A0A060ZA86_ONCMY Loading...

Small integral membrane protein 18

AlphaFold DB , UniProt , Accession A0A060ZA86, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 102 aa.

						>A0A060ZA86_ONCMY|A0A060ZA86
MDRLNTTSLPWLPDAAPLSQVSLQVQEVYPFHDGWNIACFVILLLFIITVVSLAALAFLYELLDCGCCVKGKTHRDLMEEEGPFQNMVEKIHSPTGSQTEVV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.8	Very low	48.3	Very low	243 Å²	243	153.1 Å²	153.1	100%	1.197	79%	0.786	S	S	*	*				0	84.4	0	-87.1	158.5	146.4	0	0	107.4
2	D	43.3	Very low	48.4	Very low	148 Å²	148	150.8 Å²	150.8	79%	0.791	78%	0.776	S	S	*	*			trans	-63.9	141.3	176.7	-49	-92.1	0	0	0	110.9
3	R	38.1	Very low	48.4	Very low	222 Å²	222	148.5 Å²	148.5	84%	0.838	78%	0.776	S	S	*	*				170.1	111.4	105	-90.8	-164.9	171.6	-120.7	-0.3	110.9
4	L	63.3	Low	48.5	Very low	164 Å²	164	147.9 Å²	147.9	86%	0.859	77%	0.774	S	S	*	*			trans	-54.1	129.5	140.4	-78.5	121	0	0	0	108.3
5	N	42.6	Very low	49.1	Very low	120 Å²	120	144.3 Å²	144.3	64%	0.642	77%	0.774	S	S	*	*			trans	-147.1	91.9	148.1	-162.2	41.1	0	0	0	111.3	T7	N5-T7 PolarHBondContact ND2-OG1 3.4Å; N5-T7 PolarHBondContact O-N 3.38Å; N5-T7 PolarHBondContact OD1-OG1 3.39Å; N5-T7 VanDerWaalsContact OD1-OG1 3.12Å
6	T	52.2	Low	49	Very low	128 Å²	128	140.1 Å²	140.1	79%	0.785	77%	0.765	S	S	*	*			trans	-63.9	110.7	150.7	-61.5	0	0	0	0	108.1
7	T	43.6	Very low	48.9	Very low	95 Å²	95	136.6 Å²	136.6	58%	0.583	75%	0.751	S	S	*	*			trans	-150.6	89.7	156	-39.7	0	0	0	0	109.3	N5	N5-T7 PolarHBondContact ND2-OG1 3.4Å; N5-T7 PolarHBondContact O-N 3.38Å; N5-T7 PolarHBondContact OD1-OG1 3.39Å; N5-T7 VanDerWaalsContact OD1-OG1 3.12Å
8	S	55.5	Low	49	Very low	91 Å²	91	137.3 Å²	137.3	64%	0.636	75%	0.753	S	S	*	*			trans	34.2	117	136.4	59.1	0	0	0	0	118.8
9	L	49.2	Very low	48.9	Very low	160 Å²	160	134.3 Å²	134.3	84%	0.838	74%	0.743	S	S	*	*				-145.6	135.4	119.8	-96.5	172.6	0	0	0	110
10	P	47.3	Very low	48.9	Very low	108 Å²	108	133.7 Å²	133.7	70%	0.701	73%	0.734	S	S	*	*			trans	-115.9	81.6	-162.5	36.6	-21.1	0	0	0	112
11	W	51.2	Low	49.1	Very low	205 Å²	205	131.9 Å²	131.9	78%	0.777	73%	0.727	S	S	*	*			trans	178.1	84.2	165.2	53	-76.4	0	0	0	111.9
12	L	49.1	Very low	49.3	Very low	126 Å²	126	123.7 Å²	123.7	66%	0.66	69%	0.693	S	S	*	*			trans	-164.6	108.2	140.2	-147.5	67.5	0	0	0	108	D14	L12-D14 PolarHBondContact O-N 3.04Å
13	P	48.8	Very low	49.6	Very low	120 Å²	120	121.5 Å²	121.5	78%	0.779	68%	0.681	S	S	*	*			trans	-70	91.4	160.1	-2.8	18.6	0	0	0	107.2	A15	P13-A15 PolarHBondContact O-N 3.32Å
14	D	49.4	Very low	50.2	Low	141 Å²	141	118.1 Å²	118.1	75%	0.754	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.2	122.2	163	-92.8	-52.4	0	0	0	108.8	L12	L12-D14 PolarHBondContact O-N 3.04Å
15	A	57.5	Low	49.7	Very low	94 Å²	94	116.4 Å²	116.4	78%	0.777	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	56.7	63.9	168.1	0	0	0	0	0	115.9	P13	P13-A15 PolarHBondContact O-N 3.32Å
16	A	48.7	Very low	49.9	Very low	76 Å²	76	118 Å²	118	63%	0.628	67%	0.674	S	S	*	*			trans	-53.7	135.6	148	0	0	0	0	0	108.8	L18	A16-L18 PolarHBondContact O-N 3.46Å
17	P	47	Very low	49.9	Very low	81 Å²	81	119.5 Å²	119.5	53%	0.526	67%	0.672	S	S	.	*			trans	-71	124.4	-161.5	29.3	-34.3	0	0	0	110	S19 Q20	P17-S19 PolarHBondContact O-N 3.24Å; P17-Q20 PolarHBondContact O-N 3.37Å
18	L	50.2	Low	50.5	Low	150 Å²	150	120.2 Å²	120.2	79%	0.785	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-7.6	166.9	-67.6	179.3	0	0	0	112.7	A16 Q20 V21	A16-L18 PolarHBondContact O-N 3.46Å; L18-Q20 VanDerWaalsContact C-N 3.27Å; L18-Q20 PolarHBondContact O-N 3.45Å; L18-V21 PolarHBondContact O-N 2.75Å
19	S	48.1	Very low	50.5	Low	79 Å²	79	122.2 Å²	122.2	55%	0.552	67%	0.671	S	S	*	*	H	α-helix	trans	-65	-21.9	166.9	165.6	0	0	0	0	114.1	P17 V21 S22 L23	P17-S19 PolarHBondContact O-N 3.24Å; S19-V21 VanDerWaalsContact C-N 3.31Å; S19-S22 WeakPolarHBondContact CA-OG 3.47Å; S19-S22 PolarHBondContact O-OG 2.96Å; S19-L23 PolarHBondContact O-N 3.32Å
20	Q	49	Very low	50.8	Low	123 Å²	123	119.5 Å²	119.5	58%	0.575	66%	0.663	S	S	*	*	H	α-helix	trans	-74.1	-26.1	176.8	-169.6	174.7	-36	0	0	111.8	P17 L18 Q24	P17-Q20 PolarHBondContact O-N 3.37Å; L18-Q20 VanDerWaalsContact C-N 3.27Å; L18-Q20 PolarHBondContact O-N 3.45Å; Q20-Q24 PolarHBondContact O-N 3.28Å
21	V	51.7	Low	51.1	Low	96 Å²	96	122 Å²	122	58%	0.582	66%	0.663	S	S	*	*	H	α-helix	trans	-82.9	-30.4	179.5	-165.8	0	0	0	0	111.2	L18 S19 L23 Q24	L18-V21 PolarHBondContact O-N 2.75Å; S19-V21 VanDerWaalsContact C-N 3.31Å; V21-L23 VanDerWaalsContact C-N 3.34Å; V21-Q24 PolarHBondContact O-N 3.37Å
