A0A060Z3V6_ONCMY Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A060Z3V6, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 108 aa.

						>A0A060Z3V6_ONCMY|A0A060Z3V6
MASILLLFLAASCCACLCLADGDTSLEFETRALEFPHKSQEEKDLIEALQEVLEKLKNKQMPLSEKKLGWLPSCDAGEQCAVRKGARVGTLCGCPRGTTCNFYVLKCL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.1	Low	75.6	Confident	207 Å²	207	107.6 Å²	107.6	100%	1.02	61%	0.611	S	S	*	*				0	-45.9	0	-58.1	-125.9	-70.4	0	0	112.5	S3 I4 L5	M1-S3 PolarHBondContact O-N 3.15Å; M1-I4 PolarHBondContact O-N 3.13Å; M1-L5 PolarHBondContact O-N 3.26Å
2	A	64.6	Low	76.1	Confident	72 Å²	72	103.7 Å²	103.7	60%	0.595	60%	0.595	S	S	*	*	H	α-helix	trans	-61.3	-37.5	178.3	0	0	0	0	0	114.9	L5 L6	A2-L5 PolarHBondContact O-N 2.91Å; A2-L6 WeakPolarHBondContact O-CD1 3.04Å; A2-L6 PolarHBondContact O-N 2.99Å
3	S	72.4	Confident	76.2	Confident	87 Å²	87	101.2 Å²	101.2	61%	0.608	59%	0.586	S	S	*	*	H	α-helix	trans	-65.9	-39.2	179.6	-178.6	0	0	0	0	112.9	M1 L6 L7	M1-S3 PolarHBondContact O-N 3.15Å; S3-L6 PolarHBondContact O-N 3.48Å; S3-L7 WeakPolarHBondContact O-CG 3.44Å; S3-L7 PolarHBondContact O-N 3.47Å; S3-L7 VanDerWaalsContact O-N 3.14Å
4	I	78.1	Confident	76.2	Confident	102 Å²	102	99.3 Å²	99.3	52%	0.523	58%	0.58	S	S	.	*	H	α-helix	trans	-66.8	-41.3	177.9	-64.8	170.1	0	0	0	110.4	M1 L6 L7 F8	M1-I4 PolarHBondContact O-N 3.13Å; I4-L6 VanDerWaalsContact C-N 3.34Å; I4-L6 PolarHBondContact O-N 3.02Å; I4-L7 PolarHBondContact O-N 3.03Å; I4-F8 HydrophobicContact CG2-CD2 3.79Å; I4-F8 HydrophobicContact CG2-CE2 3.42Å; I4-F8 VanDerWaalsContact CG2-CE2 3.42Å; I4-F8 WeakPolarHBondContact O-CD2 3.07Å; I4-F8 PolarHBondContact O-N 3.3Å
5	L	74.9	Confident	76.3	Confident	112 Å²	112	96.1 Å²	96.1	59%	0.586	57%	0.57	S	S	*	*	H	α-helix	trans	-63.5	-40	176.7	-164	74.2	0	0	0	111.8	M1 A2 L7 F8 L9	M1-L5 PolarHBondContact O-N 3.26Å; A2-L5 PolarHBondContact O-N 2.91Å; L5-L7 VanDerWaalsContact C-N 3.33Å; L5-L7 PolarHBondContact O-N 3.4Å; L5-F8 PolarHBondContact O-N 3.1Å; L5-L9 HydrophobicContact CG-CD1 4.35Å; L5-L9 VanDerWaalsContact O-CG 3.29Å; L5-L9 WeakPolarHBondContact O-CG 3.41Å; L5-L9 PolarHBondContact O-N 3.38Å
6	L	77.3	Confident	76.2	Confident	122 Å²	122	95.4 Å²	95.4	64%	0.639	57%	0.57	S	S	*	*	H	α-helix	trans	-61.5	-40.4	175.5	-109.6	101.2	0	0	0	112.5	A2 S3 I4 L9 A10	A2-L6 WeakPolarHBondContact O-CD1 3.04Å; A2-L6 PolarHBondContact O-N 2.99Å; S3-L6 PolarHBondContact O-N 3.48Å; I4-L6 VanDerWaalsContact C-N 3.34Å; I4-L6 PolarHBondContact O-N 3.02Å; L6-L9 PolarHBondContact O-N 3.48Å; L6-A10 WeakPolarHBondContact O-CB 3.46Å; L6-A10 PolarHBondContact O-N 3.44Å
7	L	79.8	Confident	75.8	Confident	120 Å²	120	96.5 Å²	96.5	63%	0.628	57%	0.572	S	S	*	*	H	α-helix	trans	-65.4	-41.1	178.5	-69.1	172.5	0	0	0	111.8	S3 I4 L5 A10 A11	S3-L7 WeakPolarHBondContact O-CG 3.44Å; S3-L7 PolarHBondContact O-N 3.47Å; S3-L7 VanDerWaalsContact O-N 3.14Å; I4-L7 PolarHBondContact O-N 3.03Å; L5-L7 VanDerWaalsContact C-N 3.33Å; L5-L7 PolarHBondContact O-N 3.4Å; L7-A10 PolarHBondContact O-N 3.03Å; L7-A11 WeakPolarHBondContact O-CB 3.49Å; L7-A11 PolarHBondContact O-N 3.17Å
8	F	79.7	Confident	75.6	Confident	145 Å²	145	96.1 Å²	96.1	64%	0.636	57%	0.574	S	S	*	*	H	α-helix	trans	-66.2	-38.7	175.9	-75.8	-63	0	0	0	112.7	I4 L5 A11 S12	I4-F8 HydrophobicContact CG2-CD2 3.79Å; I4-F8 HydrophobicContact CG2-CE2 3.42Å; I4-F8 VanDerWaalsContact CG2-CE2 3.42Å; I4-F8 WeakPolarHBondContact O-CD2 3.07Å; I4-F8 PolarHBondContact O-N 3.3Å; L5-F8 PolarHBondContact O-N 3.1Å; F8-A11 PolarHBondContact O-N 3.34Å; F8-S12 WeakPolarHBondContact O-CB 3.46Å; F8-S12 PolarHBondContact O-N 3.15Å; F8-S12 PolarHBondContact O-OG 2.83Å
9	L	80.1	Confident	75	Confident	103 Å²	103	97.5 Å²	97.5	54%	0.539	58%	0.577	S	S	.	*	H	α-helix	trans	-68.7	-38.2	176.4	-69.2	171.8	0	0	0	112.3	L5 L6 S12 C13	L5-L9 HydrophobicContact CG-CD1 4.35Å; L5-L9 VanDerWaalsContact O-CG 3.29Å; L5-L9 WeakPolarHBondContact O-CG 3.41Å; L5-L9 PolarHBondContact O-N 3.38Å; L6-L9 PolarHBondContact O-N 3.48Å; L9-S12 PolarHBondContact O-OG 2.95Å; L9-S12 VanDerWaalsContact O-OG 3.08Å; L9-C13 WeakPolarHBondContact O-CB 3.46Å; L9-C13 PolarHBondContact O-N 3.28Å
10	A	81.3	Confident	74.4	Confident	53 Å²	53	95.7 Å²	95.7	44%	0.438	57%	0.574	S	S	.	*	H	α-helix	trans	-66.1	-44	174.4	0	0	0	0	0	111.1	L6 L7 C13 C14	L6-A10 WeakPolarHBondContact O-CB 3.46Å; L6-A10 PolarHBondContact O-N 3.44Å; L7-A10 PolarHBondContact O-N 3.03Å; A10-C13 PolarHBondContact O-N 3.37Å; A10-C14 WeakPolarHBondContact O-CB 3.2Å; A10-C14 PolarHBondContact O-N 3.48Å; A10-C14 PolarHBondContact O-SG 2.95Å
11	A	82.6	Confident	73.4	Confident	61 Å²	61	96 Å²	96	50%	0.504	57%	0.572	S	S	.	*	H	α-helix	trans	-64.3	-42.3	178.3	0	0	0	0	0	112.5	L7 F8 C14 A15	L7-A11 WeakPolarHBondContact O-CB 3.49Å; L7-A11 PolarHBondContact O-N 3.17Å; F8-A11 PolarHBondContact O-N 3.34Å; A11-C14 PolarHBondContact O-N 3.45Å; A11-A15 WeakPolarHBondContact O-CB 3.3Å; A11-A15 PolarHBondContact O-N 3.2Å
12	S	80.8	Confident	72.8	Confident	60 Å²	60	87.1 Å²	87.1	42%	0.42	53%	0.534	S	S	.	.	H	α-helix	trans	-67.9	-39.8	176.6	67.7	0	0	0	0	112.1	F8 L9 A15 C16	F8-S12 WeakPolarHBondContact O-CB 3.46Å; F8-S12 PolarHBondContact O-N 3.15Å; F8-S12 PolarHBondContact O-OG 2.83Å; L9-S12 PolarHBondContact O-OG 2.95Å; L9-S12 VanDerWaalsContact O-OG 3.08Å; S12-A15 PolarHBondContact O-N 3.27Å; S12-C16 PolarHBondContact O-N 2.61Å; S12-C16 PolarHBondContact O-SG 3.35Å
