98Å
32	E	79.7	Confident	78.4	Confident	95 Å²	95	108.1 Å²	108.1	44%	0.444	56%	0.564	S	S	.	*	H	α-helix	trans	-59.7	-44.4	171	-178.9	179.3	176.4	0	0	110.4	G28 F34 I35 R36	G28-E32 WeakPolarHBondContact O-CB 3.36Å; G28-E32 PolarHBondContact O-N 3.41Å; E32-F34 VanDerWaalsContact C-N 3.34Å; E32-F34 PolarHBondContact O-N 3.04Å; E32-I35 PolarHBondContact O-N 3.21Å; E32-R36 WeakPolarHBondContact O-CB 3.13Å; E32-R36 PolarHBondContact O-N 3.2Å; E32-R36 IonicContact OE1-CZ 2.65Å; E32-R36 IonicContact OE1-NE 2.75Å; E32-R36 IonicContact OE1-NH2 3.96Å; E32-R36 PolarHBondContact OE1-NH2 2.86Å
33	W	74.1	Confident	76.4	Confident	181 Å²	181	108.3 Å²	108.3	69%	0.686	58%	0.579	S	S	*	*	H	α-helix	trans	-61.9	-41.5	175.1	-171.5	78.2	0	0	0	112.2	Y29 H30 L31 G37	Y29-W33 WeakPolarHBondContact O-CB 3.48Å; Y29-W33 PolarHBondContact O-N 3.26Å; H30-W33 PolarHBondContact O-N 2.65Å; L31-W33 VanDerWaalsContact C-N 3.32Å; W33-G37 PolarHBondContact O-N 2.95Å
34	F	78.7	Confident	74.5	Confident	172 Å²	172	107.8 Å²	107.8	75%	0.754	59%	0.591	S	S	*	*	H	α-helix	trans	-66.6	-40.6	177.5	-173.6	-99.6	0	0	0	113	H30 L31 E32	H30-F34 WeakPolarHBondContact O-CB 3.3Å; H30-F34 PolarHBondContact O-N 3.37Å; L31-F34 PolarHBondContact O-N 2.88Å; E32-F34 VanDerWaalsContact C-N 3.34Å; E32-F34 PolarHBondContact O-N 3.04Å
35	I	79.5	Confident	72.7	Confident	127 Å²	127	107.6 Å²	107.6	65%	0.651	58%	0.584	S	S	*	*	H	α-helix	trans	-75.7	-37.7	179	-67.1	170.9	0	0	0	111.3	L31 E32 G37	L31-I35 HydrophobicContact CD2-CD1 3.49Å; L31-I35 VanDerWaalsContact CD2-CD1 3.49Å; L31-I35 HydrophobicContact CG-CD1 4.02Å; L31-I35 WeakPolarHBondContact O-CB 3.35Å; L31-I35 VanDerWaalsContact O-CG1 3.31Å; L31-I35 WeakPolarHBondContact O-CG1 3.02Å; L31-I35 PolarHBondContact O-N 2.98Å; E32-I35 PolarHBondContact O-N 3.21Å; I35-G37 VanDerWaalsContact C-N 3.26Å; I35-G37 PolarHBondContact O-N 3.43Å
36	R	68.4	Low	71.4	Confident	128 Å²	128	112.9 Å²	112.9	48%	0.483	60%	0.597	S	S	.	*	H	α-helix	trans	-63.9	-32.9	-177.4	-172.5	176.4	-68.2	-102.3	1.7	111.6	E32 T39 T40	E32-R36 WeakPolarHBondContact O-CB 3.13Å; E32-R36 PolarHBondContact O-N 3.2Å; E32-R36 IonicContact OE1-CZ 2.65Å; E32-R36 IonicContact OE1-NE 2.75Å; E32-R36 IonicContact OE1-NH2 3.96Å; E32-R36 PolarHBondContact OE1-NH2 2.86Å; R36-T39 PolarHBondContact O-OG1 2.71Å; R36-T40 WeakPolarHBondContact CD-OG1 3.2Å; R36-T40 WeakPolarHBondContact CG-OG1 3.45Å
37	G	64.3	Low	70.5	Confident	40 Å²	40	116.4 Å²	116.4	41%	0.412	61%	0.605	S	S	.	*	G	3₁₀ helix	trans	54.4	178.8	174.8	0	0	0	0	0	113.9	W33 I35 T39	W33-G37 PolarHBondContact O-N 2.95Å; I35-G37 VanDerWaalsContact C-N 3.26Å; I35-G37 PolarHBondContact O-N 3.43Å; G37-T39 PolarHBondContact O-N 2.79Å