22	S	49.9	Very low	51.3	Low	70 Å²	70	116.1 Å²	116.1	49%	0.49	64%	0.644	S	S	.	*	H	α-helix	trans	-73	-25.8	170.5	54.7	0	0	0	0	113.1	S19 V25 Q26	S19-S22 WeakPolarHBondContact CA-OG 3.47Å; S19-S22 PolarHBondContact O-OG 2.96Å; S22-V25 PolarHBondContact O-N 3.48Å; S22-Q26 PolarHBondContact O-N 3.08Å
23	L	48.6	Very low	51.9	Low	102 Å²	102	116.8 Å²	116.8	53%	0.534	65%	0.648	S	S	.	*	H	α-helix	trans	-72.1	-33	174.3	-151.7	175.1	0	0	0	111.4	S19 V21 V25 E27	S19-L23 PolarHBondContact O-N 3.32Å; V21-L23 VanDerWaalsContact C-N 3.34Å; L23-V25 VanDerWaalsContact C-N 3.27Å; L23-V25 PolarHBondContact O-N 3.47Å; L23-E27 HydrophobicContact CD2-CG 4.13Å; L23-E27 PolarHBondContact O-N 2.79Å
24	Q	50.9	Low	52.7	Low	151 Å²	151	113.8 Å²	113.8	71%	0.706	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.8	-10.9	174.5	-69.2	-168	16.6	0	0	114.7	Q20 V21	Q20-Q24 PolarHBondContact O-N 3.28Å; V21-Q24 PolarHBondContact O-N 3.37Å
25	V	52.7	Low	53.6	Low	128 Å²	128	115.4 Å²	115.4	78%	0.776	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.4	-16.9	177.4	155.8	0	0	0	0	112.7	S22 L23	S22-V25 PolarHBondContact O-N 3.48Å; L23-V25 VanDerWaalsContact C-N 3.27Å; L23-V25 PolarHBondContact O-N 3.47Å
26	Q	47.8	Very low	54.4	Low	153 Å²	153	115.3 Å²	115.3	72%	0.715	62%	0.621	S	S	*	*			trans	-127.6	31.2	-177.8	-152.9	178.2	-19	0	0	112.8	S22 V28	S22-Q26 PolarHBondContact O-N 3.08Å; Q26-V28 HydrophobicContact CG-CG2 3.84Å; Q26-V28 PolarHBondContact O-N 3.43Å
27	E	50.7	Low	56.1	Low	160 Å²	160	116.6 Å²	116.6	75%	0.748	62%	0.616	S	S	*	*			trans	-71.2	67.5	151.2	-82.7	-106.2	130.3	0	0	107.5	L23 Y29	L23-E27 HydrophobicContact CD2-CG 4.13Å; L23-E27 PolarHBondContact O-N 2.79Å; E27-Y29 PolarHBondContact O-N 3.48Å
28	V	57.6	Low	58.1	Low	110 Å²	110	115.1 Å²	115.1	67%	0.667	61%	0.611	S	S	*	*			trans	-63.1	95.4	168	170.4	0	0	0	0	105.5	Q26 P30	Q26-V28 HydrophobicContact CG-CG2 3.84Å; Q26-V28 PolarHBondContact O-N 3.43Å; V28-P30 WeakPolarHBondContact O-CD 2.94Å; V28-P30 VanDerWaalsContact O-N 3.08Å
29	Y	54.8	Low	59.7	Low	133 Å²	133	110.4 Å²	110.4	52%	0.522	59%	0.59	S	S	.	*			trans	-53.7	108.5	171.2	-172	-91.8	0	0	0	108.4	E27 F31 H32	E27-Y29 PolarHBondContact O-N 3.48Å; Y29-F31 HydrophobicContact CD1-CB 4.15Å; Y29-F31 HydrophobicContact CE1-CB 3.81Å; Y29-F31 PolarHBondContact O-N 2.93Å; Y29-H32 HydrophobicContact CD1-CB 3.64Å; Y29-H32 AromaticContact CD1-CD2 3.14Å; Y29-H32 WeakPolarHBondContact CD1-CD2 3.42Å; Y29-H32 AromaticContact CD1-CG 3.57Å; Y29-H32 HydrophobicContact CE1-CB 4.47Å; Y29-H32 AromaticContact CE1-CD2 3.76Å; Y29-H32 HydrophobicContact CG-CB 4.38Å; Y29-H32 AromaticContact CG-CD2 3.42Å; Y29-H32 VanDerWaalsContact CG-CD2 3.42Å; Y29-H32 PolarHBondContact O-N 3.49Å
30	P	56.2	Low	61.5	Low	103 Å²	103	112.4 Å²	112.4	67%	0.669	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.8	7.4	-167.3	27.9	-32.9	0	0	0	113.9	V28	V28-P30 WeakPolarHBondContact O-CD 2.94Å; V28-P30 VanDerWaalsContact O-N 3.08Å
31	F	52.4	Low	63.6	Low	161 Å²	161	109.6 Å²	109.6	71%	0.706	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126.5	20.1	179.1	-58.4	-72.5	0	0	0	113.2	Y29	Y29-F31 HydrophobicContact CD1-CB 4.15Å; Y29-F31 HydrophobicContact CE1-CB 3.81Å; Y29-F31 PolarHBondContact O-N 2.93Å
32	H	55.5	Low	65.6	Low	81 Å²	81	110.4 Å²	110.4	38%	0.375	58%	0.58	S	S	.	*	H	α-helix	trans	-88.5	-15.9	-172.5	-123	-57.3	0	0	0	113.9	Y29 N36	Y29-H32 HydrophobicContact CD1-CB 3.64Å; Y29-H32 AromaticContact CD1-CD2 3.14Å; Y29-H32 WeakPolarHBondContact CD1-CD2 3.42Å; Y29-H32 AromaticContact CD1-CG 3.57Å; Y29-H32 HydrophobicContact CE1-CB 4.47Å; Y29-H32 AromaticContact CE1-CD2 3.76Å; Y29-H32 HydrophobicContact CG-CB 4.38Å; Y29-H32 AromaticContact CG-CD2 3.42Å; Y29-H32 VanDerWaalsContact CG-CD2 3.42Å; Y29-H32 PolarHBondContact O-N 3.49Å; H32-N36 WeakPolarHBondContact O-CB 3.43Å; H32-N36 PolarHBondContact O-N 3.1Å
33	D	62.2	Low	67.6	Low	141 Å²	141	112.1 Å²	112.1	75%	0.754	58%	0.583	S	S	*	*	H	α-helix	trans	-71.3	-40.9	-173.2	-65.3	-35.7	0	0	0	112.7	I37	D33-I37 WeakPolarHBondContact O-CB 3.45Å; D33-I37 WeakPolarHBondContact O-CG1 3.07Å; D33-I37 PolarHBondContact O-N 3.3Å
34	G	66.1	Low	69.8	Low	56 Å²	56	111.1 Å²	111.1	58%	0.577	58%	0.578	S	S	*	*	H	α-helix	trans	-77.4	-40	176.3	0	0	0	0	0	113.3	A38	G34-A38 WeakPolarHBondContact O-CB 3.1Å; G34-A38 PolarHBondContact O-N 2.96Å
35	W	68.2	Low	71.9	Confident	176 Å²	176	108.6 Å²	108.6	67%	0.667	57%	0.569	S	S	*	*	H	α-helix	trans	-69.8	-41.3	-178.5	-173.5	-69.1	0	0	0	111.9	A38 C39	W35-A38 PolarHBondContact O-N 2.84Å; W35-C39 WeakPolarHBondContact O-CB 3.26Å; W35-C39 PolarHBondContact O-N 3.28Å; W35-C39 PolarHBondContact O-SG 3.44Å; W35-C39 VanDerWaalsContact O-SG 3.41Å
