A0A060ZJD9_ONCMY Loading...

Mitotic spindle organizing protein 1

AlphaFold DB , UniProt , Accession A0A060ZJD9, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene mzt1, Length 95 aa.

						>A0A060ZJD9_ONCMY|A0A060ZJD9|mzt1
MASSANANNMNAVRETMDVLLEISRLLNTGLDMESLSICVRLCEQGINPEALSSVIKELRKASDSLKVRTCSGDRDRYLQNGVNRDTIEQGCPHF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.3	Low	70	Confident	223 Å²	223	100.2 Å²	100.2	100%	1.099	60%	0.604	S	S	*	*				0	-14.6	0	-73	177.7	172.6	0	0	114.1	S3	M1-S3 PolarHBondContact O-N 3.07Å
2	A	57.2	Low	71.4	Confident	90 Å²	90	95.3 Å²	95.3	74%	0.744	58%	0.582	S	S	*	*	H	α-helix	trans	-72.4	-23.3	178.5	0	0	0	0	0	115.2
3	S	59.6	Low	72.6	Confident	95 Å²	95	93.5 Å²	93.5	66%	0.664	57%	0.571	S	S	*	*	H	α-helix	trans	-71.9	-33.5	-175.1	20.2	0	0	0	0	114.2	M1 A7	M1-S3 PolarHBondContact O-N 3.07Å; S3-A7 PolarHBondContact O-N 3.27Å
4	S	62.1	Low	73.7	Confident	81 Å²	81	99.6 Å²	99.6	57%	0.566	58%	0.578	S	S	*	*	H	α-helix	trans	-73.4	-35.5	-179.2	-49.6	0	0	0	0	112.9	N6 A7 N8	S4-N6 VanDerWaalsContact C-N 3.34Å; S4-N6 PolarHBondContact O-N 3.25Å; S4-A7 PolarHBondContact O-N 3.18Å; S4-N8 PolarHBondContact O-N 3.26Å; S4-N8 PolarHBondContact O-OD1 3.24Å
5	A	65.1	Low	74.8	Confident	66 Å²	66	101.7 Å²	101.7	55%	0.545	58%	0.58	S	S	.	*	H	α-helix	trans	-66.2	-36.9	177.1	0	0	0	0	0	112.1	N8 N9	A5-N8 PolarHBondContact O-N 3.32Å; A5-N9 PolarHBondContact O-N 3.28Å; A5-N9 VanDerWaalsContact O-N 3.1Å
6	N	71.6	Confident	75.8	Confident	93 Å²	93	100.4 Å²	100.4	50%	0.497	58%	0.575	S	S	.	*	H	α-helix	trans	-69.9	-35.6	178.6	-158.6	59.3	0	0	0	112.3	S4 N9 M10	S4-N6 VanDerWaalsContact C-N 3.34Å; S4-N6 PolarHBondContact O-N 3.25Å; N6-N9 PolarHBondContact O-N 3.27Å; N6-M10 WeakPolarHBondContact O-CG 3.28Å; N6-M10 PolarHBondContact O-N 3.22Å; N6-M10 VanDerWaalsContact O-N 3.1Å
7	A	71.6	Confident	76.8	Confident	49 Å²	49	96.8 Å²	96.8	41%	0.405	55%	0.553	S	S	.	*	H	α-helix	trans	-64.4	-42.6	174	0	0	0	0	0	111.8	S3 S4 N9 M10 N11	S3-A7 PolarHBondContact O-N 3.27Å; S4-A7 PolarHBondContact O-N 3.18Å; A7-N9 VanDerWaalsContact C-N 3.32Å; A7-N9 PolarHBondContact O-N 3.3Å; A7-M10 PolarHBondContact O-N 3.24Å; A7-N11 VanDerWaalsContact O-CG 3.26Å; A7-N11 PolarHBondContact O-N 3.03Å; A7-N11 VanDerWaalsContact O-N 3.1Å; A7-N11 PolarHBondContact O-ND2 3.36Å
8	N	78.8	Confident	77.6	Confident	112 Å²	112	95.7 Å²	95.7	60%	0.599	55%	0.545	S	S	*	.	H	α-helix	trans	-63.7	-38.1	176.3	-70.5	14.6	0	0	0	112.1	S4 A5 N11 A12	S4-N8 PolarHBondContact O-N 3.26Å; S4-N8 PolarHBondContact O-OD1 3.24Å; A5-N8 PolarHBondContact O-N 3.32Å; N8-N11 PolarHBondContact O-N 3.35Å; N8-A12 PolarHBondContact O-N 2.72Å
9	N	82.2	Confident	78.5	Confident	90 Å²	90	95.4 Å²	95.4	48%	0.481	55%	0.545	S	S	.	.	H	α-helix	trans	-65.2	-42.9	177	-169.2	34	0	0	0	112.1	A5 N6 A7 N11 A12 V13	A5-N9 PolarHBondContact O-N 3.28Å; A5-N9 VanDerWaalsContact O-N 3.1Å; N6-N9 PolarHBondContact O-N 3.27Å; A7-N9 VanDerWaalsContact C-N 3.32Å; A7-N9 PolarHBondContact O-N 3.3Å; N9-N11 VanDerWaalsContact C-N 3.29Å; N9-N11 PolarHBondContact O-N 2.99Å; N9-A12 PolarHBondContact O-N 2.88Å; N9-V13 WeakPolarHBondContact O-CG2 3.39Å; N9-V13 PolarHBondContact O-N 3.25Å
10	M	80.9	Confident	79.1	Confident	112 Å²	112	93.8 Å²	93.8	55%	0.552	53%	0.534	S	S	*	.	H	α-helix	trans	-64.2	-35	177.2	-68.6	-67.7	163	0	0	112.4	N6 A7 R14	N6-M10 WeakPolarHBondContact O-CG 3.28Å; N6-M10 PolarHBondContact O-N 3.22Å; N6-M10 VanDerWaalsContact O-N 3.1Å; A7-M10 PolarHBondContact O-N 3.24Å; M10-R14 WeakPolarHBondContact O-CB 3.43Å; M10-R14 PolarHBondContact O-N 2.85Å; M10-R14 VanDerWaalsContact O-N 3.1Å