38	D	58.9	Low	69.9	Low	178 Å²	178	114.7 Å²	114.7	95%	0.952	60%	0.597	S	S	*	*	G	3₁₀ helix	trans	-60.5	7.9	-177.5	-72.4	-34.4	0	0	0	115.6
39	T	55.2	Low	69.6	Low	129 Å²	129	118.8 Å²	118.8	79%	0.791	61%	0.611	S	S	*	*	G	3₁₀ helix	trans	-84.9	-13.6	-172.8	59.5	0	0	0	0	114.9	R36 G37	R36-T39 PolarHBondContact O-OG1 2.71Å; G37-T39 PolarHBondContact O-N 2.79Å
40	T	55.3	Low	69.7	Low	75 Å²	75	115.3 Å²	115.3	46%	0.46	61%	0.605	S	S	.	*	S	Bend	trans	-119	113.9	169.2	16.2	0	0	0	0	108.4	R36 K42	R36-T40 WeakPolarHBondContact CD-OG1 3.2Å; R36-T40 WeakPolarHBondContact CG-OG1 3.45Å; T40-K42 PolarHBondContact O-N 2.75Å
41	L	54.5	Low	69.6	Low	114 Å²	114	114.1 Å²	114.1	60%	0.597	60%	0.6	S	S	*	*			trans	-32.7	125.8	162.1	-73	157.3	0	0	0	108.2
42	K	58.2	Low	69.6	Low	129 Å²	129	113.4 Å²	113.4	56%	0.561	60%	0.596	S	S	*	*			trans	-48.8	136.6	-178.4	-64.3	178.3	-167.7	127.3	0	107.8	T40 G44 E45	T40-K42 PolarHBondContact O-N 2.75Å; K42-G44 VanDerWaalsContact C-N 3.26Å; K42-G44 PolarHBondContact O-N 3.23Å; K42-E45 HydrophobicContact CB-CB 4.21Å; K42-E45 HydrophobicContact CB-CG 4.19Å; K42-E45 HydrophobicContact CD-CG 4.5Å; K42-E45 WeakPolarHBondContact CD-OE1 3.32Å; K42-E45 WeakPolarHBondContact CG-OE2 3.4Å; K42-E45 PolarHBondContact N-OE2 3.49Å; K42-E45 IonicContact NZ-OE1 3.72Å; K42-E45 PolarHBondContact NZ-OE1 2.82Å; K42-E45 IonicContact NZ-OE2 2.63Å; K42-E45 PolarHBondContact O-N 2.63Å
43	P	54.7	Low	70	Confident	143 Å²	143	115.8 Å²	115.8	93%	0.929	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.8	94.6	174.7	23	-28.9	0	0	0	107.9
44	G	56.1	Low	70.6	Confident	76 Å²	76	112.3 Å²	112.3	78%	0.784	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	134.9	-15.7	-167.3	0	0	0	0	0	115.8	K42	K42-G44 VanDerWaalsContact C-N 3.26Å; K42-G44 PolarHBondContact O-N 3.23Å
45	E	59.2	Low	71.1	Confident	93 Å²	93	106.6 Å²	106.6	44%	0.435	57%	0.57	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92	-4.5	173.2	-94.1	173	-178.9	0	0	113.3	K42 K47	K42-E45 HydrophobicContact CB-CB 4.21Å; K42-E45 HydrophobicContact CB-CG 4.19Å; K42-E45 HydrophobicContact CD-CG 4.5Å; K42-E45 WeakPolarHBondContact CD-OE1 3.32Å; K42-E45 WeakPolarHBondContact CG-OE2 3.4Å; K42-E45 PolarHBondContact N-OE2 3.49Å; K42-E45 IonicContact NZ-OE1 3.72Å; K42-E45 PolarHBondContact NZ-OE1 2.82Å; K42-E45 IonicContact NZ-OE2 2.63Å; K42-E45 PolarHBondContact O-N 2.63Å; E45-K47 VanDerWaalsContact C-N 3.26Å; E45-K47 PolarHBondContact O-N 3.41Å
46	E	66.5	Low	71.5	Confident	154 Å²	154	107.5 Å²	107.5	72%	0.72	57%	0.565	S	S	*	*	S	Bend	trans	-68.2	91.9	166.5	-66.6	-171.6	-179	0	0	108.1	S48	E46-S48 PolarHBondContact O-N 2.92Å