13	C	77.4	Confident	72.2	Confident	71 Å²	71	89.6 Å²	89.6	48%	0.48	54%	0.537	S	S	.	.	H	α-helix	trans	-62	-45.5	175.1	-170	0	0	0	0	111.6	L9 A10 A15 C16 L17	L9-C13 WeakPolarHBondContact O-CB 3.46Å; L9-C13 PolarHBondContact O-N 3.28Å; A10-C13 PolarHBondContact O-N 3.37Å; C13-A15 PolarHBondContact O-N 3.12Å; C13-C16 PolarHBondContact O-N 2.93Å; C13-L17 WeakPolarHBondContact O-CG 3.22Å; C13-L17 PolarHBondContact O-N 2.98Å
14	C	76.2	Confident	70.8	Confident	75 Å²	75	90.2 Å²	90.2	51%	0.507	54%	0.537	S	S	.	.	H	α-helix	trans	-61	-42.8	175	-71.2	0	0	0	0	111.9	A10 A11 C16 L17 C18	A10-C14 WeakPolarHBondContact O-CB 3.2Å; A10-C14 PolarHBondContact O-N 3.48Å; A10-C14 PolarHBondContact O-SG 2.95Å; A11-C14 PolarHBondContact O-N 3.45Å; C14-C16 PolarHBondContact O-N 3.39Å; C14-L17 PolarHBondContact O-N 3.46Å; C14-C18 PolarHBondContact O-N 3.14Å; C14-C18 PolarHBondContact O-SG 3.38Å
15	A	78.6	Confident	69	Low	51 Å²	51	88.4 Å²	88.4	42%	0.421	53%	0.534	S	S	.	.	H	α-helix	trans	-62.7	-41.8	176.6	0	0	0	0	0	112.4	A11 S12 C13 C18 L19	A11-A15 WeakPolarHBondContact O-CB 3.3Å; A11-A15 PolarHBondContact O-N 3.2Å; S12-A15 PolarHBondContact O-N 3.27Å; C13-A15 PolarHBondContact O-N 3.12Å; A15-C18 PolarHBondContact O-N 2.84Å; A15-L19 WeakPolarHBondContact O-CB 3.17Å; A15-L19 VanDerWaalsContact O-CG 3.29Å; A15-L19 WeakPolarHBondContact O-CG 3.36Å; A15-L19 PolarHBondContact O-N 3.33Å
16	C	73.9	Confident	67.3	Low	86 Å²	86	88.5 Å²	88.5	58%	0.581	53%	0.534	S	S	*	.	H	α-helix	trans	-63.8	-40.5	176.2	-69.1	0	0	0	0	112.5	S12 C13 C14 L19 A20	S12-C16 PolarHBondContact O-N 2.61Å; S12-C16 PolarHBondContact O-SG 3.35Å; C13-C16 PolarHBondContact O-N 2.93Å; C14-C16 PolarHBondContact O-N 3.39Å; C16-L19 PolarHBondContact O-N 2.97Å; C16-A20 WeakPolarHBondContact O-CB 3.3Å; C16-A20 PolarHBondContact O-N 2.77Å
17	L	70.6	Confident	65.6	Low	113 Å²	113	90.4 Å²	90.4	59%	0.592	54%	0.54	S	S	*	.	H	α-helix	trans	-66	-42	176.3	-69.9	168.5	0	0	0	111.3	C13 C14 L19 A20 D21	C13-L17 WeakPolarHBondContact O-CG 3.22Å; C13-L17 PolarHBondContact O-N 2.98Å; C14-L17 PolarHBondContact O-N 3.46Å; L17-L19 PolarHBondContact O-N 3.46Å; L17-A20 PolarHBondContact O-N 2.84Å; L17-D21 WeakPolarHBondContact O-CB 3.35Å; L17-D21 PolarHBondContact O-N 3.04Å
18	C	70.9	Confident	63.6	Low	90 Å²	90	93.5 Å²	93.5	61%	0.608	55%	0.549	S	S	*	.	H	α-helix	trans	-66.6	-35.1	177.1	-66.1	0	0	0	0	113	C14 A15 G22	C14-C18 PolarHBondContact O-N 3.14Å; C14-C18 PolarHBondContact O-SG 3.38Å; A15-C18 PolarHBondContact O-N 2.84Å; C18-G22 PolarHBondContact O-N 3.27Å
19	L	65	Low	61.6	Low	122 Å²	122	94.1 Å²	94.1	64%	0.639	55%	0.554	S	S	*	*	H	α-helix	trans	-71.2	-40.4	175.8	-71.1	169.9	0	0	0	111.6	A15 C16 L17 D21 G22 D23	A15-L19 WeakPolarHBondContact O-CB 3.17Å; A15-L19 VanDerWaalsContact O-CG 3.29Å; A15-L19 WeakPolarHBondContact O-CG 3.36Å; A15-L19 PolarHBondContact O-N 3.33Å; C16-L19 PolarHBondContact O-N 2.97Å; L17-L19 PolarHBondContact O-N 3.46Å; L19-D21 VanDerWaalsContact C-N 3.33Å; L19-D21 PolarHBondContact O-N 2.99Å; L19-G22 PolarHBondContact O-N 3.41Å; L19-D23 PolarHBondContact O-N 2.79Å
20	A	62.3	Low	59.5	Low	62 Å²	62	93.2 Å²	93.2	51%	0.512	55%	0.553	S	S	.	*	H	α-helix	trans	-66.4	-33.4	176.5	0	0	0	0	0	113	C16 L17	C16-A20 WeakPolarHBondContact O-CB 3.3Å; C16-A20 PolarHBondContact O-N 2.77Å; L17-A20 PolarHBondContact O-N 2.84Å
21	D	53.4	Low	57.3	Low	101 Å²	101	101.1 Å²	101.1	54%	0.54	57%	0.571	S	S	.	*	H	α-helix	trans	-77.8	-36.1	175.5	-153.6	-83.7	0	0	0	111.6	L17 L19 D23 T24 S25	L17-D21 WeakPolarHBondContact O-CB 3.35Å; L17-D21 PolarHBondContact O-N 3.04Å; L19-D21 VanDerWaalsContact C-N 3.33Å; L19-D21 PolarHBondContact O-N 2.99Å; D21-D23 VanDerWaalsContact C-N 3.33Å; D21-D23 PolarHBondContact O-N 3.48Å; D21-T24 PolarHBondContact O-N 3.29Å; D21-T24 PolarHBondContact O-OG1 2.95Å; D21-S25 PolarHBondContact O-N 3.11Å
22	G	49.3	Very low	55.2	Low	21 Å²	21	102.5 Å²	102.5	22%	0.216	58%	0.583	C	S	.	*	H	α-helix	trans	-60.9	-36	176.5	0	0	0	0	0	113.8	C18 L19 T24 L26	C18-G22 PolarHBondContact O-N 3.27Å; L19-G22 PolarHBondContact O-N 3.41Å; G22-T24 VanDerWaalsContact C-N 3.27Å; G22-T24 PolarHBondContact O-N 3.07Å; G22-L26 VanDerWaalsContact O-CB 3.25Å; G22-L26 WeakPolarHBondContact O-CB 3.49Å; G22-L26 PolarHBondContact O-N 3.03Å
23	D	50.9	Low	53.5	Low	124 Å²	124	105.8 Å²	105.8	66%	0.663	60%	0.595	S	S	*	*	H	α-helix	trans	-71.3	-21.6	175.6	-72	-31.4	0	0	0	112.7	L19 D21	L19-D23 PolarHBondContact O-N 2.79Å; D21-D23 VanDerWaalsContact C-N 3.33Å; D21-D23 PolarHBondContact O-N 3.48Å
24	T	42.9	Very low	51.9	Low	100 Å²	100	110.1 Å²	110.1	61%	0.613	61%	0.608	S	S	*	*	H	α-helix	trans	-95.4	-25	175.9	55.6	0	0	0	0	114.4	D21 G22	D21-T24 PolarHBondContact O-N 3.29Å; D21-T24 PolarHBondContact O-OG1 2.95Å; G22-T24 VanDerWaalsContact C-N 3.27Å; G22-T24 PolarHBondContact O-N 3.07Å
25	S	40.7	Very low	50.5	Low	64 Å²	64	113.5 Å²	113.5	45%	0.448	62%	0.615	S	S	.	*	H	α-helix	trans	-90.3	-32.4	178.1	-85.2	0	0	0	0	113.5	D21 F28 E29	D21-S25 PolarHBondContact O-N 3.11Å; S25-F28 PolarHBondContact O-N 3.46Å; S25-E29 PolarHBondContact O-N 3.08Å
26	L	40.4	Very low	49.1	Very low	114 Å²	114	116.8 Å²	116.8	60%	0.597	63%	0.631	S	S	*	*	H	α-helix	trans	-78.7	-18.1	-177.5	-77.5	166.3	0	0	0	114.8	G22 F28 T30	G22-L26 VanDerWaalsContact O-CB 3.25Å; G22-L26 WeakPolarHBondContact O-CB 3.49Å; G22-L26 PolarHBondContact O-N 3.03Å; L26-F28 VanDerWaalsContact C-N 3.35Å; L26-T30 PolarHBondContact O-OG1 3.38Å
27	E	41	Very low	48.2	Very low	163 Å²	163	121.4 Å²	121.4	76%	0.762	64%	0.644	S	S	*	*	H	α-helix	trans	-79.4	-19	171.9	-66.9	-145.7	122.4	0	0	112.8