11	N	87.3	Confident	79.7	Confident	91 Å²	91	90 Å²	90	49%	0.487	51%	0.512	S	S	.	.	H	α-helix	trans	-65	-47.2	173.4	-65.5	-16.9	0	0	0	111.1	A7 N8 N9 V13 R14 E15	A7-N11 VanDerWaalsContact O-CG 3.26Å; A7-N11 PolarHBondContact O-N 3.03Å; A7-N11 VanDerWaalsContact O-N 3.1Å; A7-N11 PolarHBondContact O-ND2 3.36Å; N8-N11 PolarHBondContact O-N 3.35Å; N9-N11 VanDerWaalsContact C-N 3.29Å; N9-N11 PolarHBondContact O-N 2.99Å; N11-V13 VanDerWaalsContact C-N 3.34Å; N11-V13 PolarHBondContact O-N 3.41Å; N11-R14 WeakPolarHBondContact O-CB 3.48Å; N11-R14 PolarHBondContact O-N 3.49Å; N11-R14 VanDerWaalsContact O-N 3.12Å; N11-E15 PolarHBondContact O-N 3.16Å
12	A	87.1	Confident	81.6	Confident	42 Å²	42	84.7 Å²	84.7	35%	0.347	49%	0.485	S	S	.	.	H	α-helix	trans	-61.3	-40	178.1	0	0	0	0	0	112.9	N8 N9 R14 T16	N8-A12 PolarHBondContact O-N 2.72Å; N9-A12 PolarHBondContact O-N 2.88Å; A12-R14 VanDerWaalsContact C-N 3.33Å; A12-T16 WeakPolarHBondContact O-CB 3.42Å; A12-T16 PolarHBondContact O-N 3.25Å; A12-T16 PolarHBondContact O-OG1 3.01Å
13	V	87.6	Confident	83.2	Confident	71 Å²	71	84.3 Å²	84.3	43%	0.43	47%	0.469	S	S	.	.	H	α-helix	trans	-62.6	-42.5	174.8	171.1	0	0	0	0	110.9	N9 N11 T16 M17	N9-V13 WeakPolarHBondContact O-CG2 3.39Å; N9-V13 PolarHBondContact O-N 3.25Å; N11-V13 VanDerWaalsContact C-N 3.34Å; N11-V13 PolarHBondContact O-N 3.41Å; V13-T16 PolarHBondContact O-N 3.34Å; V13-M17 WeakPolarHBondContact O-CB 3.48Å; V13-M17 WeakPolarHBondContact O-CG 3.43Å; V13-M17 PolarHBondContact O-N 2.75Å
14	R	87.8	Confident	84.5	Confident	180 Å²	180	80.1 Å²	80.1	68%	0.679	44%	0.44	S	S	*	.	H	α-helix	trans	-64.9	-47.2	179.3	-165.5	174.8	-176	161.3	2.3	111.7	M10 N11 A12 T16 M17 D18	M10-R14 WeakPolarHBondContact O-CB 3.43Å; M10-R14 PolarHBondContact O-N 2.85Å; M10-R14 VanDerWaalsContact O-N 3.1Å; N11-R14 WeakPolarHBondContact O-CB 3.48Å; N11-R14 PolarHBondContact O-N 3.49Å; N11-R14 VanDerWaalsContact O-N 3.12Å; A12-R14 VanDerWaalsContact C-N 3.33Å; R14-T16 VanDerWaalsContact C-N 3.31Å; R14-T16 PolarHBondContact O-N 3.09Å; R14-M17 PolarHBondContact O-N 3.44Å; R14-D18 PolarHBondContact O-N 2.9Å
15	E	90.6	Very high	85.8	Confident	130 Å²	130	84 Å²	84	61%	0.607	44%	0.442	S	S	*	.	H	α-helix	trans	-59.4	-42.7	175	-72.7	174.8	90.6	0	0	111.6	N11 M17 D18 V19	N11-E15 PolarHBondContact O-N 3.16Å; E15-M17 PolarHBondContact O-N 3.33Å; E15-D18 PolarHBondContact O-N 2.83Å; E15-V19 WeakPolarHBondContact O-CG2 3.29Å; E15-V19 PolarHBondContact O-N 2.89Å
16	T	90.7	Very high	87	Confident	81 Å²	81	87.5 Å²	87.5	50%	0.497	45%	0.451	S	S	.	.	H	α-helix	trans	-62.3	-43.7	177.3	-58	0	0	0	0	111.5	A12 V13 R14 V19 L20	A12-T16 WeakPolarHBondContact O-CB 3.42Å; A12-T16 PolarHBondContact O-N 3.25Å; A12-T16 PolarHBondContact O-OG1 3.01Å; V13-T16 PolarHBondContact O-N 3.34Å; R14-T16 VanDerWaalsContact C-N 3.31Å; R14-T16 PolarHBondContact O-N 3.09Å; T16-V19 PolarHBondContact O-N 3.3Å; T16-L20 HydrophobicContact CG2-CD1 4.01Å; T16-L20 WeakPolarHBondContact O-CB 3.28Å; T16-L20 VanDerWaalsContact O-CG 3.28Å; T16-L20 WeakPolarHBondContact O-CG 3.33Å; T16-L20 PolarHBondContact O-N 3.32Å