47	K	74.8	Confident	72.3	Confident	111 Å²	111	108.3 Å²	108.3	48%	0.483	57%	0.572	S	S	.	*			trans	-46	130.2	176.9	-73.3	-176	175.8	-173.1	0	109.4	E45 E51 L52 D55	E45-K47 VanDerWaalsContact C-N 3.26Å; E45-K47 PolarHBondContact O-N 3.41Å; K47-E51 WeakPolarHBondContact CA-OE2 3.17Å; K47-E51 HydrophobicContact CB-CB 4.29Å; K47-L52 HydrophobicContact CB-CD2 3.85Å; K47-L52 HydrophobicContact CB-CG 3.85Å; K47-L52 HydrophobicContact CD-CD2 3.99Å; K47-D55 WeakPolarHBondContact CD-OD2 3.28Å; K47-D55 IonicContact NZ-OD2 3.53Å; K47-D55 PolarHBondContact NZ-OD2 2.96Å
48	S	81.4	Confident	73.4	Confident	52 Å²	52	112.2 Å²	112.2	36%	0.364	58%	0.583	S	S	.	*			trans	-61.4	155.7	178.4	83.2	0	0	0	0	109.8	E46 V50 E51 L52	E46-S48 PolarHBondContact O-N 2.92Å; S48-V50 PolarHBondContact O-N 3.36Å; S48-V50 PolarHBondContact OG-N 2.73Å; S48-E51 PolarHBondContact N-OE2 2.87Å; S48-E51 PolarHBondContact O-N 2.82Å; S48-E51 WeakPolarHBondContact OG-CG 3.38Å; S48-E51 PolarHBondContact OG-N 3.4Å; S48-L52 PolarHBondContact O-N 3.33Å
49	I	83.1	Confident	74.8	Confident	119 Å²	119	110.8 Å²	110.8	61%	0.61	57%	0.57	S	S	*	*	H	α-helix	trans	-56.7	-28.9	177.5	-59.7	175.1	0	0	0	111.1	R53	I49-R53 WeakPolarHBondContact O-CD 3.47Å; I49-R53 WeakPolarHBondContact O-CG 3.34Å; I49-R53 PolarHBondContact O-N 3.07Å
50	V	88.4	Confident	76	Confident	82 Å²	82	109.8 Å²	109.8	50%	0.497	56%	0.557	S	S	.	*	H	α-helix	trans	-70.4	-48.9	176.4	179.1	0	0	0	0	110.6	S48 L52 R53 E54	S48-V50 PolarHBondContact O-N 3.36Å; S48-V50 PolarHBondContact OG-N 2.73Å; V50-L52 VanDerWaalsContact C-N 3.32Å; V50-L52 PolarHBondContact O-N 3.36Å; V50-R53 WeakPolarHBondContact O-CB 3.4Å; V50-R53 PolarHBondContact O-N 3.4Å; V50-E54 PolarHBondContact O-N 3.14Å
51	E	84.4	Confident	77.1	Confident	97 Å²	97	108.1 Å²	108.1	45%	0.453	55%	0.554	S	S	.	*	H	α-helix	trans	-59.5	-42.4	177.5	-69.3	166.7	-176.1	0	0	111.4	K47 S48 R53 E54 D55	K47-E51 WeakPolarHBondContact CA-OE2 3.17Å; K47-E51 HydrophobicContact CB-CB 4.29Å; S48-E51 PolarHBondContact N-OE2 2.87Å; S48-E51 PolarHBondContact O-N 2.82Å; S48-E51 WeakPolarHBondContact OG-CG 3.38Å; S48-E51 PolarHBondContact OG-N 3.4Å; E51-R53 VanDerWaalsContact C-N 3.26Å; E51-R53 PolarHBondContact O-N 3.1Å; E51-E54 PolarHBondContact O-N 3.39Å; E51-D55 PolarHBondContact O-N 3.41Å
52	L	86.4	Confident	78.2	Confident	86 Å²	86	107 Å²	107	45%	0.45	56%	0.562	S	S	.	*	H	α-helix	trans	-61.4	-33.2	175.1	-71.9	174.3	0	0	0	113.3	K47 S48 V50 R56	K47-L52 HydrophobicContact CB-CD2 3.85Å; K47-L52 HydrophobicContact CB-CG 3.85Å; K47-L52 HydrophobicContact CD-CD2 3.99Å; S48-L52 PolarHBondContact O-N 3.33Å; V50-L52 VanDerWaalsContact C-N 3.32Å; V50-L52 PolarHBondContact O-N 3.36Å; L52-R56 PolarHBondContact O-N 2.86Å