36	N	74.6	Confident	74	Confident	92 Å²	92	108.9 Å²	108.9	49%	0.492	56%	0.56	S	S	.	*	H	α-helix	trans	-65.3	-42.4	177.8	-172.6	-81.5	0	0	0	111.3	H32 C39 F40	H32-N36 WeakPolarHBondContact O-CB 3.43Å; H32-N36 PolarHBondContact O-N 3.1Å; N36-C39 WeakPolarHBondContact O-CB 3.44Å; N36-C39 PolarHBondContact O-N 2.77Å; N36-F40 WeakPolarHBondContact O-CB 3.44Å; N36-F40 PolarHBondContact O-N 2.73Å
37	I	84.8	Confident	76.4	Confident	103 Å²	103	106.4 Å²	106.4	53%	0.528	55%	0.55	S	S	.	*	H	α-helix	trans	-65.9	-42.6	175.7	-65	-63.6	0	0	0	111.3	D33 C39 F40 V41	D33-I37 WeakPolarHBondContact O-CB 3.45Å; D33-I37 WeakPolarHBondContact O-CG1 3.07Å; D33-I37 PolarHBondContact O-N 3.3Å; I37-C39 VanDerWaalsContact C-N 3.34Å; I37-C39 PolarHBondContact O-N 3.42Å; I37-F40 PolarHBondContact O-N 2.69Å; I37-V41 HydrophobicContact CG2-CG2 4.18Å; I37-V41 WeakPolarHBondContact O-CB 3.33Å; I37-V41 WeakPolarHBondContact O-CG2 3.23Å; I37-V41 PolarHBondContact O-N 3.25Å
38	A	88.1	Confident	78.6	Confident	49 Å²	49	102.9 Å²	102.9	41%	0.405	54%	0.536	S	S	.	.	H	α-helix	trans	-59.8	-45.1	174.4	0	0	0	0	0	111.5	G34 W35 F40 V41 I42	G34-A38 WeakPolarHBondContact O-CB 3.1Å; G34-A38 PolarHBondContact O-N 2.96Å; W35-A38 PolarHBondContact O-N 2.84Å; A38-F40 PolarHBondContact O-N 2.97Å; A38-V41 PolarHBondContact O-N 3.39Å; A38-I42 WeakPolarHBondContact O-CB 3.29Å; A38-I42 WeakPolarHBondContact O-CD1 3.47Å; A38-I42 WeakPolarHBondContact O-CG1 3.08Å; A38-I42 PolarHBondContact O-N 2.84Å
39	C	83.5	Confident	80.4	Confident	52 Å²	52	101 Å²	101	35%	0.351	53%	0.525	S	S	.	.	H	α-helix	trans	-59.2	-45.6	173.8	-77.6	0	0	0	0	111.9	W35 N36 I37 I42 L43	W35-C39 WeakPolarHBondContact O-CB 3.26Å; W35-C39 PolarHBondContact O-N 3.28Å; W35-C39 PolarHBondContact O-SG 3.44Å; W35-C39 VanDerWaalsContact O-SG 3.41Å; N36-C39 WeakPolarHBondContact O-CB 3.44Å; N36-C39 PolarHBondContact O-N 2.77Å; I37-C39 VanDerWaalsContact C-N 3.34Å; I37-C39 PolarHBondContact O-N 3.42Å; C39-I42 PolarHBondContact O-N 2.84Å; C39-L43 WeakPolarHBondContact O-CB 3.18Å; C39-L43 WeakPolarHBondContact O-CG 3.23Å; C39-L43 PolarHBondContact O-N 2.72Å
40	F	86.8	Confident	82.4	Confident	120 Å²	120	98.3 Å²	98.3	53%	0.526	52%	0.522	S	S	.	.	H	α-helix	trans	-62.1	-44.3	177.7	-178.8	-98.9	0	0	0	112	N36 I37 A38 L43 L44	N36-F40 WeakPolarHBondContact O-CB 3.44Å; N36-F40 PolarHBondContact O-N 2.73Å; I37-F40 PolarHBondContact O-N 2.69Å; A38-F40 PolarHBondContact O-N 2.97Å; F40-L43 PolarHBondContact O-N 2.82Å; F40-L44 HydrophobicContact CE1-CD2 4.2Å; F40-L44 WeakPolarHBondContact O-CB 3.14Å; F40-L44 PolarHBondContact O-N 2.84Å
41	V	92.5	Very high	84.4	Confident	65 Å²	65	97.7 Å²	97.7	39%	0.394	52%	0.516	S	S	.	.	H	α-helix	trans	-62.4	-44.6	177.1	171	0	0	0	0	110.7	I37 A38 L44 L45	I37-V41 HydrophobicContact CG2-CG2 4.18Å; I37-V41 WeakPolarHBondContact O-CB 3.33Å; I37-V41 WeakPolarHBondContact O-CG2 3.23Å; I37-V41 PolarHBondContact O-N 3.25Å; A38-V41 PolarHBondContact O-N 3.39Å; V41-L44 PolarHBondContact O-N 3.46Å; V41-L45 HydrophobicContact CG1-CD1 3.92Å; V41-L45 HydrophobicContact CG1-CG 4.27Å; V41-L45 VanDerWaalsContact O-CB 3.31Å; V41-L45 WeakPolarHBondContact O-CB 3.49Å; V41-L45 WeakPolarHBondContact O-CG 3.38Å; V41-L45 PolarHBondContact O-N 3.29Å
42	I	93.1	Very high	86.4	Confident	112 Å²	112	92.5 Å²	92.5	57%	0.574	50%	0.5	S	S	*	.	H	α-helix	trans	-63.2	-45.3	177.5	-67.3	161.9	0	0	0	110.9	A38 C39 L45 F46	A38-I42 WeakPolarHBondContact O-CB 3.29Å; A38-I42 WeakPolarHBondContact O-CD1 3.47Å; A38-I42 WeakPolarHBondContact O-CG1 3.08Å; A38-I42 PolarHBondContact O-N 2.84Å; C39-I42 PolarHBondContact O-N 2.84Å; I42-L45 PolarHBondContact O-N 3.29Å; I42-F46 WeakPolarHBondContact O-CB 3.43Å; I42-F46 PolarHBondContact O-N 3.1Å
43	L	91.8	Very high	88.3	Confident	107 Å²	107	93.9 Å²	93.9	56%	0.56	51%	0.509	S	S	*	.	H	α-helix	trans	-62.2	-43.7	176.9	-71.7	170.2	0	0	0	111.5	C39 F40 F46 I47	C39-L43 WeakPolarHBondContact O-CB 3.18Å; C39-L43 WeakPolarHBondContact O-CG 3.23Å; C39-L43 PolarHBondContact O-N 2.72Å; F40-L43 PolarHBondContact O-N 2.82Å; L43-F46 WeakPolarHBondContact O-CB 3.1Å; L43-F46 PolarHBondContact O-N 2.74Å; L43-I47 VanDerWaalsContact O-CG1 3.3Å; L43-I47 WeakPolarHBondContact O-CG1 3Å; L43-I47 PolarHBondContact O-N 3.31Å