17	M	92.3	Very high	87.7	Confident	39 Å²	39	89 Å²	89	19%	0.192	46%	0.459	C	S	.	.	H	α-helix	trans	-66.4	-39	177.6	-76.3	-63.1	-166.7	0	0	112.7	V13 R14 E15 L20 L21 L36 V40	V13-M17 WeakPolarHBondContact O-CB 3.48Å; V13-M17 WeakPolarHBondContact O-CG 3.43Å; V13-M17 PolarHBondContact O-N 2.75Å; R14-M17 PolarHBondContact O-N 3.44Å; E15-M17 PolarHBondContact O-N 3.33Å; M17-L20 PolarHBondContact O-N 2.8Å; M17-L20 HydrophobicContact SD-CD1 4.22Å; M17-L21 WeakPolarHBondContact O-CB 3.49Å; M17-L21 PolarHBondContact O-N 3.02Å; M17-L36 HydrophobicContact SD-CD2 4.29Å; M17-V40 HydrophobicContact CE-CB 4.01Å; M17-V40 HydrophobicContact CE-CG1 4.08Å; M17-V40 HydrophobicContact CE-CG2 4.07Å; M17-V40 HydrophobicContact SD-CG2 4.26Å
18	D	91.8	Very high	88.3	Confident	77 Å²	77	93.5 Å²	93.5	41%	0.412	48%	0.476	S	S	.	.	H	α-helix	trans	-63.8	-43.2	175.4	-80.4	-39.6	0	0	0	111.2	R14 E15 L20 L21 E22 M33	R14-D18 PolarHBondContact O-N 2.9Å; E15-D18 PolarHBondContact O-N 2.83Å; D18-L20 PolarHBondContact O-N 3.38Å; D18-L21 PolarHBondContact O-N 3.27Å; D18-E22 PolarHBondContact O-N 3.37Å; D18-M33 WeakPolarHBondContact OD1-CE 3.45Å
19	V	93.5	Very high	88.5	Confident	90 Å²	90	90.8 Å²	90.8	55%	0.545	46%	0.464	S	S	.	.	H	α-helix	trans	-62.9	-43.1	175	172.6	0	0	0	0	111.6	E15 T16 L21 E22 I23	E15-V19 WeakPolarHBondContact O-CG2 3.29Å; E15-V19 PolarHBondContact O-N 2.89Å; T16-V19 PolarHBondContact O-N 3.3Å; V19-L21 VanDerWaalsContact C-N 3.3Å; V19-L21 PolarHBondContact O-N 3Å; V19-E22 WeakPolarHBondContact O-CB 3.37Å; V19-E22 PolarHBondContact O-N 2.79Å; V19-I23 HydrophobicContact CG1-CD1 4.06Å; V19-I23 WeakPolarHBondContact O-CG1 3.34Å; V19-I23 PolarHBondContact O-N 2.68Å
20	L	90.9	Very high	88.5	Confident	64 Å²	64	88.5 Å²	88.5	34%	0.335	46%	0.461	S	S	.	.	H	α-helix	trans	-63.5	-36.8	176.8	-73.3	164.8	0	0	0	112	T16 M17 D18 I23 S24 L36 V40	T16-L20 HydrophobicContact CG2-CD1 4.01Å; T16-L20 WeakPolarHBondContact O-CB 3.28Å; T16-L20 VanDerWaalsContact O-CG 3.28Å; T16-L20 WeakPolarHBondContact O-CG 3.33Å; T16-L20 PolarHBondContact O-N 3.32Å; M17-L20 PolarHBondContact O-N 2.8Å; M17-L20 HydrophobicContact SD-CD1 4.22Å; D18-L20 PolarHBondContact O-N 3.38Å; L20-I23 PolarHBondContact O-N 2.81Å; L20-S24 WeakPolarHBondContact O-CB 3.5Å; L20-S24 PolarHBondContact O-N 3.47Å; L20-L36 HydrophobicContact CB-CD2 3.82Å; L20-V40 HydrophobicContact CD1-CG2 4.13Å
21	L	91.8	Very high	88.6	Confident	14 Å²	14	84.9 Å²	84.9	7%	0.073	44%	0.444	C	S	.	.	H	α-helix	trans	-68.2	-39.4	175.5	-172.5	66.7	0	0	0	111.6	M17 D18 V19 S24 R25 M33 L36	M17-L21 WeakPolarHBondContact O-CB 3.49Å; M17-L21 PolarHBondContact O-N 3.02Å; D18-L21 PolarHBondContact O-N 3.27Å; V19-L21 VanDerWaalsContact C-N 3.3Å; V19-L21 PolarHBondContact O-N 3Å; L21-S24 WeakPolarHBondContact O-CB 3.39Å; L21-S24 PolarHBondContact O-N 2.95Å; L21-R25 WeakPolarHBondContact O-CG 3.41Å; L21-R25 PolarHBondContact O-N 3.45Å; L21-M33 HydrophobicContact CD2-CB 4.5Å; L21-M33 HydrophobicContact CD2-CE 4.23Å; L21-L36 HydrophobicContact CB-CD2 4.33Å
22	E	92.9	Very high	88.7	Confident	112 Å²	112	84.3 Å²	84.3	52%	0.523	44%	0.441	S	S	.	.	H	α-helix	trans	-57.2	-49	172.6	-165.2	87.6	178.9	0	0	110.6	D18 V19 S24 R25 L26	D18-E22 PolarHBondContact O-N 3.37Å; V19-E22 WeakPolarHBondContact O-CB 3.37Å; V19-E22 PolarHBondContact O-N 2.79Å; E22-S24 VanDerWaalsContact C-N 3.35Å; E22-S24 PolarHBondContact O-N 3.25Å; E22-R25 WeakPolarHBondContact O-CB 3.41Å; E22-R25 PolarHBondContact O-N 3.11Å; E22-L26 WeakPolarHBondContact O-CG 3.27Å; E22-L26 PolarHBondContact O-N 3.08Å