28	F	36.9	Very low	47.2	Very low	184 Å²	184	119.1 Å²	119.1	81%	0.807	63%	0.629	S	S	*	*	H	α-helix	trans	-91.1	-31.4	177.7	-165.5	-103.9	0	0	0	112.8	S25 L26	S25-F28 PolarHBondContact O-N 3.46Å; L26-F28 VanDerWaalsContact C-N 3.35Å
29	E	37.8	Very low	47	Very low	159 Å²	159	117.3 Å²	117.3	74%	0.743	62%	0.618	S	S	*	*	H	α-helix	trans	-94.7	-4	-172	-156.3	161.4	114.5	0	0	114.9	S25	S25-E29 PolarHBondContact O-N 3.08Å
30	T	35.7	Very low	47.2	Very low	84 Å²	84	117.5 Å²	117.5	52%	0.515	62%	0.616	S	S	.	*	S	Bend	trans	-95	-7.3	178	45.3	0	0	0	0	114.7	L26	L26-T30 PolarHBondContact O-OG1 3.38Å
31	R	36.3	Very low	47.6	Very low	218 Å²	218	121.3 Å²	121.3	82%	0.823	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	4.7	174.1	-73.8	-170.7	-174.5	167.3	5.1	114.9	L33	R31-L33 PolarHBondContact O-N 3.33Å
32	A	39.1	Very low	48.6	Very low	91 Å²	91	120.9 Å²	120.9	75%	0.752	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.2	5.3	169.5	0	0	0	0	0	113	E34	A32-E34 PolarHBondContact O-N 2.91Å; A32-E34 VanDerWaalsContact O-N 3.14Å
33	L	44.3	Very low	50.1	Low	128 Å²	128	125.3 Å²	125.3	67%	0.67	63%	0.631	S	S	*	*	S	Bend	trans	-72	103.4	171.4	-76.6	171.8	0	0	0	110.2	R31	R31-L33 PolarHBondContact O-N 3.33Å
34	E	44.8	Very low	51.5	Low	163 Å²	163	123.1 Å²	123.1	76%	0.762	62%	0.619	S	S	*	*			trans	49.7	94.7	146.4	-58.3	-173.7	160.2	0	0	116.7	A32 P36	A32-E34 PolarHBondContact O-N 2.91Å; A32-E34 VanDerWaalsContact O-N 3.14Å; E34-P36 VanDerWaalsContact O-CD 3.22Å; E34-P36 WeakPolarHBondContact O-CD 3.31Å
35	F	46	Very low	53.6	Low	146 Å²	146	123.2 Å²	123.2	64%	0.64	62%	0.615	S	S	*	*			trans	-104.1	90.1	155.9	-76.3	-83.5	0	0	0	109.3	H37	F35-H37 PolarHBondContact O-N 3.06Å
36	P	49.5	Very low	55.9	Low	119 Å²	119	123 Å²	123	77%	0.773	61%	0.609	S	S	*	*			trans	-70.9	117.9	165.8	30.4	-28	0	0	0	107.3	E34	E34-P36 VanDerWaalsContact O-CD 3.22Å; E34-P36 WeakPolarHBondContact O-CD 3.31Å
37	H	53.8	Low	58.1	Low	184 Å²	184	123.9 Å²	123.9	85%	0.852	61%	0.609	S	S	*	*			trans	66.6	63.9	163.2	-130.4	-69.8	0	0	0	116.6	F35 S39	F35-H37 PolarHBondContact O-N 3.06Å; H37-S39 PolarHBondContact O-N 3.42Å
38	K	49.3	Very low	60.3	Low	64 Å²	64	118.6 Å²	118.6	28%	0.278	59%	0.594	S	S	.	*			trans	-53.8	119.6	161.3	-102.7	166.9	177.5	157.7	0	110.1	E42 K43 I46	K38-E42 WeakPolarHBondContact CA-OE2 3.49Å; K38-E42 HydrophobicContact CB-CB 4.29Å; K38-E42 HydrophobicContact CD-CB 4.45Å; K38-E42 HydrophobicContact CG-CB 3.79Å; K38-E42 WeakPolarHBondContact CG-OE2 3.34Å; K38-K43 HydrophobicContact CB-CG 4.15Å; K38-I46 HydrophobicContact CD-CD1 3.77Å
39	S	67.1	Low	62.9	Low	53 Å²	53	114.9 Å²	114.9	37%	0.371	58%	0.582	S	S	.	*			trans	-57.1	153.6	168.8	64	0	0	0	0	109.1	H37 E41 E42 K43	H37-S39 PolarHBondContact O-N 3.42Å; S39-E41 PolarHBondContact O-N 3.18Å; S39-E41 VanDerWaalsContact O-N 3.15Å; S39-E42 PolarHBondContact O-N 3.4Å; S39-E42 WeakPolarHBondContact OG-CG 3.32Å; S39-E42 PolarHBondContact OG-N 3.01Å; S39-K43 PolarHBondContact O-N 3.29Å
40	Q	69.9	Low	65.2	Low	126 Å²	126	113 Å²	113	59%	0.589	57%	0.573	S	S	*	*	H	α-helix	trans	-53.2	-37.5	179.7	-177.5	60.2	39.4	0	0	111.2	E42 K43 D44	Q40-E42 PolarHBondContact O-N 3.39Å; Q40-K43 WeakPolarHBondContact O-CB 3.44Å; Q40-K43 PolarHBondContact O-N 2.94Å; Q40-K43 VanDerWaalsContact O-N 3.15Å; Q40-D44 PolarHBondContact NE2-OD1 3.41Å; Q40-D44 VanDerWaalsContact O-CG 3.25Å; Q40-D44 PolarHBondContact O-N 3.02Å; Q40-D44 VanDerWaalsContact O-N 3.1Å
41	E	71.1	Confident	67.6	Low	141 Å²	141	114.1 Å²	114.1	66%	0.659	57%	0.572	S	S	*	*	H	α-helix	trans	-59.6	-42.9	177.2	-166.6	172.8	-173.5	0	0	112.8	S39 K43 D44 L45	S39-E41 PolarHBondContact O-N 3.18Å; S39-E41 VanDerWaalsContact O-N 3.15Å; E41-K43 VanDerWaalsContact C-N 3.28Å; E41-K43 PolarHBondContact O-N 2.91Å; E41-D44 PolarHBondContact O-N 3.47Å; E41-L45 HydrophobicContact CG-CD1 3.96Å; E41-L45 WeakPolarHBondContact O-CD1 3.3Å; E41-L45 PolarHBondContact O-N 3.01Å
42	E	74.4	Confident	70.1	Confident	92 Å²	92	107.6 Å²	107.6	43%	0.43	56%	0.557	S	S	.	*	H	α-helix	trans	-67.3	-28.2	177.8	-72	177.2	171.6	0	0	112.9	K38 S39 Q40 I46	K38-E42 WeakPolarHBondContact CA-OE2 3.49Å; K38-E42 HydrophobicContact CB-CB 4.29Å; K38-E42 HydrophobicContact CD-CB 4.45Å; K38-E42 HydrophobicContact CG-CB 3.79Å; K38-E42 WeakPolarHBondContact CG-OE2 3.34Å; S39-E42 PolarHBondContact O-N 3.4Å; S39-E42 WeakPolarHBondContact OG-CG 3.32Å; S39-E42 PolarHBondContact OG-N 3.01Å; Q40-E42 PolarHBondContact O-N 3.39Å; E42-I46 VanDerWaalsContact O-CD1 3.3Å; E42-I46 WeakPolarHBondContact O-CD1 3.37Å; E42-I46 WeakPolarHBondContact O-CG1 3.25Å; E42-I46 PolarHBondContact O-N 2.96Å
43	K	80.3	Confident	72.2	Confident	114 Å²	114	108.5 Å²	108.5	50%	0.496	55%	0.548	S	S	.	.	H	α-helix	trans	-71.8	-44.7	174.7	-64.5	-179.6	-179.2	176.3	0	111	K38 S39 Q40 E41 L45 I46 E47	K38-K43 HydrophobicContact CB-CG 4.15Å; S39-K43 PolarHBondContact O-N 3.29Å; Q40-K43 WeakPolarHBondContact O-CB 3.44Å; Q40-K43 PolarHBondContact O-N 2.94Å; Q40-K43 VanDerWaalsContact O-N 3.15Å; E41-K43 VanDerWaalsContact C-N 3.28Å; E41-K43 PolarHBondContact O-N 2.91Å; K43-L45 VanDerWaalsContact C-N 3.29Å; K43-L45 PolarHBondContact O-N 3.5Å; K43-I46 PolarHBondContact O-N 3.37Å; K43-I46 VanDerWaalsContact O-N 3.13Å; K43-E47 PolarHBondContact O-N 3.35Å
44	D	80.5	Confident	74	Confident	78 Å²	78	107 Å²	107	42%	0.417	54%	0.537	S	S	.	.	H	α-helix	trans	-62.5	-38.3	179.1	-58.7	-15.8	0	0	0	110.8	Q40 E41 E47 A48	Q40-D44 PolarHBondContact NE2-OD1 3.41Å; Q40-D44 VanDerWaalsContact O-CG 3.25Å; Q40-D44 PolarHBondContact O-N 3.02Å; Q40-D44 VanDerWaalsContact O-N 3.1Å; E41-D44 PolarHBondContact O-N 3.47Å; D44-E47 PolarHBondContact O-N 2.94Å; D44-A48 WeakPolarHBondContact O-CB 3.5Å; D44-A48 PolarHBondContact O-N 3.36Å