44	L	95	Very high	89.8	Confident	80 Å²	80	89.2 Å²	89.2	42%	0.419	49%	0.49	S	S	.	.	H	α-helix	trans	-63.9	-47	177.7	-176.3	65.2	0	0	0	111.2	F40 V41 F46 I47 I48	F40-L44 HydrophobicContact CE1-CD2 4.2Å; F40-L44 WeakPolarHBondContact O-CB 3.14Å; F40-L44 PolarHBondContact O-N 2.84Å; V41-L44 PolarHBondContact O-N 3.46Å; L44-F46 VanDerWaalsContact C-N 3.28Å; L44-F46 PolarHBondContact O-N 3.38Å; L44-I47 PolarHBondContact O-N 3.28Å; L44-I48 HydrophobicContact CD1-CD1 4.32Å; L44-I48 HydrophobicContact CG-CD1 3.95Å; L44-I48 VanDerWaalsContact O-CG1 3.28Å; L44-I48 WeakPolarHBondContact O-CG1 3.18Å; L44-I48 PolarHBondContact O-N 2.75Å
45	L	96.3	Very high	91.1	Very high	99 Å²	99	88.5 Å²	88.5	52%	0.518	48%	0.479	S	S	.	.	H	α-helix	trans	-60.5	-39.1	175.5	-74.1	176.6	0	0	0	111.5	V41 I42 I48 T49	V41-L45 HydrophobicContact CG1-CD1 3.92Å; V41-L45 HydrophobicContact CG1-CG 4.27Å; V41-L45 VanDerWaalsContact O-CB 3.31Å; V41-L45 WeakPolarHBondContact O-CB 3.49Å; V41-L45 WeakPolarHBondContact O-CG 3.38Å; V41-L45 PolarHBondContact O-N 3.29Å; I42-L45 PolarHBondContact O-N 3.29Å; L45-I48 PolarHBondContact O-N 3.47Å; L45-T49 VanDerWaalsContact O-CB 3.23Å; L45-T49 WeakPolarHBondContact O-CB 3.33Å; L45-T49 PolarHBondContact O-N 2.78Å; L45-T49 PolarHBondContact O-OG1 3.41Å
46	F	96.8	Very high	92.2	Very high	134 Å²	134	85.4 Å²	85.4	59%	0.588	48%	0.475	S	S	*	.	H	α-helix	trans	-63.1	-47.3	176.5	177.8	-104	0	0	0	111.6	I42 L43 L44 I48 T49 V50	I42-F46 WeakPolarHBondContact O-CB 3.43Å; I42-F46 PolarHBondContact O-N 3.1Å; L43-F46 WeakPolarHBondContact O-CB 3.1Å; L43-F46 PolarHBondContact O-N 2.74Å; L44-F46 VanDerWaalsContact C-N 3.28Å; L44-F46 PolarHBondContact O-N 3.38Å; F46-I48 PolarHBondContact O-N 3.5Å; F46-T49 WeakPolarHBondContact O-CB 3.43Å; F46-T49 PolarHBondContact O-N 2.89Å; F46-V50 HydrophobicContact CD1-CG2 4.47Å; F46-V50 HydrophobicContact CD2-CG2 4.46Å; F46-V50 HydrophobicContact CE1-CG2 4.05Å; F46-V50 HydrophobicContact CE2-CG2 4.04Å; F46-V50 HydrophobicContact CZ-CG2 3.82Å; F46-V50 WeakPolarHBondContact O-CG2 3.14Å; F46-V50 PolarHBondContact O-N 3.37Å
47	I	96.9	Very high	92.9	Very high	101 Å²	101	84 Å²	84	52%	0.518	48%	0.476	S	S	.	.	H	α-helix	trans	-60.2	-48.5	176.6	-66.3	163	0	0	0	110.5	L43 L44 T49 V50 V51	L43-I47 VanDerWaalsContact O-CG1 3.3Å; L43-I47 WeakPolarHBondContact O-CG1 3Å; L43-I47 PolarHBondContact O-N 3.31Å; L44-I47 PolarHBondContact O-N 3.28Å; I47-T49 VanDerWaalsContact C-N 3.28Å; I47-T49 PolarHBondContact O-N 2.88Å; I47-V50 PolarHBondContact O-N 2.95Å; I47-V51 HydrophobicContact CG2-CG2 4.36Å; I47-V51 WeakPolarHBondContact O-CB 3.16Å; I47-V51 VanDerWaalsContact O-CG2 3.29Å; I47-V51 WeakPolarHBondContact O-CG2 3.41Å; I47-V51 PolarHBondContact O-N 2.66Å
48	I	96.6	Very high	93.1	Very high	85 Å²	85	86 Å²	86	44%	0.436	48%	0.482	S	S	.	.	H	α-helix	trans	-58.4	-44.9	176.8	-68	167	0	0	0	109.9	L44 L45 F46 V50 V51 S52	L44-I48 HydrophobicContact CD1-CD1 4.32Å; L44-I48 HydrophobicContact CG-CD1 3.95Å; L44-I48 VanDerWaalsContact O-CG1 3.28Å; L44-I48 WeakPolarHBondContact O-CG1 3.18Å; L44-I48 PolarHBondContact O-N 2.75Å; L45-I48 PolarHBondContact O-N 3.47Å; F46-I48 PolarHBondContact O-N 3.5Å; I48-V50 PolarHBondContact O-N 3.2Å; I48-V51 PolarHBondContact O-N 2.99Å; I48-S52 VanDerWaalsContact O-CB 3.24Å; I48-S52 WeakPolarHBondContact O-CB 3.15Å; I48-S52 PolarHBondContact O-N 3.48Å; I48-S52 PolarHBondContact O-OG 2.73Å
49	T	96.1	Very high	92.8	Very high	72 Å²	72	88.1 Å²	88.1	44%	0.442	49%	0.485	S	S	.	.	H	α-helix	trans	-59.6	-48.4	178.5	-60.3	0	0	0	0	111.1	L45 F46 I47 V51 S52 L53	L45-T49 VanDerWaalsContact O-CB 3.23Å; L45-T49 WeakPolarHBondContact O-CB 3.33Å; L45-T49 PolarHBondContact O-N 2.78Å; L45-T49 PolarHBondContact O-OG1 3.41Å; F46-T49 WeakPolarHBondContact O-CB 3.43Å; F46-T49 PolarHBondContact O-N 2.89Å; I47-T49 VanDerWaalsContact C-N 3.28Å; I47-T49 PolarHBondContact O-N 2.88Å; T49-V51 PolarHBondContact O-N 2.79Å; T49-S52 PolarHBondContact O-N 3.32Å; T49-L53 HydrophobicContact CG2-CD1 3.73Å; T49-L53 WeakPolarHBondContact O-CB 3.37Å; T49-L53 WeakPolarHBondContact O-CD1 3.2Å; T49-L53 PolarHBondContact O-N 2.87Å
50	V	97.8	Very high	92.8	Very high	75 Å²	75	93.6 Å²	93.6	46%	0.455	50%	0.5	S	S	.	.	H	α-helix	trans	-62.6	-44.8	178.1	172.4	0	0	0	0	111.2	F46 I47 I48 L53 A54	F46-V50 HydrophobicContact CD1-CG2 4.47Å; F46-V50 HydrophobicContact CD2-CG2 4.46Å; F46-V50 HydrophobicContact CE1-CG2 4.05Å; F46-V50 HydrophobicContact CE2-CG2 4.04Å; F46-V50 HydrophobicContact CZ-CG2 3.82Å; F46-V50 WeakPolarHBondContact O-CG2 3.14Å; F46-V50 PolarHBondContact O-N 3.37Å; I47-V50 PolarHBondContact O-N 2.95Å; I48-V50 PolarHBondContact O-N 3.2Å; V50-L53 PolarHBondContact O-N 3.43Å; V50-A54 WeakPolarHBondContact O-CB 3.2Å; V50-A54 PolarHBondContact O-N 2.91Å