23	I	91.2	Very high	88.6	Confident	81 Å²	81	87 Å²	87	42%	0.415	45%	0.447	S	S	.	.	H	α-helix	trans	-60.9	-44.3	177.2	-65.2	164.8	0	0	0	110.8	V19 L20 R25 L26 L27	V19-I23 HydrophobicContact CG1-CD1 4.06Å; V19-I23 WeakPolarHBondContact O-CG1 3.34Å; V19-I23 PolarHBondContact O-N 2.68Å; L20-I23 PolarHBondContact O-N 2.81Å; I23-R25 VanDerWaalsContact C-N 3.28Å; I23-R25 PolarHBondContact O-N 3.19Å; I23-L26 PolarHBondContact O-N 3.15Å; I23-L27 HydrophobicContact CG2-CD1 3.87Å; I23-L27 HydrophobicContact CG2-CG 4.41Å; I23-L27 WeakPolarHBondContact O-CB 3.32Å; I23-L27 WeakPolarHBondContact O-CG 3.41Å; I23-L27 PolarHBondContact O-N 2.93Å
24	S	87.1	Confident	88.7	Confident	8 Å²	8	90.9 Å²	90.9	6%	0.056	46%	0.461	C	S	.	.	H	α-helix	trans	-58.1	-39.6	176.7	169.2	0	0	0	0	112.5	L20 L21 E22 N28 T29	L20-S24 WeakPolarHBondContact O-CB 3.5Å; L20-S24 PolarHBondContact O-N 3.47Å; L21-S24 WeakPolarHBondContact O-CB 3.39Å; L21-S24 PolarHBondContact O-N 2.95Å; E22-S24 VanDerWaalsContact C-N 3.35Å; E22-S24 PolarHBondContact O-N 3.25Å; S24-N28 PolarHBondContact O-N 3.27Å; S24-N28 VanDerWaalsContact O-N 3.08Å; S24-T29 PolarHBondContact O-N 2.96Å; S24-T29 PolarHBondContact O-OG1 3.24Å; S24-T29 PolarHBondContact OG-OG1 3.03Å
25	R	88.5	Confident	88.6	Confident	161 Å²	161	84.3 Å²	84.3	61%	0.608	44%	0.442	S	S	*	.	H	α-helix	trans	-68.5	-44.1	175.9	-73.1	170.5	176.7	171.3	-0.2	111.7	L21 E22 I23 L27 N28	L21-R25 WeakPolarHBondContact O-CG 3.41Å; L21-R25 PolarHBondContact O-N 3.45Å; E22-R25 WeakPolarHBondContact O-CB 3.41Å; E22-R25 PolarHBondContact O-N 3.11Å; I23-R25 VanDerWaalsContact C-N 3.28Å; I23-R25 PolarHBondContact O-N 3.19Å; R25-L27 VanDerWaalsContact C-N 3.33Å; R25-L27 PolarHBondContact O-N 3.43Å; R25-N28 WeakPolarHBondContact O-CA 3.44Å; R25-N28 PolarHBondContact O-N 3.39Å
26	L	91.4	Very high	88.6	Confident	141 Å²	141	79 Å²	79	74%	0.738	42%	0.418	S	S	*	.	H	α-helix	trans	-61.5	-40.8	176.6	-69.5	172.2	0	0	0	112.2	E22 I23 N28	E22-L26 WeakPolarHBondContact O-CG 3.27Å; E22-L26 PolarHBondContact O-N 3.08Å; I23-L26 PolarHBondContact O-N 3.15Å; L26-N28 PolarHBondContact O-N 3.26Å
27	L	86.8	Confident	88.6	Confident	125 Å²	125	76.6 Å²	76.6	65%	0.654	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80	-1.1	175.8	-66.4	176	0	0	0	113.3	I23 R25 T29	I23-L27 HydrophobicContact CG2-CD1 3.87Å; I23-L27 HydrophobicContact CG2-CG 4.41Å; I23-L27 WeakPolarHBondContact O-CB 3.32Å; I23-L27 WeakPolarHBondContact O-CG 3.41Å; I23-L27 PolarHBondContact O-N 2.93Å; R25-L27 VanDerWaalsContact C-N 3.33Å; R25-L27 PolarHBondContact O-N 3.43Å; L27-T29 HydrophobicContact CB-CG2 3.85Å; L27-T29 PolarHBondContact O-N 2.94Å; L27-T29 VanDerWaalsContact O-N 3.15Å
28	N	83.3	Confident	88.5	Confident	142 Å²	142	78.7 Å²	78.7	76%	0.759	42%	0.416	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.7	37.6	178.1	-147.1	80.8	0	0	0	113.4	S24 R25 L26 G30	S24-N28 PolarHBondContact O-N 3.27Å; S24-N28 VanDerWaalsContact O-N 3.08Å; R25-N28 WeakPolarHBondContact O-CA 3.44Å; R25-N28 PolarHBondContact O-N 3.39Å; L26-N28 PolarHBondContact O-N 3.26Å; N28-G30 PolarHBondContact O-N 3.5Å
29	T	82.5	Confident	88.4	Confident	56 Å²	56	76 Å²	76	34%	0.344	40%	0.402	S	S	.	.			trans	-70.6	-22.9	-178.6	72.7	0	0	0	0	112.3	S24 L27 L31	S24-T29 PolarHBondContact O-N 2.96Å; S24-T29 PolarHBondContact O-OG1 3.24Å; S24-T29 PolarHBondContact OG-OG1 3.03Å; L27-T29 HydrophobicContact CB-CG2 3.85Å; L27-T29 PolarHBondContact O-N 2.94Å; L27-T29 VanDerWaalsContact O-N 3.15Å; T29-L31 VanDerWaalsContact C-N 3.3Å; T29-L31 PolarHBondContact O-N 3.43Å; T29-L31 PolarHBondContact OG1-N 2.94Å