45	L	86.6	Confident	75.6	Confident	102 Å²	102	104.8 Å²	104.8	53%	0.534	53%	0.525	S	S	.	.	H	α-helix	trans	-63.7	-41	173.5	-92.2	93.6	0	0	0	113	E41 K43 A48 L49	E41-L45 HydrophobicContact CG-CD1 3.96Å; E41-L45 WeakPolarHBondContact O-CD1 3.3Å; E41-L45 PolarHBondContact O-N 3.01Å; K43-L45 VanDerWaalsContact C-N 3.29Å; K43-L45 PolarHBondContact O-N 3.5Å; L45-A48 PolarHBondContact O-N 3.47Å; L45-L49 WeakPolarHBondContact O-CB 3.42Å; L45-L49 WeakPolarHBondContact O-CG 3.44Å; L45-L49 PolarHBondContact O-N 2.97Å
46	I	89	Confident	76.8	Confident	61 Å²	61	102.6 Å²	102.6	31%	0.313	52%	0.52	S	S	.	.	H	α-helix	trans	-67.9	-39.6	179.7	-70.7	166	0	0	0	110.9	K38 E42 K43 L49 Q50	K38-I46 HydrophobicContact CD-CD1 3.77Å; E42-I46 VanDerWaalsContact O-CD1 3.3Å; E42-I46 WeakPolarHBondContact O-CD1 3.37Å; E42-I46 WeakPolarHBondContact O-CG1 3.25Å; E42-I46 PolarHBondContact O-N 2.96Å; K43-I46 PolarHBondContact O-N 3.37Å; K43-I46 VanDerWaalsContact O-N 3.13Å; I46-L49 PolarHBondContact O-N 3Å; I46-Q50 WeakPolarHBondContact O-CG 3.24Å; I46-Q50 PolarHBondContact O-N 3.3Å
47	E	87.3	Confident	77.7	Confident	131 Å²	131	102.2 Å²	102.2	61%	0.612	51%	0.506	S	S	*	.	H	α-helix	trans	-64	-45.1	176	-173.8	169.1	-167.5	0	0	111.2	K43 D44 L49 Q50 E51	K43-E47 PolarHBondContact O-N 3.35Å; D44-E47 PolarHBondContact O-N 2.94Å; E47-L49 VanDerWaalsContact C-N 3.32Å; E47-L49 PolarHBondContact O-N 3.28Å; E47-Q50 PolarHBondContact O-N 2.95Å; E47-E51 PolarHBondContact O-N 3.49Å
48	A	87.1	Confident	78	Confident	52 Å²	52	100 Å²	100	43%	0.43	50%	0.501	S	S	.	.	H	α-helix	trans	-60.7	-40.4	175	0	0	0	0	0	112.4	D44 L45 E51 V52	D44-A48 WeakPolarHBondContact O-CB 3.5Å; D44-A48 PolarHBondContact O-N 3.36Å; L45-A48 PolarHBondContact O-N 3.47Å; A48-E51 PolarHBondContact O-N 3.3Å; A48-V52 WeakPolarHBondContact O-CG2 3.45Å; A48-V52 PolarHBondContact O-N 3.41Å; A48-V52 VanDerWaalsContact O-N 3.12Å
49	L	90.4	Very high	78.6	Confident	107 Å²	107	104.6 Å²	104.6	56%	0.56	52%	0.52	S	S	*	.	H	α-helix	trans	-64.1	-42.6	175.1	-85.8	160.6	0	0	0	112.1	L45 I46 E47 V52 L53	L45-L49 WeakPolarHBondContact O-CB 3.42Å; L45-L49 WeakPolarHBondContact O-CG 3.44Å; L45-L49 PolarHBondContact O-N 2.97Å; I46-L49 PolarHBondContact O-N 3Å; E47-L49 VanDerWaalsContact C-N 3.32Å; E47-L49 PolarHBondContact O-N 3.28Å; L49-V52 PolarHBondContact O-N 3.06Å; L49-L53 WeakPolarHBondContact O-CB 3.29Å; L49-L53 VanDerWaalsContact O-CG 3.31Å; L49-L53 WeakPolarHBondContact O-CG 3.08Å; L49-L53 PolarHBondContact O-N 2.81Å
50	Q	87.6	Confident	78.1	Confident	120 Å²	120	107.8 Å²	107.8	56%	0.561	53%	0.53	S	S	*	.	H	α-helix	trans	-63.9	-40.5	177.1	-77.4	175.9	-17.9	0	0	111.9	I46 E47 V52 L53 E54	I46-Q50 WeakPolarHBondContact O-CG 3.24Å; I46-Q50 PolarHBondContact O-N 3.3Å; E47-Q50 PolarHBondContact O-N 2.95Å; Q50-V52 PolarHBondContact O-N 2.88Å; Q50-L53 PolarHBondContact O-N 3.2Å; Q50-E54 PolarHBondContact O-N 3.19Å
51	E	86.3	Confident	77.6	Confident	107 Å²	107	109.4 Å²	109.4	50%	0.5	54%	0.539	S	S	.	.	H	α-helix	trans	-62.7	-42.6	176.2	-169.9	-171.4	168.2	0	0	111.7	E47 A48 E54 K55	E47-E51 PolarHBondContact O-N 3.49Å; A48-E51 PolarHBondContact O-N 3.3Å; E51-E54 PolarHBondContact O-N 3.21Å; E51-K55 HydrophobicContact CG-CD 4.45Å; E51-K55 WeakPolarHBondContact O-CB 3.21Å; E51-K55 WeakPolarHBondContact O-CG 3.41Å; E51-K55 PolarHBondContact O-N 2.99Å; E51-K55 WeakPolarHBondContact OE1-CE 3.37Å; E51-K55 IonicContact OE1-NZ 2.61Å; E51-K55 PolarHBondContact OE1-NZ 3.26Å
52	V	88.8	Confident	76.8	Confident	81 Å²	81	106.9 Å²	106.9	49%	0.491	54%	0.535	S	S	.	.	H	α-helix	trans	-65.3	-40.9	176.2	173.7	0	0	0	0	111.1	A48 L49 Q50 K55 L56	A48-V52 WeakPolarHBondContact O-CG2 3.45Å; A48-V52 PolarHBondContact O-N 3.41Å; A48-V52 VanDerWaalsContact O-N 3.12Å; L49-V52 PolarHBondContact O-N 3.06Å; Q50-V52 PolarHBondContact O-N 2.88Å; V52-K55 PolarHBondContact O-N 3.39Å; V52-L56 HydrophobicContact CG1-CD1 3.84Å; V52-L56 HydrophobicContact CG1-CG 4.27Å; V52-L56 WeakPolarHBondContact O-CB 3.47Å; V52-L56 VanDerWaalsContact O-CG 3.3Å; V52-L56 WeakPolarHBondContact O-CG 3.46Å; V52-L56 PolarHBondContact O-N 2.92Å
53	L	83	Confident	76	Confident	109 Å²	109	109.5 Å²	109.5	57%	0.571	55%	0.551	S	S	*	*	H	α-helix	trans	-62.9	-43.4	176.7	-75.8	168.3	0	0	0	112.1	L49 Q50 L56 K57	L49-L53 WeakPolarHBondContact O-CB 3.29Å; L49-L53 VanDerWaalsContact O-CG 3.31Å; L49-L53 WeakPolarHBondContact O-CG 3.08Å; L49-L53 PolarHBondContact O-N 2.81Å; Q50-L53 PolarHBondContact O-N 3.2Å; L53-L56 PolarHBondContact O-N 2.92Å; L53-K57 VanDerWaalsContact O-CB 3.24Å; L53-K57 WeakPolarHBondContact O-CB 3.38Å; L53-K57 PolarHBondContact O-N 3.08Å
54	E	82	Confident	74.8	Confident	96 Å²	96	108.8 Å²	108.8	45%	0.449	56%	0.56	S	S	.	*	H	α-helix	trans	-66.9	-38.3	175.7	-78.1	-64.6	147.8	0	0	112	Q50 E51 L56 K57 N58	Q50-E54 PolarHBondContact O-N 3.19Å; E51-E54 PolarHBondContact O-N 3.21Å; E54-L56 VanDerWaalsContact C-N 3.34Å; E54-L56 PolarHBondContact O-N 3.49Å; E54-K57 PolarHBondContact O-N 3.26Å; E54-K57 IonicContact OE1-NZ 2.94Å; E54-K57 PolarHBondContact OE1-NZ 3.38Å; E54-K57 IonicContact OE2-NZ 3.29Å; E54-K57 PolarHBondContact OE2-NZ 3.03Å; E54-N58 PolarHBondContact O-N 3.47Å; E54-N58 VanDerWaalsContact O-N 3.07Å