51	V	97.2	Very high	92.4	Very high	91 Å²	91	93.3 Å²	93.3	55%	0.552	50%	0.5	S	S	*	.	H	α-helix	trans	-63.6	-42.8	177	171.2	0	0	0	0	110.9	I47 I48 T49 A54 A55	I47-V51 HydrophobicContact CG2-CG2 4.36Å; I47-V51 WeakPolarHBondContact O-CB 3.16Å; I47-V51 VanDerWaalsContact O-CG2 3.29Å; I47-V51 WeakPolarHBondContact O-CG2 3.41Å; I47-V51 PolarHBondContact O-N 2.66Å; I48-V51 PolarHBondContact O-N 2.99Å; T49-V51 PolarHBondContact O-N 2.79Å; V51-A54 PolarHBondContact O-N 3.37Å; V51-A55 VanDerWaalsContact O-CB 3.22Å; V51-A55 WeakPolarHBondContact O-CB 3.3Å; V51-A55 PolarHBondContact O-N 2.89Å
52	S	95.7	Very high	91.4	Very high	52 Å²	52	95.8 Å²	95.8	36%	0.364	51%	0.511	S	S	.	.	H	α-helix	trans	-64.7	-43	176.1	-68.1	0	0	0	0	111.5	I48 T49 A55 L56	I48-S52 VanDerWaalsContact O-CB 3.24Å; I48-S52 WeakPolarHBondContact O-CB 3.15Å; I48-S52 PolarHBondContact O-N 3.48Å; I48-S52 PolarHBondContact O-OG 2.73Å; T49-S52 PolarHBondContact O-N 3.32Å; S52-A55 PolarHBondContact O-N 3Å; S52-L56 WeakPolarHBondContact O-CB 3.35Å; S52-L56 WeakPolarHBondContact O-CD1 3.24Å; S52-L56 WeakPolarHBondContact O-CG 3.07Å; S52-L56 PolarHBondContact O-N 3.28Å
53	L	94.4	Very high	89.9	Confident	109 Å²	109	95.8 Å²	95.8	57%	0.571	51%	0.511	S	S	*	.	H	α-helix	trans	-63.9	-43	175.5	-96.2	71.9	0	0	0	111.3	T49 V50 L56 A57	T49-L53 HydrophobicContact CG2-CD1 3.73Å; T49-L53 WeakPolarHBondContact O-CB 3.37Å; T49-L53 WeakPolarHBondContact O-CD1 3.2Å; T49-L53 PolarHBondContact O-N 2.87Å; V50-L53 PolarHBondContact O-N 3.43Å; L53-L56 PolarHBondContact O-N 3.44Å; L53-A57 WeakPolarHBondContact O-CB 3.32Å; L53-A57 PolarHBondContact O-N 2.8Å
54	A	94.5	Very high	88.7	Confident	43 Å²	43	95.1 Å²	95.1	36%	0.355	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-50.2	175.3	0	0	0	0	0	110.9	V50 V51 L56 A57 F58	V50-A54 WeakPolarHBondContact O-CB 3.2Å; V50-A54 PolarHBondContact O-N 2.91Å; V51-A54 PolarHBondContact O-N 3.37Å; A54-L56 VanDerWaalsContact C-N 3.34Å; A54-L56 PolarHBondContact O-N 3.42Å; A54-A57 PolarHBondContact O-N 2.87Å; A54-F58 WeakPolarHBondContact O-CD2 3.22Å; A54-F58 PolarHBondContact O-N 3.36Å
55	A	93.3	Very high	87.1	Confident	42 Å²	42	94.8 Å²	94.8	35%	0.347	51%	0.512	S	S	.	.	H	α-helix	trans	-60.2	-42.6	177.2	0	0	0	0	0	111.8	V51 S52 F58 L59	V51-A55 VanDerWaalsContact O-CB 3.22Å; V51-A55 WeakPolarHBondContact O-CB 3.3Å; V51-A55 PolarHBondContact O-N 2.89Å; S52-A55 PolarHBondContact O-N 3Å; A55-F58 PolarHBondContact O-N 3.31Å; A55-L59 WeakPolarHBondContact O-CB 3.23Å; A55-L59 WeakPolarHBondContact O-CD1 3.39Å; A55-L59 VanDerWaalsContact O-CG 3.32Å; A55-L59 WeakPolarHBondContact O-CG 3.45Å; A55-L59 PolarHBondContact O-N 3.4Å
56	L	90.1	Very high	85.3	Confident	111 Å²	111	91.2 Å²	91.2	58%	0.581	50%	0.499	S	S	*	.	H	α-helix	trans	-64.1	-40.5	175.3	-78.5	165.9	0	0	0	111.6	S52 L53 A54 L59 Y60	S52-L56 WeakPolarHBondContact O-CB 3.35Å; S52-L56 WeakPolarHBondContact O-CD1 3.24Å; S52-L56 WeakPolarHBondContact O-CG 3.07Å; S52-L56 PolarHBondContact O-N 3.28Å; L53-L56 PolarHBondContact O-N 3.44Å; A54-L56 VanDerWaalsContact C-N 3.34Å; A54-L56 PolarHBondContact O-N 3.42Å; L56-L59 PolarHBondContact O-N 3.39Å; L56-Y60 WeakPolarHBondContact O-CA 3.34Å; L56-Y60 WeakPolarHBondContact O-CB 3.47Å; L56-Y60 PolarHBondContact O-N 2.83Å
57	A	89.6	Confident	83.3	Confident	63 Å²	63	89 Å²	89	52%	0.521	50%	0.499	S	S	.	.	H	α-helix	trans	-63.2	-45.1	175.5	0	0	0	0	0	111.1	L53 A54 Y60 E61	L53-A57 WeakPolarHBondContact O-CB 3.32Å; L53-A57 PolarHBondContact O-N 2.8Å; A54-A57 PolarHBondContact O-N 2.87Å; A57-Y60 PolarHBondContact O-N 3.46Å; A57-E61 WeakPolarHBondContact O-CB 3.49Å; A57-E61 PolarHBondContact O-N 3.34Å
58	F	88.5	Confident	81.3	Confident	145 Å²	145	88.4 Å²	88.4	64%	0.636	50%	0.503	S	S	*	.	H	α-helix	trans	-65.8	-44.3	175	-76.9	-67.1	0	0	0	112.8	A54 A55 Y60 E61 L62	A54-F58 WeakPolarHBondContact O-CD2 3.22Å; A54-F58 PolarHBondContact O-N 3.36Å; A55-F58 PolarHBondContact O-N 3.31Å; F58-Y60 VanDerWaalsContact C-N 3.32Å; F58-E61 PolarHBondContact O-N 3.45Å; F58-L62 VanDerWaalsContact O-CB 3.3Å; F58-L62 WeakPolarHBondContact O-CB 3.29Å; F58-L62 WeakPolarHBondContact O-CG 3.21Å; F58-L62 PolarHBondContact O-N 3.48Å
59	L	83.1	Confident	79.3	Confident	92 Å²	92	89.9 Å²	89.9	48%	0.482	52%	0.515	S	S	.	.	H	α-helix	trans	-64.8	-38.8	176.9	-82.2	156	0	0	0	110.7	A55 L56 L62 L63	A55-L59 WeakPolarHBondContact O-CB 3.23Å; A55-L59 WeakPolarHBondContact O-CD1 3.39Å; A55-L59 VanDerWaalsContact O-CG 3.32Å; A55-L59 WeakPolarHBondContact O-CG 3.45Å; A55-L59 PolarHBondContact O-N 3.4Å; L56-L59 PolarHBondContact O-N 3.39Å; L59-L62 CarbonylContact O-C 3.5Å; L59-L62 PolarHBondContact O-N 3.5Å; L59-L63 HydrophobicContact CB-CD1 4.34Å; L59-L63 HydrophobicContact CD2-CD1 4.16Å; L59-L63 VanDerWaalsContact O-CB 3.23Å; L59-L63 WeakPolarHBondContact O-CB 3.39Å; L59-L63 WeakPolarHBondContact O-CD1 3.18Å; L59-L63 PolarHBondContact O-N 3.21Å