53	R	87.4	Confident	78.9	Confident	146 Å²	146	104.6 Å²	104.6	55%	0.551	57%	0.573	S	S	*	*	H	α-helix	trans	-75.6	-36.8	177	-73.1	167.7	-176.3	-177.7	3.5	111.4	I49 V50 E51 R56 K57	I49-R53 WeakPolarHBondContact O-CD 3.47Å; I49-R53 WeakPolarHBondContact O-CG 3.34Å; I49-R53 PolarHBondContact O-N 3.07Å; V50-R53 WeakPolarHBondContact O-CB 3.4Å; V50-R53 PolarHBondContact O-N 3.4Å; E51-R53 VanDerWaalsContact C-N 3.26Å; E51-R53 PolarHBondContact O-N 3.1Å; R53-R56 PolarHBondContact O-N 3.22Å; R53-K57 WeakPolarHBondContact O-CG 3.48Å; R53-K57 PolarHBondContact O-N 3.3Å
54	E	87.8	Confident	79.9	Confident	107 Å²	107	106.4 Å²	106.4	50%	0.5	56%	0.561	S	S	.	*	H	α-helix	trans	-66.8	-45.2	175.9	-71.3	179.1	177.4	0	0	110.8	V50 E51 R56 K57 L58	V50-E54 PolarHBondContact O-N 3.14Å; E51-E54 PolarHBondContact O-N 3.39Å; E54-R56 VanDerWaalsContact C-N 3.31Å; E54-R56 PolarHBondContact O-N 3.22Å; E54-K57 WeakPolarHBondContact O-CB 3.18Å; E54-K57 PolarHBondContact O-N 3.35Å; E54-K57 VanDerWaalsContact O-N 3.08Å; E54-L58 WeakPolarHBondContact O-CG 3.18Å; E54-L58 PolarHBondContact O-N 2.85Å
55	D	88.8	Confident	80.7	Confident	53 Å²	53	106.9 Å²	106.9	28%	0.283	55%	0.546	S	S	.	.	H	α-helix	trans	-55.7	-45.8	173.4	-74.4	-19.2	0	0	0	111.5	K47 E51 K57 L58 E59	K47-D55 WeakPolarHBondContact CD-OD2 3.28Å; K47-D55 IonicContact NZ-OD2 3.53Å; K47-D55 PolarHBondContact NZ-OD2 2.96Å; E51-D55 PolarHBondContact O-N 3.41Å; D55-K57 PolarHBondContact O-N 3.3Å; D55-L58 WeakPolarHBondContact O-CB 3.47Å; D55-L58 PolarHBondContact O-N 3.31Å; D55-L58 VanDerWaalsContact O-N 3.17Å; D55-E59 WeakPolarHBondContact O-CG 3.43Å; D55-E59 PolarHBondContact O-N 3.34Å
56	R	87.3	Confident	81.1	Confident	145 Å²	145	107.6 Å²	107.6	55%	0.547	56%	0.561	S	S	.	*	H	α-helix	trans	-61	-42.4	175.9	-168.9	-170.6	-55.3	158.5	3.5	112.4	L52 R53 E54 L58 E59 E60	L52-R56 PolarHBondContact O-N 2.86Å; R53-R56 PolarHBondContact O-N 3.22Å; E54-R56 VanDerWaalsContact C-N 3.31Å; E54-R56 PolarHBondContact O-N 3.22Å; R56-L58 VanDerWaalsContact C-N 3.3Å; R56-L58 PolarHBondContact O-N 3.08Å; R56-E59 PolarHBondContact O-N 3.04Å; R56-E60 WeakPolarHBondContact CG-OE1 3.3Å; R56-E60 WeakPolarHBondContact O-CB 3.48Å; R56-E60 VanDerWaalsContact O-CG 3.28Å; R56-E60 WeakPolarHBondContact O-CG 3.17Å; R56-E60 PolarHBondContact O-N 2.95Å
57	K	86.3	Confident	81.3	Confident	146 Å²	146	105.4 Å²	105.4	64%	0.635	56%	0.558	S	S	*	*	H	α-helix	trans	-64	-37.8	176.3	-74.1	175.9	-178.4	-179.8	0	111.7	R53 E54 D55 G61	R53-K57 WeakPolarHBondContact O-CG 3.48Å; R53-K57 PolarHBondContact O-N 3.3Å; E54-K57 WeakPolarHBondContact O-CB 3.18Å; E54-K57 PolarHBondContact O-N 3.35Å; E54-K57 VanDerWaalsContact O-N 3.08Å; D55-K57 PolarHBondContact O-N 3.3Å; K57-G61 PolarHBondContact O-N 2.94Å