55	K	77.6	Confident	73.6	Confident	117 Å²	117	113.3 Å²	113.3	51%	0.509	58%	0.579	S	S	.	*	H	α-helix	trans	-65.5	-35.5	172.7	-74.9	180	-176	170.4	0	112.7	E51 V52 K59	E51-K55 HydrophobicContact CG-CD 4.45Å; E51-K55 WeakPolarHBondContact O-CB 3.21Å; E51-K55 WeakPolarHBondContact O-CG 3.41Å; E51-K55 PolarHBondContact O-N 2.99Å; E51-K55 WeakPolarHBondContact OE1-CE 3.37Å; E51-K55 IonicContact OE1-NZ 2.61Å; E51-K55 PolarHBondContact OE1-NZ 3.26Å; V52-K55 PolarHBondContact O-N 3.39Å; K55-K59 VanDerWaalsContact O-CG 3.32Å; K55-K59 WeakPolarHBondContact O-CG 3.19Å; K55-K59 PolarHBondContact O-N 2.98Å
56	L	71.1	Confident	72.3	Confident	101 Å²	101	117.8 Å²	117.8	53%	0.529	59%	0.594	S	S	.	*	H	α-helix	trans	-75.7	-35	175.8	-75.9	173.5	0	0	0	112.4	V52 L53 E54 K59 Q60	V52-L56 HydrophobicContact CG1-CD1 3.84Å; V52-L56 HydrophobicContact CG1-CG 4.27Å; V52-L56 WeakPolarHBondContact O-CB 3.47Å; V52-L56 VanDerWaalsContact O-CG 3.3Å; V52-L56 WeakPolarHBondContact O-CG 3.46Å; V52-L56 PolarHBondContact O-N 2.92Å; L53-L56 PolarHBondContact O-N 2.92Å; E54-L56 VanDerWaalsContact C-N 3.34Å; E54-L56 PolarHBondContact O-N 3.49Å; L56-K59 CarbonylContact O-C 3.36Å; L56-K59 VanDerWaalsContact O-CA 3.3Å; L56-K59 WeakPolarHBondContact O-CA 3.38Å; L56-K59 WeakPolarHBondContact O-CB 3.35Å; L56-K59 PolarHBondContact O-N 2.94Å; L56-Q60 WeakPolarHBondContact O-CA 3.44Å; L56-Q60 PolarHBondContact O-N 2.93Å
57	K	68.1	Low	70.8	Confident	111 Å²	111	121 Å²	121	48%	0.483	61%	0.606	S	S	.	*	H	α-helix	trans	-63.1	-41.5	174.3	178.2	179.2	156.5	-158.5	0	111.8	L53 E54 K59 Q60	L53-K57 VanDerWaalsContact O-CB 3.24Å; L53-K57 WeakPolarHBondContact O-CB 3.38Å; L53-K57 PolarHBondContact O-N 3.08Å; E54-K57 PolarHBondContact O-N 3.26Å; E54-K57 IonicContact OE1-NZ 2.94Å; E54-K57 PolarHBondContact OE1-NZ 3.38Å; E54-K57 IonicContact OE2-NZ 3.29Å; E54-K57 PolarHBondContact OE2-NZ 3.03Å; K57-K59 PolarHBondContact O-N 3.47Å; K57-Q60 WeakPolarHBondContact O-CB 3.29Å; K57-Q60 PolarHBondContact O-N 3.35Å
58	N	61.6	Low	69.1	Low	138 Å²	138	123.8 Å²	123.8	74%	0.738	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.9	-16	171.1	-74.9	-25.5	0	0	0	113.4	E54	E54-N58 PolarHBondContact O-N 3.47Å; E54-N58 VanDerWaalsContact O-N 3.07Å
59	K	61.8	Low	68.2	Low	159 Å²	159	124.5 Å²	124.5	69%	0.691	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.3	10.1	171.8	-67.7	173.1	-178.3	-75	0	112.3	K55 L56 K57 M61	K55-K59 VanDerWaalsContact O-CG 3.32Å; K55-K59 WeakPolarHBondContact O-CG 3.19Å; K55-K59 PolarHBondContact O-N 2.98Å; L56-K59 CarbonylContact O-C 3.36Å; L56-K59 VanDerWaalsContact O-CA 3.3Å; L56-K59 WeakPolarHBondContact O-CA 3.38Å; L56-K59 WeakPolarHBondContact O-CB 3.35Å; L56-K59 PolarHBondContact O-N 2.94Å; K57-K59 PolarHBondContact O-N 3.47Å; K59-M61 PolarHBondContact O-N 3.17Å
60	Q	55.6	Low	67.5	Low	120 Å²	120	127 Å²	127	56%	0.561	64%	0.638	S	S	*	*			trans	-63.4	98.6	-169.5	-169.7	160.8	22.3	0	0	109.2	L56 K57	L56-Q60 WeakPolarHBondContact O-CA 3.44Å; L56-Q60 PolarHBondContact O-N 2.93Å; K57-Q60 WeakPolarHBondContact O-CB 3.29Å; K57-Q60 PolarHBondContact O-N 3.35Å
61	M	58.8	Low	67.3	Low	161 Å²	161	124.1 Å²	124.1	79%	0.793	63%	0.626	S	S	*	*			trans	-54.7	140.2	162.1	-100.4	-177.9	-89.4	0	0	107.7	K59 L63	K59-M61 PolarHBondContact O-N 3.17Å; M61-L63 PolarHBondContact O-N 3.22Å
62	P	54.6	Low	67.5	Low	87 Å²	87	122.2 Å²	122.2	57%	0.565	62%	0.623	S	S	*	*			trans	-55.3	119.5	-179.4	21.2	-30	0	0	0	109	S64	P62-S64 PolarHBondContact O-N 2.02Å; P62-S64 VanDerWaalsContact O-N 3.08Å
63	L	57.6	Low	67.6	Low	148 Å²	148	123.4 Å²	123.4	78%	0.775	64%	0.635	S	S	*	*	S	Bend	trans	-72	0.5	-170.4	-147.1	135.2	0	0	0	112.9	M61 E65	M61-L63 PolarHBondContact O-N 3.22Å; L63-E65 PolarHBondContact O-N 1.99Å
64	S	55.6	Low	68.2	Low	98 Å²	98	118.9 Å²	118.9	69%	0.685	61%	0.613	S	S	*	*	S	Bend	trans	-96.2	92.4	174.2	48.6	0	0	0	0	110.4	P62	P62-S64 PolarHBondContact O-N 2.02Å; P62-S64 VanDerWaalsContact O-N 3.08Å
65	E	55.5	Low	68.8	Low	174 Å²	174	119.6 Å²	119.6	81%	0.813	62%	0.619	S	S	*	*	S	Bend	trans	-4.8	122.3	159.9	-59.3	-178.6	138.5	0	0	116.3	L63	L63-E65 PolarHBondContact O-N 1.99Å
66	K	60.1	Low	69.5	Low	195 Å²	195	117.5 Å²	117.5	85%	0.848	62%	0.624	S	S	*	*			trans	76.1	96.6	165.5	-51.3	172.9	-173	174	0	116
67	K	55.7	Low	70.5	Confident	130 Å²	130	114.3 Å²	114.3	57%	0.565	62%	0.616	S	S	*	*			trans	-131.5	73	151.9	-81.8	-178.5	166.8	-155.3	0	112.2	G69 W70	K67-G69 PolarHBondContact O-N 2.85Å; K67-G69 VanDerWaalsContact O-N 3.11Å; K67-W70 HydrophobicContact CB-CB 3.66Å; K67-W70 HydrophobicContact CD-CB 3.58Å; K67-W70 HydrophobicContact CD-CG 3.68Å; K67-W70 HydrophobicContact CG-CB 4.24Å; K67-W70 PolarHBondContact O-N 2.76Å
68	L	53.1	Low	71.9	Confident	189 Å²	189	113.4 Å²	113.4	99%	0.99	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.5	112.5	138.2	-107.4	91.1	0	0	0	105.7
69	G	66.8	Low	73.5	Confident	66 Å²	66	111.7 Å²	111.7	68%	0.68	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	92.8	29.6	-177.7	0	0	0	0	0	115.8	K67 L71	K67-G69 PolarHBondContact O-N 2.85Å; K67-G69 VanDerWaalsContact O-N 3.11Å; G69-L71 PolarHBondContact O-N 2.9Å
70	W	75.7	Confident	75.2	Confident	160 Å²	160	104.1 Å²	104.1	61%	0.606	57%	0.568	S	S	*	*			trans	-64.3	118.1	161.4	-170.6	102.9	0	0	0	108	K67	K67-W70 HydrophobicContact CB-CB 3.66Å; K67-W70 HydrophobicContact CD-CB 3.58Å; K67-W70 HydrophobicContact CD-CG 3.68Å; K67-W70 HydrophobicContact CG-CB 4.24Å; K67-W70 PolarHBondContact O-N 2.76Å
71	L	84.4	Confident	77.1	Confident	59 Å²	59	98.4 Å²	98.4	31%	0.309	54%	0.541	S	S	.	.			trans	-119.1	147.3	173.2	-67.4	172.6	0	0	0	108.8	G69 T90	G69-L71 PolarHBondContact O-N 2.9Å; L71-T90 WeakPolarHBondContact CD1-OG1 3.38Å