60	Y	83.6	Confident	77.1	Confident	168 Å²	168	95 Å²	95	66%	0.659	53%	0.532	S	S	*	.	H	α-helix	trans	-65	-45	176.3	-171	-90.7	0	0	0	110.6	L56 A57 F58 L62 L63 D64	L56-Y60 WeakPolarHBondContact O-CA 3.34Å; L56-Y60 WeakPolarHBondContact O-CB 3.47Å; L56-Y60 PolarHBondContact O-N 2.83Å; A57-Y60 PolarHBondContact O-N 3.46Å; F58-Y60 VanDerWaalsContact C-N 3.32Å; Y60-L62 VanDerWaalsContact C-N 3.31Å; Y60-L62 PolarHBondContact O-N 2.9Å; Y60-L63 PolarHBondContact O-N 3.41Å; Y60-D64 WeakPolarHBondContact O-CB 3.28Å; Y60-D64 PolarHBondContact O-N 2.92Å
61	E	77.4	Confident	74.9	Confident	114 Å²	114	92.7 Å²	92.7	53%	0.533	52%	0.523	S	S	.	.	H	α-helix	trans	-61.3	-39.4	173.1	-167.8	72.5	94.8	0	0	111.9	A57 F58 C65	A57-E61 WeakPolarHBondContact O-CB 3.49Å; A57-E61 PolarHBondContact O-N 3.34Å; F58-E61 PolarHBondContact O-N 3.45Å; E61-C65 WeakPolarHBondContact O-CB 3.3Å; E61-C65 PolarHBondContact O-N 3.21Å; E61-C65 PolarHBondContact O-SG 3.34Å
62	L	71.1	Confident	72.6	Confident	117 Å²	117	95.2 Å²	95.2	61%	0.613	53%	0.526	S	S	*	.	H	α-helix	trans	-75.3	-27.7	177	-72.7	171.3	0	0	0	113.7	F58 L59 Y60 G66	F58-L62 VanDerWaalsContact O-CB 3.3Å; F58-L62 WeakPolarHBondContact O-CB 3.29Å; F58-L62 WeakPolarHBondContact O-CG 3.21Å; F58-L62 PolarHBondContact O-N 3.48Å; L59-L62 CarbonylContact O-C 3.5Å; L59-L62 PolarHBondContact O-N 3.5Å; Y60-L62 VanDerWaalsContact C-N 3.31Å; Y60-L62 PolarHBondContact O-N 2.9Å; L62-G66 WeakPolarHBondContact O-CA 3.45Å; L62-G66 PolarHBondContact O-N 2.82Å
63	L	62.1	Low	70.6	Confident	111 Å²	111	97.2 Å²	97.2	58%	0.581	54%	0.537	S	S	*	.	H	α-helix	trans	-79.8	-37.6	174	-94	74.1	0	0	0	110.1	L59 Y60 G66 C67	L59-L63 HydrophobicContact CB-CD1 4.34Å; L59-L63 HydrophobicContact CD2-CD1 4.16Å; L59-L63 VanDerWaalsContact O-CB 3.23Å; L59-L63 WeakPolarHBondContact O-CB 3.39Å; L59-L63 WeakPolarHBondContact O-CD1 3.18Å; L59-L63 PolarHBondContact O-N 3.21Å; Y60-L63 PolarHBondContact O-N 3.41Å; L63-G66 CarbonylContact O-C 3.47Å; L63-G66 WeakPolarHBondContact O-CA 3.31Å; L63-G66 PolarHBondContact O-N 3.37Å; L63-G66 VanDerWaalsContact O-N 3.1Å; L63-C67 PolarHBondContact O-N 2.81Å
64	D	66.4	Low	68.5	Low	94 Å²	94	97.9 Å²	97.9	50%	0.503	54%	0.536	S	S	.	.	H	α-helix	trans	-66.5	-45	173.1	-161.2	25	0	0	0	110.3	Y60 G66 C67	Y60-D64 WeakPolarHBondContact O-CB 3.28Å; Y60-D64 PolarHBondContact O-N 2.92Å; D64-G66 VanDerWaalsContact C-N 3.28Å; D64-G66 PolarHBondContact O-N 3.41Å; D64-C67 WeakPolarHBondContact O-CB 3.43Å; D64-C67 PolarHBondContact O-N 2.84Å
65	C	62.1	Low	66.3	Low	73 Å²	73	103.3 Å²	103.3	49%	0.493	55%	0.548	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.6	-25.5	166.1	-71.7	0	0	0	0	113	E61 C67 C68	E61-C65 WeakPolarHBondContact O-CB 3.3Å; E61-C65 PolarHBondContact O-N 3.21Å; E61-C65 PolarHBondContact O-SG 3.34Å; C65-C67 VanDerWaalsContact C-N 3.3Å; C65-C67 PolarHBondContact O-N 2.92Å; C65-C68 WeakPolarHBondContact O-CA 3.35Å; C65-C68 WeakPolarHBondContact O-CB 3.2Å; C65-C68 PolarHBondContact O-N 3.49Å
66	G	57.5	Low	64.1	Low	24 Å²	24	106.1 Å²	106.1	25%	0.247	56%	0.557	C	S	.	*	H	α-helix	trans	-72.7	-23.2	-179.8	0	0	0	0	0	112.7	L62 L63 D64 C68 V69 K70	L62-G66 WeakPolarHBondContact O-CA 3.45Å; L62-G66 PolarHBondContact O-N 2.82Å; L63-G66 CarbonylContact O-C 3.47Å; L63-G66 WeakPolarHBondContact O-CA 3.31Å; L63-G66 PolarHBondContact O-N 3.37Å; L63-G66 VanDerWaalsContact O-N 3.1Å; D64-G66 VanDerWaalsContact C-N 3.28Å; D64-G66 PolarHBondContact O-N 3.41Å; G66-C68 PolarHBondContact O-N 2.84Å; G66-V69 PolarHBondContact O-N 2.92Å; G66-V69 VanDerWaalsContact O-N 3.1Å; G66-K70 PolarHBondContact O-N 2.93Å
67	C	56	Low	62.3	Low	87 Å²	87	106.7 Å²	106.7	59%	0.588	56%	0.56	S	S	*	*	H	α-helix	trans	-59.8	-24.1	163.4	-73.2	0	0	0	0	112	L63 D64 C65 G71	L63-C67 PolarHBondContact O-N 2.81Å; D64-C67 WeakPolarHBondContact O-CB 3.43Å; D64-C67 PolarHBondContact O-N 2.84Å; C65-C67 VanDerWaalsContact C-N 3.3Å; C65-C67 PolarHBondContact O-N 2.92Å; C67-G71 VanDerWaalsContact O-CA 3.29Å; C67-G71 WeakPolarHBondContact O-CA 3.5Å; C67-G71 PolarHBondContact O-N 3.26Å
68	C	53.9	Low	60.3	Low	89 Å²	89	109 Å²	109	60%	0.601	56%	0.561	S	S	*	*	H	α-helix	trans	-77.3	-26.5	173.5	-56.9	0	0	0	0	113.1	C65 G66	C65-C68 WeakPolarHBondContact O-CA 3.35Å; C65-C68 WeakPolarHBondContact O-CB 3.2Å; C65-C68 PolarHBondContact O-N 3.49Å; G66-C68 PolarHBondContact O-N 2.84Å