58	L	86.4	Confident	81	Confident	122 Å²	122	107.6 Å²	107.6	64%	0.639	57%	0.57	S	S	*	*	H	α-helix	trans	-66.4	-44.2	176.3	-70.3	172.5	0	0	0	110.9	E54 D55 R56 G61 A62	E54-L58 WeakPolarHBondContact O-CG 3.18Å; E54-L58 PolarHBondContact O-N 2.85Å; D55-L58 WeakPolarHBondContact O-CB 3.47Å; D55-L58 PolarHBondContact O-N 3.31Å; D55-L58 VanDerWaalsContact O-N 3.17Å; R56-L58 VanDerWaalsContact C-N 3.3Å; R56-L58 PolarHBondContact O-N 3.08Å; L58-G61 CarbonylContact O-C 3.56Å; L58-G61 PolarHBondContact O-N 3.26Å; L58-G61 VanDerWaalsContact O-N 3.16Å; L58-A62 WeakPolarHBondContact O-CB 3.31Å; L58-A62 PolarHBondContact O-N 2.98Å
59	E	87.6	Confident	80.4	Confident	148 Å²	148	110.7 Å²	110.7	69%	0.692	59%	0.587	S	S	*	*	H	α-helix	trans	-60.8	-44.5	174.2	-73.3	-179.5	173.8	0	0	112.1	D55 R56 G61 A62	D55-E59 WeakPolarHBondContact O-CG 3.43Å; D55-E59 PolarHBondContact O-N 3.34Å; R56-E59 PolarHBondContact O-N 3.04Å; E59-G61 PolarHBondContact O-N 3.43Å; E59-A62 PolarHBondContact O-N 2.87Å
60	E	81.6	Confident	79.6	Confident	108 Å²	108	110.5 Å²	110.5	51%	0.505	59%	0.586	S	S	.	*	H	α-helix	trans	-65.3	-24.3	176.1	-73	174.2	-163.4	0	0	113.4	R56 R64	R56-E60 WeakPolarHBondContact CG-OE1 3.3Å; R56-E60 WeakPolarHBondContact O-CB 3.48Å; R56-E60 VanDerWaalsContact O-CG 3.28Å; R56-E60 WeakPolarHBondContact O-CG 3.17Å; R56-E60 PolarHBondContact O-N 2.95Å; E60-R64 PolarHBondContact O-NH1 3.44Å
61	G	77.8	Confident	78.6	Confident	39 Å²	39	110 Å²	110	40%	0.402	59%	0.586	S	S	.	*	H	α-helix	trans	-91	-26	177.8	0	0	0	0	0	114.2	K57 L58 E59 G63 R64	K57-G61 PolarHBondContact O-N 2.94Å; L58-G61 CarbonylContact O-C 3.56Å; L58-G61 PolarHBondContact O-N 3.26Å; L58-G61 VanDerWaalsContact O-N 3.16Å; E59-G61 PolarHBondContact O-N 3.43Å; G61-G63 PolarHBondContact O-N 3.22Å; G61-G63 VanDerWaalsContact O-N 3.07Å; G61-R64 PolarHBondContact O-N 3.36Å; G61-R64 VanDerWaalsContact O-N 3.07Å
62	A	78.9	Confident	77.8	Confident	92 Å²	92	112.1 Å²	112.1	76%	0.76	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.4	-17.7	-174.8	0	0	0	0	0	114.2	L58 E59	L58-A62 WeakPolarHBondContact O-CB 3.31Å; L58-A62 PolarHBondContact O-N 2.98Å; E59-A62 PolarHBondContact O-N 2.87Å
63	G	72.4	Confident	76.6	Confident	77 Å²	77	116.2 Å²	116.2	79%	0.794	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.8	3.8	176.5	0	0	0	0	0	115.3	G61	G61-G63 PolarHBondContact O-N 3.22Å; G61-G63 VanDerWaalsContact O-N 3.07Å