72	P	90.1	Very high	78.9	Confident	67 Å²	67	93.6 Å²	93.6	44%	0.435	52%	0.521	S	S	.	.	P	Polyproline II helix	trans	-60.1	160.8	170.5	28.4	-35.5	0	0	0	110.4	L91 C92 G93	P72-L91 WeakPolarHBondContact CD-O 3.38Å; P72-C92 HydrophobicContact CG-CB 4.26Å; P72-C92 CarbonylContact O-C 3.47Å; P72-C92 WeakPolarHBondContact O-CA 3.41Å; P72-C92 WeakPolarHBondContact O-CB 3.49Å; P72-G93 PolarHBondContact O-N 3.47Å
73	S	91.8	Very high	80.8	Confident	107 Å²	107	97.1 Å²	97.1	75%	0.748	52%	0.523	S	S	*	.	B	Isolated β-bridge	trans	-81.7	144.1	172.3	50.2	0	0	0	0	111.1	G93	S73-G93 WeakPolarHBondContact CA-O 3.33Å
74	C	95.5	Very high	82.6	Confident	14 Å²	14	99 Å²	99	10%	0.095	53%	0.525	C	S	.	.	P	Polyproline II helix	trans	-99.3	166.5	166.7	-88.3	0	0	0	0	111.5	E78 C92 G93 P95	C74-E78 HydrophobicContact CB-CB 4.2Å; C74-C92 HydrophobicContact CB-CB 3.84Å; C74-C92 WeakPolarHBondContact CB-SG 3.26Å; C74-C92 WeakPolarHBondContact SG-CB 3.41Å; C74-C92 CovalentContact SG-SG 1.99Å; C74-C92 PolarHBondContact SG-SG 2.7Å; C74-G93 PolarHBondContact N-O 3.44Å; C74-P95 WeakPolarHBondContact O-CD 3.13Å
75	D	93.8	Very high	84.3	Confident	110 Å²	110	97.3 Å²	97.3	59%	0.588	52%	0.522	S	S	*	.	P	Polyproline II helix	trans	-85.8	164.2	165.1	-64.8	-35.8	0	0	0	111.9	G77 E78	D75-G77 PolarHBondContact O-N 3.46Å; D75-E78 HydrophobicContact CB-CG 3.87Å; D75-E78 PolarHBondContact N-OE2 3.48Å; D75-E78 WeakPolarHBondContact O-CB 3.33Å; D75-E78 PolarHBondContact O-N 3.28Å
76	A	92.9	Very high	86.1	Confident	73 Å²	73	93.8 Å²	93.8	60%	0.603	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.7	131.6	177.3	0	0	0	0	0	110.7	E78 T98	A76-E78 VanDerWaalsContact C-N 3.29Å; A76-E78 PolarHBondContact O-N 3.14Å; A76-T98 HydrophobicContact CB-CG2 4.4Å
77	G	92.5	Very high	87.8	Confident	35 Å²	35	94.5 Å²	94.5	36%	0.361	52%	0.52	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.3	-4.7	-176.9	0	0	0	0	0	115.7	D75 K106 C107	D75-G77 PolarHBondContact O-N 3.46Å; G77-K106 WeakPolarHBondContact O-CD 3.48Å; G77-C107 WeakPolarHBondContact CA-O 3.47Å; G77-C107 PolarHBondContact N-O 3.23Å
78	E	95.6	Very high	89.6	Confident	91 Å²	91	91.3 Å²	91.3	43%	0.425	51%	0.512	S	S	.	.	S	Bend	trans	-76.4	162.1	174.6	-70.4	-165	139.1	0	0	113	C74 D75 A76 C80 K106 C107	C74-E78 HydrophobicContact CB-CB 4.2Å; D75-E78 HydrophobicContact CB-CG 3.87Å; D75-E78 PolarHBondContact N-OE2 3.48Å; D75-E78 WeakPolarHBondContact O-CB 3.33Å; D75-E78 PolarHBondContact O-N 3.28Å; A76-E78 VanDerWaalsContact C-N 3.29Å; A76-E78 PolarHBondContact O-N 3.14Å; E78-C80 PolarHBondContact O-N 3.33Å; E78-K106 CarbonylContact O-C 3.57Å; E78-K106 WeakPolarHBondContact O-CA 3.47Å; E78-C107 PolarHBondContact O-N 3.45Å
79	Q	96.3	Very high	91.6	Very high	102 Å²	102	84 Å²	84	48%	0.477	48%	0.482	S	S	.	.	B	Isolated β-bridge	trans	-73.1	113.4	-179.9	-174.3	173.1	15.4	0	0	111.1	A81 L91 L105	Q79-A81 WeakPolarHBondContact CG-O 3.41Å; Q79-A81 PolarHBondContact NE2-O 3.06Å; Q79-L91 HydrophobicContact CG-CD1 4.47Å; Q79-L105 CarbonylContact C-O 3.48Å; Q79-L105 VanDerWaalsContact CA-O 3.26Å; Q79-L105 WeakPolarHBondContact CA-O 3.02Å; Q79-L105 WeakPolarHBondContact CG-O 3.43Å
80	C	96.8	Very high	92.8	Very high	0 Å²	0	84.3 Å²	84.3	0%	0	47%	0.471	C	S	.	.			trans	-100.3	-16.4	-174.9	60.5	0	0	0	0	114.8	E78 L91 C92 C100 L105 K106 C107	E78-C80 PolarHBondContact O-N 3.33Å; C80-L91 PolarHBondContact O-N 2.9Å; C80-C92 VanDerWaalsContact CA-SG 3.53Å; C80-C100 HydrophobicContact CB-CB 3.78Å; C80-C100 WeakPolarHBondContact CB-SG 3.11Å; C80-C100 WeakPolarHBondContact SG-CA 3.44Å; C80-C100 WeakPolarHBondContact SG-CB 3.38Å; C80-C100 CovalentContact SG-SG 2.02Å; C80-C100 PolarHBondContact SG-SG 2.94Å; C80-L105 PolarHBondContact N-O 2.9Å; C80-K106 PolarHBondContact SG-O 3.34Å; C80-C107 VanDerWaalsContact CB-SG 3.58Å
81	A	96.7	Very high	93.7	Very high	0 Å²	0	80.5 Å²	80.5	0%	0	46%	0.462	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.4	164	179.9	0	0	0	0	0	112	Q79 V88 G89 F102 L105	Q79-A81 WeakPolarHBondContact CG-O 3.41Å; Q79-A81 PolarHBondContact NE2-O 3.06Å; A81-V88 HydrophobicContact CB-CG1 3.97Å; A81-G89 CarbonylContact C-O 3.09Å; A81-G89 WeakPolarHBondContact CA-O 3.11Å; A81-G89 WeakPolarHBondContact CB-O 2.99Å; A81-F102 HydrophobicContact CB-CD1 3.84Å; A81-F102 HydrophobicContact CB-CE1 3.91Å; A81-L105 HydrophobicContact CB-CD2 3.94Å; A81-L105 WeakPolarHBondContact O-CB 3.07Å
82	V	95.4	Very high	94.1	Very high	60 Å²	60	78.1 Å²	78.1	36%	0.364	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.7	141.6	173.6	-71.4	0	0	0	0	109.7	V88 G89 L91	V82-V88 WeakPolarHBondContact O-CA 2.97Å; V82-G89 PolarHBondContact N-O 2.85Å; V82-G89 PolarHBondContact O-N 3.39Å; V82-L91 HydrophobicContact CG1-CD1 3.82Å; V82-L91 HydrophobicContact CG1-CD2 4.38Å; V82-L91 HydrophobicContact CG1-CG 4.26Å; V82-L91 HydrophobicContact CG2-CD2 4.11Å; V82-L91 HydrophobicContact CG2-CG 4.48Å
83	R	95.8	Very high	94.3	Very high	161 Å²	161	76.7 Å²	76.7	61%	0.608	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.9	126.7	178	-169.3	173	-178.9	168.8	2.2	109.9	G85 V88 L105	R83-G85 WeakPolarHBondContact CG-O 3.04Å; R83-G85 PolarHBondContact NE-O 3.39Å; R83-V88 HydrophobicContact CG-CG2 4.31Å; R83-L105 HydrophobicContact CB-CD1 4.33Å
84	K	94.6	Very high	94.5	Very high	188 Å²	188	73.1 Å²	73.1	82%	0.817	42%	0.422	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.6	96.7	172	-165.8	171	-177.3	175.3	0	108.4	A86 R87	K84-A86 PolarHBondContact O-N 3.33Å; K84-R87 PolarHBondContact N-O 3.41Å; K84-R87 PolarHBondContact O-N 3.41Å