30	G	82.3	Confident	88.3	Confident	41 Å²	41	73.4 Å²	73.4	42%	0.423	39%	0.387	S	S	.	.			trans	69.4	25.6	179.4	0	0	0	0	0	113.7	N28 R60	N28-G30 PolarHBondContact O-N 3.5Å; G30-R60 PolarHBondContact O-NH2 2.95Å
31	L	84.4	Confident	88.3	Confident	36 Å²	36	77.6 Å²	77.6	19%	0.188	40%	0.398	C	S	.	.			trans	-84.2	126.8	173.2	-64	173.6	0	0	0	110.2	T29 I56	T29-L31 VanDerWaalsContact C-N 3.3Å; T29-L31 PolarHBondContact O-N 3.43Å; T29-L31 PolarHBondContact OG1-N 2.94Å; L31-I56 HydrophobicContact CD2-CG2 3.89Å
32	D	87.9	Confident	88.2	Confident	80 Å²	80	79.3 Å²	79.3	43%	0.428	41%	0.407	S	S	.	.			trans	-74.6	164.9	170.3	58.6	-83.4	0	0	0	111.5	E34 S35 L36	D32-E34 VanDerWaalsContact C-N 3.27Å; D32-E34 PolarHBondContact O-N 3.37Å; D32-E34 WeakPolarHBondContact OD2-CB 3.36Å; D32-E34 PolarHBondContact OD2-N 2.94Å; D32-S35 VanDerWaalsContact CG-OG 3.23Å; D32-S35 PolarHBondContact O-N 2.76Å; D32-S35 VanDerWaalsContact OD1-CB 3.27Å; D32-S35 WeakPolarHBondContact OD1-CB 3.39Å; D32-S35 PolarHBondContact OD1-OG 3.23Å; D32-S35 WeakPolarHBondContact OD2-CB 3.47Å; D32-S35 PolarHBondContact OD2-N 3.48Å; D32-S35 PolarHBondContact OD2-OG 3.07Å; D32-S35 VanDerWaalsContact OD2-OG 3.11Å; D32-L36 WeakPolarHBondContact O-CB 3.38Å; D32-L36 PolarHBondContact O-N 3.48Å
33	M	86.1	Confident	88	Confident	99 Å²	99	76.7 Å²	76.7	49%	0.488	40%	0.401	S	S	.	.	H	α-helix	trans	-61.3	-35.3	-175.3	-167.5	175.1	-129.4	0	0	112.5	D18 L21 S37	D18-M33 WeakPolarHBondContact OD1-CE 3.45Å; L21-M33 HydrophobicContact CD2-CB 4.5Å; L21-M33 HydrophobicContact CD2-CE 4.23Å; M33-S37 WeakPolarHBondContact O-CB 3.49Å; M33-S37 PolarHBondContact O-N 3.29Å; M33-S37 VanDerWaalsContact O-N 3.11Å
34	E	88	Confident	88	Confident	152 Å²	152	80 Å²	80	71%	0.71	41%	0.414	S	S	*	.	H	α-helix	trans	-68.2	-51.2	176.2	-74.9	-176.6	76.5	0	0	111	D32 L36 S37 I38	D32-E34 VanDerWaalsContact C-N 3.27Å; D32-E34 PolarHBondContact O-N 3.37Å; D32-E34 WeakPolarHBondContact OD2-CB 3.36Å; D32-E34 PolarHBondContact OD2-N 2.94Å; E34-L36 VanDerWaalsContact C-N 3.31Å; E34-L36 PolarHBondContact O-N 3.42Å; E34-S37 WeakPolarHBondContact O-CB 3.24Å; E34-S37 PolarHBondContact O-N 3.47Å; E34-S37 VanDerWaalsContact O-N 3.13Å; E34-S37 PolarHBondContact O-OG 3.49Å; E34-I38 WeakPolarHBondContact O-CG1 3.41Å; E34-I38 PolarHBondContact O-N 3.25Å; E34-I38 VanDerWaalsContact O-N 3.08Å
35	S	87.3	Confident	88.2	Confident	41 Å²	41	87 Å²	87	29%	0.287	45%	0.446	S	S	.	.	H	α-helix	trans	-57	-43.3	177	-69.1	0	0	0	0	112.2	D32 I38 C39	D32-S35 VanDerWaalsContact CG-OG 3.23Å; D32-S35 PolarHBondContact O-N 2.76Å; D32-S35 VanDerWaalsContact OD1-CB 3.27Å; D32-S35 WeakPolarHBondContact OD1-CB 3.39Å; D32-S35 PolarHBondContact OD1-OG 3.23Å; D32-S35 WeakPolarHBondContact OD2-CB 3.47Å; D32-S35 PolarHBondContact OD2-N 3.48Å; D32-S35 PolarHBondContact OD2-OG 3.07Å; D32-S35 VanDerWaalsContact OD2-OG 3.11Å; S35-I38 PolarHBondContact O-N 3.44Å; S35-C39 PolarHBondContact O-N 2.93Å; S35-C39 PolarHBondContact O-SG 3.35Å
36	L	89.6	Confident	88.2	Confident	18 Å²	18	82.5 Å²	82.5	9%	0.094	45%	0.45	C	S	.	.	H	α-helix	trans	-61.3	-45	176.9	-170.7	94.1	0	0	0	111.1	M17 L20 L21 D32 E34 I38 C39 V40	M17-L36 HydrophobicContact SD-CD2 4.29Å; L20-L36 HydrophobicContact CB-CD2 3.82Å; L21-L36 HydrophobicContact CB-CD2 4.33Å; D32-L36 WeakPolarHBondContact O-CB 3.38Å; D32-L36 PolarHBondContact O-N 3.48Å; E34-L36 VanDerWaalsContact C-N 3.31Å; E34-L36 PolarHBondContact O-N 3.42Å; L36-I38 VanDerWaalsContact C-N 3.28Å; L36-I38 PolarHBondContact O-N 3.06Å; L36-C39 WeakPolarHBondContact O-CB 3.42Å; L36-C39 PolarHBondContact O-N 3.11Å; L36-C39 VanDerWaalsContact O-N 3.13Å; L36-V40 WeakPolarHBondContact O-CG2 3.38Å; L36-V40 PolarHBondContact O-N 3.13Å