69	V	54.3	Low	58.2	Low	115 Å²	115	107.8 Å²	107.8	70%	0.697	56%	0.557	S	S	*	*	H	α-helix	trans	-88.3	-41.2	175.1	148.4	0	0	0	0	111.6	G66 G71 K72	G66-V69 PolarHBondContact O-N 2.92Å; G66-V69 VanDerWaalsContact O-N 3.1Å; V69-G71 VanDerWaalsContact C-N 3.31Å; V69-K72 PolarHBondContact O-N 2.85Å
70	K	50.8	Low	56.2	Low	181 Å²	181	110.9 Å²	110.9	79%	0.787	57%	0.57	S	S	*	*	H	α-helix	trans	-83.8	-4.9	175.1	-166.4	147.7	-178.8	169.9	0	113.5	G66	G66-K70 PolarHBondContact O-N 2.93Å
71	G	51.7	Low	54.3	Low	26 Å²	26	108.8 Å²	108.8	27%	0.268	57%	0.566	S	S	.	*	S	Bend	trans	-88.8	-17.2	162.7	0	0	0	0	0	112.8	C67 V69 T73 H74 R75	C67-G71 VanDerWaalsContact O-CA 3.29Å; C67-G71 WeakPolarHBondContact O-CA 3.5Å; C67-G71 PolarHBondContact O-N 3.26Å; V69-G71 VanDerWaalsContact C-N 3.31Å; G71-T73 VanDerWaalsContact C-N 3.29Å; G71-T73 PolarHBondContact O-N 3.36Å; G71-H74 PolarHBondContact O-N 3.37Å; G71-R75 WeakPolarHBondContact O-CA 3.39Å; G71-R75 WeakPolarHBondContact O-CB 3.21Å; G71-R75 PolarHBondContact O-N 3.41Å
72	K	48.4	Very low	53	Low	143 Å²	143	105.5 Å²	105.5	62%	0.622	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	-0.7	-178.4	-111.2	-175.4	161.8	68.6	0	115.1	V69 D76	V69-K72 PolarHBondContact O-N 2.85Å; K72-D76 WeakPolarHBondContact O-CB 3.41Å
73	T	53.2	Low	51.8	Low	95 Å²	95	104 Å²	104	58%	0.583	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.7	-31.9	164.9	-53.1	0	0	0	0	111	G71 L77	G71-T73 VanDerWaalsContact C-N 3.29Å; G71-T73 PolarHBondContact O-N 3.36Å; T73-L77 HydrophobicContact CG2-CD1 3.97Å; T73-L77 VanDerWaalsContact O-CB 3.26Å; T73-L77 WeakPolarHBondContact O-CB 3.21Å; T73-L77 VanDerWaalsContact O-CD1 3.23Å; T73-L77 WeakPolarHBondContact O-CD1 3.03Å; T73-L77 WeakPolarHBondContact O-CG 3.14Å; T73-L77 PolarHBondContact O-N 3.49Å; T73-L77 VanDerWaalsContact O-N 3.08Å
74	H	50.1	Low	51.2	Low	123 Å²	123	105.3 Å²	105.3	57%	0.569	56%	0.561	S	S	*	*	H	α-helix	trans	-81.9	-34.9	178.7	-159.2	-81.4	0	0	0	113.1	G71 M78	G71-H74 PolarHBondContact O-N 3.37Å; H74-M78 PolarHBondContact CE1-SD 3.44Å; H74-M78 PolarHBondContact ND1-SD 2.99Å; H74-M78 WeakPolarHBondContact O-CB 3.41Å; H74-M78 WeakPolarHBondContact O-CG 3.14Å; H74-M78 PolarHBondContact O-N 3.41Å
75	R	48.6	Very low	50.4	Low	156 Å²	156	107.6 Å²	107.6	59%	0.589	57%	0.569	S	S	*	*	H	α-helix	trans	-80	-26.1	174.5	-152.6	-174.6	74.4	167.5	9.9	111.8	G71 M78 E79	G71-R75 WeakPolarHBondContact O-CA 3.39Å; G71-R75 WeakPolarHBondContact O-CB 3.21Å; G71-R75 PolarHBondContact O-N 3.41Å; R75-M78 PolarHBondContact O-N 3.44Å; R75-E79 WeakPolarHBondContact O-CA 3.49Å; R75-E79 WeakPolarHBondContact O-CB 3.17Å; R75-E79 PolarHBondContact O-N 3.38Å
76	D	47.9	Very low	49.6	Very low	102 Å²	102	109.8 Å²	109.8	55%	0.545	58%	0.576	S	S	.	*	H	α-helix	trans	-75.3	-30.2	171	-133.3	-102.6	0	0	0	111.2	K72 E80	K72-D76 WeakPolarHBondContact O-CB 3.41Å; D76-E80 PolarHBondContact O-N 3.27Å
77	L	52.1	Low	49.1	Very low	122 Å²	122	113 Å²	113	64%	0.639	59%	0.586	S	S	*	*	H	α-helix	trans	-77.2	-24.2	169.1	-72.1	165.9	0	0	0	113.9	T73	T73-L77 HydrophobicContact CG2-CD1 3.97Å; T73-L77 VanDerWaalsContact O-CB 3.26Å; T73-L77 WeakPolarHBondContact O-CB 3.21Å; T73-L77 VanDerWaalsContact O-CD1 3.23Å; T73-L77 WeakPolarHBondContact O-CD1 3.03Å; T73-L77 WeakPolarHBondContact O-CG 3.14Å; T73-L77 PolarHBondContact O-N 3.49Å; T73-L77 VanDerWaalsContact O-N 3.08Å
78	M	46.7	Very low	48.8	Very low	112 Å²	112	114.2 Å²	114.2	55%	0.552	59%	0.59	S	S	*	*	H	α-helix	trans	-91.9	-22.7	172.7	-77.4	178.3	96.4	0	0	113.5	H74 R75 E80 E81	H74-M78 PolarHBondContact CE1-SD 3.44Å; H74-M78 PolarHBondContact ND1-SD 2.99Å; H74-M78 WeakPolarHBondContact O-CB 3.41Å; H74-M78 WeakPolarHBondContact O-CG 3.14Å; H74-M78 PolarHBondContact O-N 3.41Å; R75-M78 PolarHBondContact O-N 3.44Å; M78-E80 VanDerWaalsContact C-N 3.34Å; M78-E81 PolarHBondContact O-N 3.27Å
79	E	45.1	Very low	48.5	Very low	119 Å²	119	118.2 Å²	118.2	56%	0.556	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.7	-3.7	176	-163	160	88.8	0	0	111.7	R75 E81	R75-E79 WeakPolarHBondContact O-CA 3.49Å; R75-E79 WeakPolarHBondContact O-CB 3.17Å; R75-E79 PolarHBondContact O-N 3.38Å; E79-E81 VanDerWaalsContact C-N 3.31Å
80	E	42.3	Very low	48.2	Very low	158 Å²	158	121.3 Å²	121.3	74%	0.738	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.7	3.5	158.5	-103.9	-88.2	106.1	0	0	112.7	D76 M78	D76-E80 PolarHBondContact O-N 3.27Å; M78-E80 VanDerWaalsContact C-N 3.34Å
81	E	43.8	Very low	48.4	Very low	123 Å²	123	119.4 Å²	119.4	58%	0.575	60%	0.601	S	S	*	*	S	Bend	trans	-99.9	14.2	172.5	-56.4	-164.6	112	0	0	113.6	M78 E79	M78-E81 PolarHBondContact O-N 3.27Å; E79-E81 VanDerWaalsContact C-N 3.31Å