64	R	74.4	Confident	75.5	Confident	182 Å²	182	114.6 Å²	114.6	69%	0.687	61%	0.613	S	S	*	*	S	Bend	trans	-112.6	129.2	-179.2	-71.3	-175.2	173.7	113.4	-7.8	110.5	E60 G61 S66	E60-R64 PolarHBondContact O-NH1 3.44Å; G61-R64 PolarHBondContact O-N 3.36Å; G61-R64 VanDerWaalsContact O-N 3.07Å; R64-S66 PolarHBondContact O-N 2.95Å; R64-S66 VanDerWaalsContact O-N 3.12Å
65	D	74.6	Confident	74.1	Confident	86 Å²	86	115.1 Å²	115.1	46%	0.46	61%	0.614	S	S	.	*			trans	-70.8	105.6	170.8	-173.8	-3.9	0	0	0	109.2	T67 Q68	D65-T67 VanDerWaalsContact CG-OG1 3.3Å; D65-T67 PolarHBondContact O-N 2.83Å; D65-T67 WeakPolarHBondContact OD1-CB 3.31Å; D65-T67 PolarHBondContact OD1-N 3.49Å; D65-T67 PolarHBondContact OD1-OG1 3.41Å; D65-T67 PolarHBondContact OD2-OG1 2.93Å; D65-Q68 HydrophobicContact CB-CG 4.2Å; D65-Q68 PolarHBondContact O-N 3.22Å; D65-Q68 WeakPolarHBondContact OD2-CG 3.48Å; D65-Q68 PolarHBondContact OD2-NE2 2.88Å
66	S	67.3	Low	72.8	Confident	107 Å²	107	119.4 Å²	119.4	75%	0.748	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69	-8.4	-179.2	52.3	0	0	0	0	113.3	R64	R64-S66 PolarHBondContact O-N 2.95Å; R64-S66 VanDerWaalsContact O-N 3.12Å
67	T	70.6	Confident	71.5	Confident	108 Å²	108	120.8 Å²	120.8	66%	0.663	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.6	-14.7	177.9	71.4	0	0	0	0	113.3	D65 V69	D65-T67 VanDerWaalsContact CG-OG1 3.3Å; D65-T67 PolarHBondContact O-N 2.83Å; D65-T67 WeakPolarHBondContact OD1-CB 3.31Å; D65-T67 PolarHBondContact OD1-N 3.49Å; D65-T67 PolarHBondContact OD1-OG1 3.41Å; D65-T67 PolarHBondContact OD2-OG1 2.93Å; T67-V69 VanDerWaalsContact C-N 3.25Å; T67-V69 PolarHBondContact O-N 2.84Å
68	Q	67.8	Low	70.2	Confident	158 Å²	158	123 Å²	123	74%	0.738	66%	0.658	S	S	*	*			trans	-84.9	65.8	174.7	-66.8	-173.4	16.6	0	0	111.3	D65	D65-Q68 HydrophobicContact CB-CG 4.2Å; D65-Q68 PolarHBondContact O-N 3.22Å; D65-Q68 WeakPolarHBondContact OD2-CG 3.48Å; D65-Q68 PolarHBondContact OD2-NE2 2.88Å
69	V	68.4	Low	69.1	Low	117 Å²	117	121.4 Å²	121.4	71%	0.709	65%	0.654	S	S	*	*	P	Polyproline II helix	trans	-97.9	133.3	169.3	-69.2	0	0	0	0	109.4	T67 S71	T67-V69 VanDerWaalsContact C-N 3.25Å; T67-V69 PolarHBondContact O-N 2.84Å; V69-S71 PolarHBondContact O-N 3.29Å
70	L	66.6	Low	67.8	Low	115 Å²	115	119.7 Å²	119.7	60%	0.602	66%	0.655	S	S	*	*	P	Polyproline II helix	trans	-55.4	134.1	171.3	-68.7	173.2	0	0	0	109.1	L72	L70-L72 PolarHBondContact O-N 2.82Å
71	S	67.4	Low	67.1	Low	71 Å²	71	124.8 Å²	124.8	50%	0.497	67%	0.67	S	S	.	*	P	Polyproline II helix	trans	-56.2	131.6	-179.9	176.9	0	0	0	0	109.7	V69 K73 E74 K75	V69-S71 PolarHBondContact O-N 3.29Å; S71-K73 PolarHBondContact O-N 3.48Å; S71-K73 PolarHBondContact OG-N 2.9Å; S71-E74 WeakPolarHBondContact O-CB 3.48Å; S71-E74 PolarHBondContact O-N 3.32Å; S71-K75 PolarHBondContact O-N 3.44Å