37	S	91.2	Very high	88.2	Confident	32 Å²	32	79 Å²	79	22%	0.224	43%	0.431	C	S	.	.	H	α-helix	trans	-60.9	-38.4	178.7	81.6	0	0	0	0	112.3	M33 E34 V40 R41	M33-S37 WeakPolarHBondContact O-CB 3.49Å; M33-S37 PolarHBondContact O-N 3.29Å; M33-S37 VanDerWaalsContact O-N 3.11Å; E34-S37 WeakPolarHBondContact O-CB 3.24Å; E34-S37 PolarHBondContact O-N 3.47Å; E34-S37 VanDerWaalsContact O-N 3.13Å; E34-S37 PolarHBondContact O-OG 3.49Å; S37-V40 PolarHBondContact O-N 3.36Å; S37-R41 VanDerWaalsContact O-CD 3.3Å; S37-R41 WeakPolarHBondContact O-CD 3.28Å; S37-R41 WeakPolarHBondContact O-CG 3.26Å; S37-R41 PolarHBondContact O-N 2.99Å; S37-R41 VanDerWaalsContact O-N 3.13Å
38	I	90.4	Very high	88.5	Confident	82 Å²	82	77.1 Å²	77.1	42%	0.421	42%	0.422	S	S	.	.	H	α-helix	trans	-66.2	-44.3	176.3	-64.6	162	0	0	0	109.5	E34 S35 L36 V40 R41 L42	E34-I38 WeakPolarHBondContact O-CG1 3.41Å; E34-I38 PolarHBondContact O-N 3.25Å; E34-I38 VanDerWaalsContact O-N 3.08Å; S35-I38 PolarHBondContact O-N 3.44Å; L36-I38 VanDerWaalsContact C-N 3.28Å; L36-I38 PolarHBondContact O-N 3.06Å; I38-V40 VanDerWaalsContact C-N 3.32Å; I38-V40 PolarHBondContact O-N 2.99Å; I38-R41 PolarHBondContact O-N 3.43Å; I38-L42 HydrophobicContact CG2-CD1 3.83Å; I38-L42 HydrophobicContact CG2-CG 4.26Å; I38-L42 WeakPolarHBondContact O-CB 3.48Å; I38-L42 VanDerWaalsContact O-CG 3.25Å; I38-L42 WeakPolarHBondContact O-CG 3.45Å; I38-L42 PolarHBondContact O-N 2.86Å
39	C	89.9	Confident	88.7	Confident	20 Å²	20	74.3 Å²	74.3	14%	0.135	41%	0.412	C	S	.	.	H	α-helix	trans	-59	-42.9	177.2	-64.6	0	0	0	0	112.1	S35 L36 L42 C43 L52 I56	S35-C39 PolarHBondContact O-N 2.93Å; S35-C39 PolarHBondContact O-SG 3.35Å; L36-C39 WeakPolarHBondContact O-CB 3.42Å; L36-C39 PolarHBondContact O-N 3.11Å; L36-C39 VanDerWaalsContact O-N 3.13Å; C39-L42 PolarHBondContact O-N 3.31Å; C39-C43 WeakPolarHBondContact O-CB 3.49Å; C39-C43 PolarHBondContact O-N 3.08Å; C39-C43 PolarHBondContact O-SG 3.35Å; C39-L52 HydrophobicContact CB-CD2 4.09Å; C39-I56 WeakPolarHBondContact SG-CD1 3.4Å
40	V	90.3	Very high	88.9	Confident	37 Å²	37	78.8 Å²	78.8	22%	0.224	43%	0.428	C	S	.	.	H	α-helix	trans	-61.2	-48.3	177	173.3	0	0	0	0	110.8	M17 L20 L36 S37 I38 L42 C43 E44	M17-V40 HydrophobicContact CE-CB 4.01Å; M17-V40 HydrophobicContact CE-CG1 4.08Å; M17-V40 HydrophobicContact CE-CG2 4.07Å; M17-V40 HydrophobicContact SD-CG2 4.26Å; L20-V40 HydrophobicContact CD1-CG2 4.13Å; L36-V40 WeakPolarHBondContact O-CG2 3.38Å; L36-V40 PolarHBondContact O-N 3.13Å; S37-V40 PolarHBondContact O-N 3.36Å; I38-V40 VanDerWaalsContact C-N 3.32Å; I38-V40 PolarHBondContact O-N 2.99Å; V40-L42 VanDerWaalsContact C-N 3.28Å; V40-L42 PolarHBondContact O-N 3.11Å; V40-C43 WeakPolarHBondContact O-CB 3.49Å; V40-C43 PolarHBondContact O-N 2.69Å; V40-C43 VanDerWaalsContact O-N 3.15Å; V40-E44 HydrophobicContact CG1-CG 4.44Å; V40-E44 WeakPolarHBondContact O-CG 3.49Å; V40-E44 PolarHBondContact O-N 3.42Å
41	R	91.1	Very high	89.3	Confident	151 Å²	151	79.3 Å²	79.3	57%	0.57	43%	0.429	S	S	*	.	H	α-helix	trans	-61	-36.7	177.8	-73.6	152.4	62.7	177.8	0.4	112.7	S37 I38 Q45	S37-R41 VanDerWaalsContact O-CD 3.3Å; S37-R41 WeakPolarHBondContact O-CD 3.28Å; S37-R41 WeakPolarHBondContact O-CG 3.26Å; S37-R41 PolarHBondContact O-N 2.99Å; S37-R41 VanDerWaalsContact O-N 3.13Å; I38-R41 PolarHBondContact O-N 3.43Å; R41-Q45 WeakPolarHBondContact O-CG 3.38Å; R41-Q45 PolarHBondContact O-N 3Å