85	G	92.4	Very high	94.4	Very high	62 Å²	62	74.7 Å²	74.7	64%	0.639	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.9	-124.4	-172.2	0	0	0	0	0	112.2	R83 R87	R83-G85 WeakPolarHBondContact CG-O 3.04Å; R83-G85 PolarHBondContact NE-O 3.39Å; G85-R87 VanDerWaalsContact C-N 3.34Å
86	A	93.1	Very high	94.3	Very high	100 Å²	100	81.7 Å²	81.7	83%	0.826	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.3	-10.6	177.1	0	0	0	0	0	113.9	K84	K84-A86 PolarHBondContact O-N 3.33Å
87	R	94.5	Very high	94.2	Very high	210 Å²	210	82.2 Å²	82.2	79%	0.792	46%	0.462	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.3	146	-176.7	-59.8	-174.7	-173.2	-157.2	1.9	111.1	K84 G85	K84-R87 PolarHBondContact N-O 3.41Å; K84-R87 PolarHBondContact O-N 3.41Å; G85-R87 VanDerWaalsContact C-N 3.34Å
88	V	94.7	Very high	94.3	Very high	64 Å²	64	82 Å²	82	39%	0.388	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	126.6	176.6	-178.2	0	0	0	0	108.6	A81 V82 R83 F102	A81-V88 HydrophobicContact CB-CG1 3.97Å; V82-V88 WeakPolarHBondContact O-CA 2.97Å; R83-V88 HydrophobicContact CG-CG2 4.31Å; V88-F102 HydrophobicContact CG1-CD1 3.42Å; V88-F102 VanDerWaalsContact CG1-CD1 3.42Å; V88-F102 HydrophobicContact CG1-CE1 3.78Å; V88-F102 HydrophobicContact CG1-CG 4.29Å
89	G	93.6	Very high	94.2	Very high	35 Å²	35	82.6 Å²	82.6	36%	0.361	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	132.6	174.2	0	0	0	0	0	110.4	A81 V82	A81-G89 CarbonylContact C-O 3.09Å; A81-G89 WeakPolarHBondContact CA-O 3.11Å; A81-G89 WeakPolarHBondContact CB-O 2.99Å; V82-G89 PolarHBondContact N-O 2.85Å; V82-G89 PolarHBondContact O-N 3.39Å
90	T	93.6	Very high	94.2	Very high	73 Å²	73	79.1 Å²	79.1	45%	0.448	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	137.1	175	43.6	0	0	0	0	110.5	L71 F102	L71-T90 WeakPolarHBondContact CD1-OG1 3.38Å; T90-F102 HydrophobicContact CG2-CE1 3.89Å; T90-F102 HydrophobicContact CG2-CZ 4.17Å
91	L	93	Very high	94.2	Very high	80 Å²	80	81.6 Å²	81.6	42%	0.419	46%	0.464	S	S	.	.			trans	-98.6	-37.4	-179.3	-63.6	-179.7	0	0	0	112.1	P72 Q79 C80 V82	P72-L91 WeakPolarHBondContact CD-O 3.38Å; Q79-L91 HydrophobicContact CG-CD1 4.47Å; C80-L91 PolarHBondContact O-N 2.9Å; V82-L91 HydrophobicContact CG1-CD1 3.82Å; V82-L91 HydrophobicContact CG1-CD2 4.38Å; V82-L91 HydrophobicContact CG1-CG 4.26Å; V82-L91 HydrophobicContact CG2-CD2 4.11Å; V82-L91 HydrophobicContact CG2-CG 4.48Å
92	C	94.1	Very high	94.1	Very high	9 Å²	9	86.4 Å²	86.4	6%	0.061	49%	0.485	C	S	.	.	S	Bend	trans	-151.8	164.8	-172.9	62	0	0	0	0	110.5	P72 C74 C80	P72-C92 HydrophobicContact CG-CB 4.26Å; P72-C92 CarbonylContact O-C 3.47Å; P72-C92 WeakPolarHBondContact O-CA 3.41Å; P72-C92 WeakPolarHBondContact O-CB 3.49Å; C74-C92 HydrophobicContact CB-CB 3.84Å; C74-C92 WeakPolarHBondContact CB-SG 3.26Å; C74-C92 WeakPolarHBondContact SG-CB 3.41Å; C74-C92 CovalentContact SG-SG 1.99Å; C74-C92 PolarHBondContact SG-SG 2.7Å; C80-C92 VanDerWaalsContact CA-SG 3.53Å
93	G	93.3	Very high	94	Very high	36 Å²	36	93.6 Å²	93.6	37%	0.371	51%	0.507	S	S	.	.	B	Isolated β-bridge	trans	-89.8	129.4	167.6	0	0	0	0	0	111.3	P72 S73 C74	P72-G93 PolarHBondContact O-N 3.47Å; S73-G93 WeakPolarHBondContact CA-O 3.33Å; C74-G93 PolarHBondContact N-O 3.44Å
94	C	95.4	Very high	94	Very high	33 Å²	33	89.9 Å²	89.9	22%	0.223	50%	0.502	C	S	.	.	P	Polyproline II helix	trans	-67.1	148.2	174.8	-65.6	0	0	0	0	111.7	T98 C100 C107	C94-T98 WeakPolarHBondContact CB-OG1 3.45Å; C94-C100 PolarHBondContact SG-N 3.49Å; C94-C100 VanDerWaalsContact SG-N 3.45Å; C94-C107 WeakPolarHBondContact CA-SG 3.37Å; C94-C107 HydrophobicContact CB-CB 3.78Å; C94-C107 WeakPolarHBondContact CB-SG 3.32Å; C94-C107 WeakPolarHBondContact SG-CA 3.33Å; C94-C107 WeakPolarHBondContact SG-CB 3.23Å; C94-C107 CovalentContact SG-SG 2.03Å; C94-C107 PolarHBondContact SG-SG 3.41Å
95	P	94.1	Very high	94.1	Very high	47 Å²	47	82.4 Å²	82.4	31%	0.305	47%	0.471	S	S	.	.	P	Polyproline II helix	trans	-67.4	159.2	178.1	29.1	-33.2	0	0	0	110.6	C74 G97 T98	C74-P95 WeakPolarHBondContact O-CD 3.13Å; P95-G97 PolarHBondContact O-N 3.1Å; P95-T98 VanDerWaalsContact CD-OG1 3.23Å; P95-T98 WeakPolarHBondContact CD-OG1 3.46Å; P95-T98 WeakPolarHBondContact CG-OG1 3.33Å; P95-T98 PolarHBondContact O-N 3.29Å; P95-T98 VanDerWaalsContact O-N 3.08Å; P95-T98 PolarHBondContact O-OG1 2.89Å
96	R	91.9	Very high	94.3	Very high	257 Å²	257	84.1 Å²	84.1	97%	0.97	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.3	133.5	-179.6	-68.3	-174.9	174.5	-177.2	-1.4	110.7
97	G	91.4	Very high	94.4	Very high	83 Å²	83	79.5 Å²	79.5	86%	0.856	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	92.2	-7.3	-178.7	0	0	0	0	0	114.7	P95	P95-G97 PolarHBondContact O-N 3.1Å
98	T	93.5	Very high	94.4	Very high	30 Å²	30	75.3 Å²	75.3	18%	0.184	42%	0.415	C	S	.	.			trans	-122.6	154.5	171.3	63.9	0	0	0	0	110.4	A76 C94 P95 L108	A76-T98 HydrophobicContact CB-CG2 4.4Å; C94-T98 WeakPolarHBondContact CB-OG1 3.45Å; P95-T98 VanDerWaalsContact CD-OG1 3.23Å; P95-T98 WeakPolarHBondContact CD-OG1 3.46Å; P95-T98 WeakPolarHBondContact CG-OG1 3.33Å; P95-T98 PolarHBondContact O-N 3.29Å; P95-T98 VanDerWaalsContact O-N 3.08Å; P95-T98 PolarHBondContact O-OG1 2.89Å; T98-L108 CarbonylContact C-O 3.47Å; T98-L108 VanDerWaalsContact CA-O 3.27Å; T98-L108 WeakPolarHBondContact CA-O 3.49Å; T98-L108 WeakPolarHBondContact CB-O 3.27Å
99	T	94.6	Very high	94.4	Very high	104 Å²	104	75.9 Å²	75.9	64%	0.638	42%	0.416	S	S	*	.			trans	-127	151.3	177.4	59.4	0	0	0	0	110.3	N101 C107 L108	T99-N101 PolarHBondContact O-N 3.43Å; T99-N101 VanDerWaalsContact O-N 3.16Å; T99-C107 WeakPolarHBondContact O-CA 3.46Å; T99-L108 PolarHBondContact N-O 3.4Å; T99-L108 PolarHBondContact O-N 3.5Å