72	L	67.1	Low	66.7	Low	142 Å²	142	125.5 Å²	125.5	74%	0.743	67%	0.672	S	S	*	*	H	α-helix	trans	-55.8	-22.3	176.6	-68.4	172.4	0	0	0	112.4	L70 L76	L70-L72 PolarHBondContact O-N 2.82Å; L72-L76 PolarHBondContact O-N 2.8Å
73	K	62.6	Low	65.9	Low	171 Å²	171	125.7 Å²	125.7	74%	0.743	67%	0.673	S	S	*	*	H	α-helix	trans	-67.5	-36.9	175.2	-149.7	177.7	-173.6	-121.6	0	112.5	S71 L76	S71-K73 PolarHBondContact O-N 3.48Å; S71-K73 PolarHBondContact OG-N 2.9Å; K73-L76 WeakPolarHBondContact O-CB 3.16Å; K73-L76 PolarHBondContact O-N 2.76Å
74	E	63.3	Low	65.3	Low	113 Å²	113	129.2 Å²	129.2	53%	0.528	67%	0.674	S	S	.	*	H	α-helix	trans	-75.4	-34	178.3	-164.8	175.9	-172	0	0	111.3	S71 L76 E77	S71-E74 WeakPolarHBondContact O-CB 3.48Å; S71-E74 PolarHBondContact O-N 3.32Å; E74-L76 VanDerWaalsContact C-N 3.29Å; E74-L76 PolarHBondContact O-N 3.25Å; E74-E77 PolarHBondContact O-N 2.87Å
75	K	59.8	Low	64.8	Low	117 Å²	117	124.2 Å²	124.2	51%	0.509	66%	0.66	S	S	.	*	H	α-helix	trans	-68.5	-23.9	172.5	-84	-173.8	177.7	-75.7	0	114	S71 E77 F78 T79	S71-K75 PolarHBondContact O-N 3.44Å; K75-E77 VanDerWaalsContact C-N 3.27Å; K75-E77 PolarHBondContact O-N 2.86Å; K75-F78 PolarHBondContact O-N 3.3Å; K75-T79 PolarHBondContact O-N 2.94Å; K75-T79 VanDerWaalsContact O-N 3.12Å; K75-T79 PolarHBondContact O-OG1 3.47Å
76	L	59.8	Low	64.3	Low	144 Å²	144	131.1 Å²	131.1	75%	0.754	68%	0.68	S	S	*	*	H	α-helix	trans	-69.2	-27.6	178.2	-131.3	119.3	0	0	0	112	L72 K73 E74	L72-L76 PolarHBondContact O-N 2.8Å; K73-L76 WeakPolarHBondContact O-CB 3.16Å; K73-L76 PolarHBondContact O-N 2.76Å; E74-L76 VanDerWaalsContact C-N 3.29Å; E74-L76 PolarHBondContact O-N 3.25Å
77	E	61.5	Low	64.1	Low	173 Å²	173	133.5 Å²	133.5	81%	0.808	68%	0.684	S	S	*	*	H	α-helix	trans	-75.7	-30.3	175.5	-64.7	-177.3	175.9	0	0	112.2	E74 K75	E74-E77 PolarHBondContact O-N 2.87Å; K75-E77 VanDerWaalsContact C-N 3.27Å; K75-E77 PolarHBondContact O-N 2.86Å
78	F	57.9	Low	63.8	Low	193 Å²	193	137.4 Å²	137.4	85%	0.846	69%	0.687	S	S	*	*	H	α-helix	trans	-95.9	-11.4	-174.5	-149.6	-92.8	0	0	0	114.3	K75	K75-F78 PolarHBondContact O-N 3.3Å
79	T	63.2	Low	63.7	Low	88 Å²	88	135.1 Å²	135.1	54%	0.54	69%	0.686	S	S	.	*	S	Bend	trans	-90.9	128.1	178.9	-50.3	0	0	0	0	109.5	K75 R81	K75-T79 PolarHBondContact O-N 2.94Å; K75-T79 VanDerWaalsContact O-N 3.12Å; K75-T79 PolarHBondContact O-OG1 3.47Å; T79-R81 PolarHBondContact O-N 3.36Å
80	P	61.3	Low	63.3	Low	112 Å²	112	137.8 Å²	137.8	73%	0.727	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-57.7	129.1	174.9	23.4	-31.9	0	0	0	109.2	A82	P80-A82 PolarHBondContact O-N 3.3Å