82	G	49.2	Very low	48.1	Very low	46 Å²	46	126 Å²	126	47%	0.474	62%	0.624	S	S	.	*	S	Bend	trans	-170.1	83.9	175.8	0	0	0	0	0	114.4
83	P	45.7	Very low	47.4	Very low	84 Å²	84	124.2 Å²	124.2	55%	0.545	63%	0.63	S	S	.	*	S	Bend		-116.2	7.9	103.8	-12.3	30.5	0	0	0	115.2	N86	P83-N86 PolarHBondContact O-OD1 2.91Å
84	F	48.7	Very low	47.1	Very low	139 Å²	139	124.3 Å²	124.3	61%	0.61	63%	0.632	S	S	*	*	S	Bend	trans	-106	-7.9	-169.3	-121.2	-93.9	0	0	0	116	N86 M87	F84-N86 PolarHBondContact O-N 2.91Å; F84-M87 HydrophobicContact CD1-CB 4.18Å; F84-M87 HydrophobicContact CD2-CE 4.3Å; F84-M87 HydrophobicContact CE1-CB 4.18Å; F84-M87 HydrophobicContact CE1-SD 4.21Å; F84-M87 HydrophobicContact CE2-CE 3.98Å; F84-M87 HydrophobicContact CE2-SD 3.97Å; F84-M87 HydrophobicContact CZ-CE 4.43Å; F84-M87 HydrophobicContact CZ-SD 3.8Å; F84-M87 PolarHBondContact O-N 2.98Å
85	Q	49.7	Very low	46.5	Very low	143 Å²	143	124.6 Å²	124.6	67%	0.668	64%	0.642	S	S	*	*	H	α-helix	trans	-69.4	-23.9	174.2	-69	-168.3	-6.3	0	0	112.5	M87	Q85-M87 VanDerWaalsContact C-N 3.35Å
86	N	45.3	Very low	46.5	Very low	119 Å²	119	121 Å²	121	64%	0.636	65%	0.654	S	S	*	*	H	α-helix	trans	-84.9	-1.4	175.8	34.7	-38.7	0	0	0	113.8	P83 F84	P83-N86 PolarHBondContact O-OD1 2.91Å; F84-N86 PolarHBondContact O-N 2.91Å
87	M	48	Very low	46.1	Very low	92 Å²	92	120.8 Å²	120.8	45%	0.453	66%	0.661	S	S	.	*	H	α-helix	trans	-102.2	-29.3	170.4	-70.5	-167.1	-140.9	0	0	113.5	F84 Q85 K90 I91	F84-M87 HydrophobicContact CD1-CB 4.18Å; F84-M87 HydrophobicContact CD2-CE 4.3Å; F84-M87 HydrophobicContact CE1-CB 4.18Å; F84-M87 HydrophobicContact CE1-SD 4.21Å; F84-M87 HydrophobicContact CE2-CE 3.98Å; F84-M87 HydrophobicContact CE2-SD 3.97Å; F84-M87 HydrophobicContact CZ-CE 4.43Å; F84-M87 HydrophobicContact CZ-SD 3.8Å; F84-M87 PolarHBondContact O-N 2.98Å; Q85-M87 VanDerWaalsContact C-N 3.35Å; M87-K90 PolarHBondContact O-N 3.3Å; M87-I91 WeakPolarHBondContact O-CG1 3.44Å
88	V	48.9	Very low	45.9	Very low	111 Å²	111	124 Å²	124	67%	0.673	67%	0.672	S	S	*	*	H	α-helix	trans	-72.6	-29.6	176.4	147.7	0	0	0	0	112.9	K90	V88-K90 PolarHBondContact O-N 3.12Å
89	E	47.5	Very low	46.2	Very low	173 Å²	173	124.2 Å²	124.2	81%	0.808	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.3	-21.3	173.7	-163.9	172.5	132.3	0	0	112.6
90	K	47.7	Very low	46.3	Very low	180 Å²	180	127.7 Å²	127.7	78%	0.783	70%	0.696	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.8	-4.9	-176.4	-150.7	170.1	-175.6	178.9	0	114.6	M87 V88	M87-K90 PolarHBondContact O-N 3.3Å; V88-K90 PolarHBondContact O-N 3.12Å
91	I	55.1	Low	46.7	Very low	142 Å²	142	126 Å²	126	73%	0.728	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113.5	-13.6	-175.5	-61.7	169.9	0	0	0	112.4	M87	M87-I91 WeakPolarHBondContact O-CG1 3.44Å
92	H	46.2	Very low	46.7	Very low	163 Å²	163	130.5 Å²	130.5	76%	0.755	73%	0.732	S	S	*	*			trans	-109.2	59.9	175	-160.9	-85	0	0	0	113
93	S	34.8	Very low	46.6	Very low	106 Å²	106	134.7 Å²	134.7	74%	0.741	75%	0.745	S	S	*	*			trans	-136	74.6	150.6	60	0	0	0	0	112
94	P	46.5	Very low	46.6	Very low	97 Å²	97	137.4 Å²	137.4	63%	0.63	76%	0.755	S	S	*	*			trans	-92.4	93.3	158.4	34.3	-23.9	0	0	0	108.1
95	T	37.7	Very low	46.5	Very low	129 Å²	129	137.3 Å²	137.3	79%	0.791	76%	0.763	S	S	*	*			trans	-146.9	93.4	153.2	-55.1	0	0	0	0	108.4	S97	T95-S97 PolarHBondContact O-N 3.03Å
96	G	47.8	Very low	46.3	Very low	80 Å²	80	136.9 Å²	136.9	83%	0.825	77%	0.769	S	S	*	*			trans	-57.6	129.6	158.6	0	0	0	0	0	108.9
97	S	39.4	Very low	46.4	Very low	99 Å²	99	138.1 Å²	138.1	69%	0.692	78%	0.777	S	S	*	*			trans	-131.8	92.1	159.1	-166.7	0	0	0	0	106.8	T95 T99	T95-S97 PolarHBondContact O-N 3.03Å; S97-T99 PolarHBondContact O-N 3.38Å
98	Q	49	Very low	46.3	Very low	190 Å²	190	141.1 Å²	141.1	89%	0.888	80%	0.798	S	S	*	*			trans	-57.7	121.6	153.3	-97	-171.2	78.3	0	0	107.6
99	T	51.5	Low	46.1	Very low	115 Å²	115	143.3 Å²	143.3	71%	0.706	81%	0.807	S	S	*	*			trans	-145.6	80	145.3	42.4	0	0	0	0	108.2	S97	S97-T99 PolarHBondContact O-N 3.38Å
100	E	48.5	Very low	46	Very low	192 Å²	192	141 Å²	141	90%	0.897	81%	0.807	S	S	*	*			trans	-87	100.6	155	-171.2	179.1	119.7	0	0	106.2
101	V	50.5	Low	45.9	Very low	124 Å²	124	137.8 Å²	137.8	75%	0.752	81%	0.809	S	S	*	*			trans	-126.7	111.9	163.1	-113.5	0	0	0	0	104.9
102	V	43.6	Very low	45	Very low	216 Å²	216	137.4 Å²	137.4	100%	1.309	82%	0.817	S	S	*	*			trans	160	0	142.4	163.2	0	0	0	0	108.9

Retrieved 102 of 102 residues in 39.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).