42	L	90.3	Very high	89.5	Confident	51 Å²	51	78.7 Å²	78.7	27%	0.267	43%	0.426	S	S	.	.	H	α-helix	trans	-69.2	-41.9	175.8	-72.2	175.7	0	0	0	111.4	I38 C39 V40 Q45 I47 L52	I38-L42 HydrophobicContact CG2-CD1 3.83Å; I38-L42 HydrophobicContact CG2-CG 4.26Å; I38-L42 WeakPolarHBondContact O-CB 3.48Å; I38-L42 VanDerWaalsContact O-CG 3.25Å; I38-L42 WeakPolarHBondContact O-CG 3.45Å; I38-L42 PolarHBondContact O-N 2.86Å; C39-L42 PolarHBondContact O-N 3.31Å; V40-L42 VanDerWaalsContact C-N 3.28Å; V40-L42 PolarHBondContact O-N 3.11Å; L42-Q45 PolarHBondContact O-N 3.42Å; L42-I47 HydrophobicContact CB-CD1 3.89Å; L42-I47 HydrophobicContact CD2-CD1 3.62Å; L42-I47 HydrophobicContact CG-CD1 4.25Å; L42-I47 VanDerWaalsContact O-CB 3.28Å; L42-I47 WeakPolarHBondContact O-CB 3.45Å; L42-I47 WeakPolarHBondContact O-CG1 3.34Å; L42-I47 PolarHBondContact O-N 3.44Å; L42-L52 HydrophobicContact CB-CD2 4.23Å; L42-L52 HydrophobicContact CD1-CD1 3.78Å
43	C	89.3	Confident	89.4	Confident	56 Å²	56	77.1 Å²	77.1	38%	0.378	42%	0.421	S	S	.	.	H	α-helix	trans	-63.7	-39.1	173.8	-71.7	0	0	0	0	112.1	C39 V40 Q45 G46	C39-C43 WeakPolarHBondContact O-CB 3.49Å; C39-C43 PolarHBondContact O-N 3.08Å; C39-C43 PolarHBondContact O-SG 3.35Å; V40-C43 WeakPolarHBondContact O-CB 3.49Å; V40-C43 PolarHBondContact O-N 2.69Å; V40-C43 VanDerWaalsContact O-N 3.15Å; C43-Q45 PolarHBondContact O-N 3.02Å; C43-G46 PolarHBondContact O-N 3.3Å
44	E	90	Very high	89.6	Confident	151 Å²	151	75.5 Å²	75.5	71%	0.706	42%	0.42	S	S	*	.	H	α-helix	trans	-62.3	-28.5	174.7	-73.3	173.3	164.5	0	0	112.7	V40 G46	V40-E44 HydrophobicContact CG1-CG 4.44Å; V40-E44 WeakPolarHBondContact O-CG 3.49Å; V40-E44 PolarHBondContact O-N 3.42Å; E44-G46 PolarHBondContact O-N 2.97Å
45	Q	91.4	Very high	89.6	Confident	154 Å²	154	72 Å²	72	72%	0.72	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.5	1.7	173	-69.6	-177.4	4	0	0	113.6	R41 L42 C43	R41-Q45 WeakPolarHBondContact O-CG 3.38Å; R41-Q45 PolarHBondContact O-N 3Å; L42-Q45 PolarHBondContact O-N 3.42Å; C43-Q45 PolarHBondContact O-N 3.02Å
46	G	89.6	Confident	89.5	Confident	67 Å²	67	71.9 Å²	71.9	69%	0.691	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	85.1	18.3	178.7	0	0	0	0	0	114.1	C43 E44	C43-G46 PolarHBondContact O-N 3.3Å; E44-G46 PolarHBondContact O-N 2.97Å
47	I	91.3	Very high	89.3	Confident	67 Å²	67	78 Å²	78	34%	0.344	43%	0.43	S	S	.	.			trans	-70.5	134.8	173.8	-63.2	-179.2	0	0	0	109.3	L42 P49 L52	L42-I47 HydrophobicContact CB-CD1 3.89Å; L42-I47 HydrophobicContact CD2-CD1 3.62Å; L42-I47 HydrophobicContact CG-CD1 4.25Å; L42-I47 VanDerWaalsContact O-CB 3.28Å; L42-I47 WeakPolarHBondContact O-CB 3.45Å; L42-I47 WeakPolarHBondContact O-CG1 3.34Å; L42-I47 PolarHBondContact O-N 3.44Å; I47-P49 WeakPolarHBondContact O-CD 3.48Å; I47-L52 HydrophobicContact CG2-CB 4.23Å
48	N	92.7	Very high	89.1	Confident	87 Å²	87	83 Å²	83	47%	0.465	45%	0.45	S	S	.	.			trans	-63.5	120.1	177.3	-176.7	-7	0	0	0	110.1	E50 A51 L52	N48-E50 PolarHBondContact O-N 2.93Å; N48-E50 PolarHBondContact OD1-N 3.39Å; N48-A51 HydrophobicContact CB-CB 4.2Å; N48-A51 PolarHBondContact O-N 3.48Å; N48-L52 PolarHBondContact O-N 2.94Å
49	P	86.9	Confident	88.9	Confident	83 Å²	83	84.1 Å²	84.1	54%	0.539	46%	0.456	S	S	.	.	H	α-helix	trans	-60.5	-30.7	-179.8	24.1	-35	0	0	0	113	I47 L52 S53	I47-P49 WeakPolarHBondContact O-CD 3.48Å; P49-L52 PolarHBondContact O-N 2.97Å; P49-S53 WeakPolarHBondContact O-CB 3.46Å; P49-S53 PolarHBondContact O-N 3.37Å