81	R	66.5	Low	62.8	Low	216 Å²	216	142 Å²	142	82%	0.815	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-46.8	120.1	-179	-73.1	-174.4	-179.7	-171.4	-2.4	109	T79	T79-R81 PolarHBondContact O-N 3.36Å
82	A	69.1	Low	61.6	Low	54 Å²	54	147.5 Å²	147.5	45%	0.446	74%	0.743	S	S	.	*	P	Polyproline II helix	trans	-61.8	145.9	179.3	0	0	0	0	0	108.8	P80 L84 D85	P80-A82 PolarHBondContact O-N 3.3Å; A82-L84 PolarHBondContact O-N 3.02Å; A82-D85 PolarHBondContact O-N 2.89Å
83	A	62.5	Low	61.4	Low	95 Å²	95	147.8 Å²	147.8	79%	0.785	74%	0.743	S	S	*	*	G	3₁₀ helix	trans	-55.3	-21.9	176.9	0	0	0	0	0	112.9	R86	A83-R86 WeakPolarHBondContact O-CB 3.42Å
84	L	60.2	Low	61.3	Low	152 Å²	152	146.6 Å²	146.6	80%	0.796	74%	0.743	S	S	*	*	G	3₁₀ helix	trans	-68.7	-29.2	175.3	-164.5	69.3	0	0	0	113.6	A82 R86	A82-L84 PolarHBondContact O-N 3.02Å; L84-R86 PolarHBondContact O-N 3.21Å
85	D	63.4	Low	61.2	Low	76 Å²	76	148.4 Å²	148.4	41%	0.406	75%	0.754	S	S	.	*	G	3₁₀ helix	trans	-75.4	-12.2	-179.7	-70.9	-41.6	0	0	0	112.8	A82 N87 R88	A82-D85 PolarHBondContact O-N 2.89Å; D85-N87 PolarHBondContact O-N 2.95Å; D85-R88 PolarHBondContact O-N 3.47Å
86	R	63.8	Low	61.3	Low	231 Å²	231	150.3 Å²	150.3	87%	0.872	77%	0.769	S	S	*	*	G	3₁₀ helix	trans	-63.1	-22.9	179.4	-161.6	176.7	-179.5	176.7	0.4	113.4	A83 L84	A83-R86 WeakPolarHBondContact O-CB 3.42Å; L84-R86 PolarHBondContact O-N 3.21Å
87	N	63	Low	61.4	Low	158 Å²	158	150.7 Å²	150.7	85%	0.845	77%	0.77	S	S	*	*	G	3₁₀ helix	trans	-107.6	4.2	-178.4	-99.3	-0.4	0	0	0	113.9	D85 P89	D85-N87 PolarHBondContact O-N 2.95Å; N87-P89 WeakPolarHBondContact O-CD 3.26Å
88	R	64.8	Low	61.3	Low	189 Å²	189	149.2 Å²	149.2	71%	0.713	77%	0.767	S	S	*	*			trans	-84.1	119.3	-179.2	-137.1	174.7	-179.5	146.2	-0.1	108.7	D85 E90	D85-R88 PolarHBondContact O-N 3.47Å; R88-E90 PolarHBondContact O-N 3.42Å
89	P	65.1	Low	61.6	Low	110 Å²	110	146.1 Å²	146.1	71%	0.714	76%	0.762	S	S	*	*			trans	-63.9	127	174.7	25.5	-31.7	0	0	0	108.5	N87 K91	N87-P89 WeakPolarHBondContact O-CD 3.26Å; P89-K91 PolarHBondContact O-N 3.27Å
90	E	59.7	Low	61.5	Low	173 Å²	173	150.5 Å²	150.5	81%	0.808	78%	0.779	S	S	*	*			trans	-59.5	112.7	171.8	-60.9	-158.4	176.7	0	0	107.4	R88 S92	R88-E90 PolarHBondContact O-N 3.42Å; E90-S92 PolarHBondContact O-N 3.25Å
91	K	57.7	Low	61.5	Low	204 Å²	204	153.8 Å²	153.8	89%	0.887	78%	0.783	S	S	*	*			trans	-71.8	120.7	174.6	-78	-174.4	175.4	-174.8	0	107.4	P89	P89-K91 PolarHBondContact O-N 3.27Å
92	S	42.2	Very low	61	Low	187 Å²	187	148.1 Å²	148.1	100%	1.308	78%	0.78	S	S	*	*			trans	-57	0	169.9	-176.7	0	0	0	0	112.7	E90	E90-S92 PolarHBondContact O-N 3.25Å

Retrieved 92 of 92 residues in 39.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).