100	C	95.8	Very high	94.5	Very high	29 Å²	29	78 Å²	78	20%	0.196	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	109.7	176.9	-173.3	0	0	0	0	109.7	C80 C94 F102	C80-C100 HydrophobicContact CB-CB 3.78Å; C80-C100 WeakPolarHBondContact CB-SG 3.11Å; C80-C100 WeakPolarHBondContact SG-CA 3.44Å; C80-C100 WeakPolarHBondContact SG-CB 3.38Å; C80-C100 CovalentContact SG-SG 2.02Å; C80-C100 PolarHBondContact SG-SG 2.94Å; C94-C100 PolarHBondContact SG-N 3.49Å; C94-C100 VanDerWaalsContact SG-N 3.45Å; C100-F102 PolarHBondContact O-N 3.02Å
101	N	96.5	Very high	94.5	Very high	52 Å²	52	78.3 Å²	78.3	28%	0.278	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80	113.1	174.5	-175.7	-50.5	0	0	0	109.4	T99 Y103 V104 L105 K106 L108	T99-N101 PolarHBondContact O-N 3.43Å; T99-N101 VanDerWaalsContact O-N 3.16Å; N101-Y103 VanDerWaalsContact C-N 3.27Å; N101-Y103 PolarHBondContact O-N 3.3Å; N101-Y103 WeakPolarHBondContact OD1-CA 3.3Å; N101-Y103 WeakPolarHBondContact OD1-CB 2.98Å; N101-Y103 PolarHBondContact OD1-N 2.97Å; N101-V104 PolarHBondContact O-N 3.16Å; N101-V104 PolarHBondContact OD1-N 3.45Å; N101-V104 VanDerWaalsContact OD1-N 3.1Å; N101-L105 WeakPolarHBondContact O-CA 3.18Å; N101-L105 PolarHBondContact O-N 2.74Å; N101-K106 PolarHBondContact N-O 3.08Å; N101-K106 PolarHBondContact O-N 2.03Å; N101-L108 HydrophobicContact CB-CD1 3.97Å; N101-L108 HydrophobicContact CB-CG 4.44Å
102	F	94.1	Very high	94.6	Very high	102 Å²	102	78.2 Å²	78.2	45%	0.447	42%	0.418	S	S	.	.	T	Hydrogen-bonded Turn	trans	-75.8	-6.4	-176.8	-64.4	-63.5	0	0	0	115.6	A81 V88 T90 C100 L105	A81-F102 HydrophobicContact CB-CD1 3.84Å; A81-F102 HydrophobicContact CB-CE1 3.91Å; V88-F102 HydrophobicContact CG1-CD1 3.42Å; V88-F102 VanDerWaalsContact CG1-CD1 3.42Å; V88-F102 HydrophobicContact CG1-CE1 3.78Å; V88-F102 HydrophobicContact CG1-CG 4.29Å; T90-F102 HydrophobicContact CG2-CE1 3.89Å; T90-F102 HydrophobicContact CG2-CZ 4.17Å; C100-F102 PolarHBondContact O-N 3.02Å; F102-L105 WeakPolarHBondContact O-CD2 3.05Å
103	Y	93.9	Very high	94.6	Very high	211 Å²	211	82.5 Å²	82.5	83%	0.827	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.3	-46.1	171.2	-62.5	-85.7	0	0	0	111.4	N101	N101-Y103 VanDerWaalsContact C-N 3.27Å; N101-Y103 PolarHBondContact O-N 3.3Å; N101-Y103 WeakPolarHBondContact OD1-CA 3.3Å; N101-Y103 WeakPolarHBondContact OD1-CB 2.98Å; N101-Y103 PolarHBondContact OD1-N 2.97Å
104	V	95.8	Very high	94.7	Very high	83 Å²	83	85.6 Å²	85.6	50%	0.503	45%	0.445	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.9	-16.4	179.9	-171.8	0	0	0	0	111.9	N101 K106 L108	N101-V104 PolarHBondContact O-N 3.16Å; N101-V104 PolarHBondContact OD1-N 3.45Å; N101-V104 VanDerWaalsContact OD1-N 3.1Å; V104-K106 HydrophobicContact CG1-CB 4.28Å; V104-K106 HydrophobicContact CG1-CD 4.15Å; V104-K106 HydrophobicContact CG1-CG 4.29Å; V104-K106 PolarHBondContact O-N 2.98Å; V104-L108 HydrophobicContact CG2-CD1 4.48Å
105	L	96.4	Very high	94.7	Very high	31 Å²	31	89.4 Å²	89.4	16%	0.162	46%	0.46	C	S	.	.	T	Hydrogen-bonded Turn	trans	62.4	25.2	-177.4	-56.1	175.6	0	0	0	114.1	Q79 C80 A81 R83 N101 F102	Q79-L105 CarbonylContact C-O 3.48Å; Q79-L105 VanDerWaalsContact CA-O 3.26Å; Q79-L105 WeakPolarHBondContact CA-O 3.02Å; Q79-L105 WeakPolarHBondContact CG-O 3.43Å; C80-L105 PolarHBondContact N-O 2.9Å; A81-L105 HydrophobicContact CB-CD2 3.94Å; A81-L105 WeakPolarHBondContact O-CB 3.07Å; R83-L105 HydrophobicContact CB-CD1 4.33Å; N101-L105 WeakPolarHBondContact O-CA 3.18Å; N101-L105 PolarHBondContact O-N 2.74Å; F102-L105 WeakPolarHBondContact O-CD2 3.05Å
106	K	96.6	Very high	94.7	Very high	98 Å²	98	92.6 Å²	92.6	43%	0.426	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	157.3	-176.5	-69.6	-179	172.6	-169.1	0	113	G77 E78 C80 N101 V104 L108	G77-K106 WeakPolarHBondContact O-CD 3.48Å; E78-K106 CarbonylContact O-C 3.57Å; E78-K106 WeakPolarHBondContact O-CA 3.47Å; C80-K106 PolarHBondContact SG-O 3.34Å; N101-K106 PolarHBondContact N-O 3.08Å; N101-K106 PolarHBondContact O-N 2.03Å; V104-K106 HydrophobicContact CG1-CB 4.28Å; V104-K106 HydrophobicContact CG1-CD 4.15Å; V104-K106 HydrophobicContact CG1-CG 4.29Å; V104-K106 PolarHBondContact O-N 2.98Å; K106-L108 PolarHBondContact O-N 2.94Å
107	C	96.4	Very high	95	Very high	2 Å²	2	78.9 Å²	78.9	1%	0.014	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.4	114.6	171.1	-64.8	0	0	0	0	110.6	G77 E78 C80 C94 T99	G77-C107 WeakPolarHBondContact CA-O 3.47Å; G77-C107 PolarHBondContact N-O 3.23Å; E78-C107 PolarHBondContact O-N 3.45Å; C80-C107 VanDerWaalsContact CB-SG 3.58Å; C94-C107 WeakPolarHBondContact CA-SG 3.37Å; C94-C107 HydrophobicContact CB-CB 3.78Å; C94-C107 WeakPolarHBondContact CB-SG 3.32Å; C94-C107 WeakPolarHBondContact SG-CA 3.33Å; C94-C107 WeakPolarHBondContact SG-CB 3.23Å; C94-C107 CovalentContact SG-SG 2.03Å; C94-C107 PolarHBondContact SG-SG 3.41Å; T99-C107 WeakPolarHBondContact O-CA 3.46Å
108	L	94.6	Very high	95.3	Very high	122 Å²	122	78.5 Å²	78.5	64%	0.639	39%	0.392	S	S	*	.			trans	-124.9	0	179	-62	178	0	0	0	111.3	T98 T99 N101 V104 K106	T98-L108 CarbonylContact C-O 3.47Å; T98-L108 VanDerWaalsContact CA-O 3.27Å; T98-L108 WeakPolarHBondContact CA-O 3.49Å; T98-L108 WeakPolarHBondContact CB-O 3.27Å; T99-L108 PolarHBondContact N-O 3.4Å; T99-L108 PolarHBondContact O-N 3.5Å; N101-L108 HydrophobicContact CB-CD1 3.97Å; N101-L108 HydrophobicContact CB-CG 4.44Å; V104-L108 HydrophobicContact CG2-CD1 4.48Å; K106-L108 PolarHBondContact O-N 2.94Å

Retrieved 108 of 108 residues in 92.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).