50	E	87.7	Confident	88.6	Confident	149 Å²	149	89.4 Å²	89.4	70%	0.696	47%	0.473	S	S	*	.	H	α-helix	trans	-65.4	-47	177.1	-68.3	-165.9	101.2	0	0	111.4	N48 S53 S54	N48-E50 PolarHBondContact O-N 2.93Å; N48-E50 PolarHBondContact OD1-N 3.39Å; E50-S53 PolarHBondContact O-N 3.12Å; E50-S53 PolarHBondContact O-OG 2.73Å; E50-S54 PolarHBondContact O-N 2.75Å
51	A	90.3	Very high	88.2	Confident	53 Å²	53	95.6 Å²	95.6	44%	0.438	50%	0.497	S	S	.	.	H	α-helix	trans	-63.4	-43.8	177.1	0	0	0	0	0	111.4	N48 S53 S54 V55	N48-A51 HydrophobicContact CB-CB 4.2Å; N48-A51 PolarHBondContact O-N 3.48Å; A51-S53 VanDerWaalsContact C-N 3.32Å; A51-S53 PolarHBondContact O-N 3.38Å; A51-S54 WeakPolarHBondContact O-CB 3.34Å; A51-S54 PolarHBondContact O-N 3.19Å; A51-V55 WeakPolarHBondContact O-CG2 3.34Å; A51-V55 PolarHBondContact O-N 3.36Å; A51-V55 VanDerWaalsContact O-N 3.15Å
52	L	87.8	Confident	87.7	Confident	22 Å²	22	91.1 Å²	91.1	12%	0.115	49%	0.493	C	S	.	.	H	α-helix	trans	-59.1	-43.7	177.1	-177.2	62.9	0	0	0	111.5	C39 L42 I47 N48 P49 S54 V55 I56	C39-L52 HydrophobicContact CB-CD2 4.09Å; L42-L52 HydrophobicContact CB-CD2 4.23Å; L42-L52 HydrophobicContact CD1-CD1 3.78Å; I47-L52 HydrophobicContact CG2-CB 4.23Å; N48-L52 PolarHBondContact O-N 2.94Å; P49-L52 PolarHBondContact O-N 2.97Å; L52-S54 VanDerWaalsContact C-N 3.29Å; L52-S54 PolarHBondContact O-N 3.23Å; L52-V55 PolarHBondContact O-N 2.93Å; L52-I56 HydrophobicContact CD1-CD1 4.06Å; L52-I56 HydrophobicContact CD1-CG1 4.39Å; L52-I56 HydrophobicContact CD2-CD1 4.47Å; L52-I56 HydrophobicContact CG-CD1 3.78Å; L52-I56 VanDerWaalsContact O-CG1 3.26Å; L52-I56 WeakPolarHBondContact O-CG1 3.5Å; L52-I56 PolarHBondContact O-N 3.29Å
53	S	87	Confident	87.1	Confident	48 Å²	48	91.9 Å²	91.9	34%	0.336	50%	0.502	S	S	.	.	H	α-helix	trans	-61.5	-37	178.2	82.5	0	0	0	0	112.8	P49 E50 A51 K57	P49-S53 WeakPolarHBondContact O-CB 3.46Å; P49-S53 PolarHBondContact O-N 3.37Å; E50-S53 PolarHBondContact O-N 3.12Å; E50-S53 PolarHBondContact O-OG 2.73Å; A51-S53 VanDerWaalsContact C-N 3.32Å; A51-S53 PolarHBondContact O-N 3.38Å; S53-K57 WeakPolarHBondContact O-CB 3.32Å; S53-K57 VanDerWaalsContact O-CG 3.24Å; S53-K57 WeakPolarHBondContact O-CG 3.38Å; S53-K57 PolarHBondContact O-N 3.39Å
54	S	88.6	Confident	86.4	Confident	65 Å²	65	94.5 Å²	94.5	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-66.6	-47.9	178.8	-159.8	0	0	0	0	110.7	E50 A51 L52 I56 K57 E58	E50-S54 PolarHBondContact O-N 2.75Å; A51-S54 WeakPolarHBondContact O-CB 3.34Å; A51-S54 PolarHBondContact O-N 3.19Å; L52-S54 VanDerWaalsContact C-N 3.29Å; L52-S54 PolarHBondContact O-N 3.23Å; S54-I56 PolarHBondContact O-N 3.42Å; S54-K57 PolarHBondContact O-N 3.42Å; S54-E58 WeakPolarHBondContact O-CG 3.45Å; S54-E58 PolarHBondContact O-N 3.1Å
55	V	88.2	Confident	85.4	Confident	79 Å²	79	90.6 Å²	90.6	48%	0.479	50%	0.502	S	S	.	.	H	α-helix	trans	-60.1	-45.4	177.6	175.2	0	0	0	0	111.1	A51 L52 K57 E58 L59	A51-V55 WeakPolarHBondContact O-CG2 3.34Å; A51-V55 PolarHBondContact O-N 3.36Å; A51-V55 VanDerWaalsContact O-N 3.15Å; L52-V55 PolarHBondContact O-N 2.93Å; V55-K57 PolarHBondContact O-N 3.2Å; V55-E58 PolarHBondContact O-N 3.34Å; V55-L59 HydrophobicContact CG1-CD1 3.84Å; V55-L59 HydrophobicContact CG1-CG 4.21Å; V55-L59 WeakPolarHBondContact O-CB 3.45Å; V55-L59 VanDerWaalsContact O-CG 3.28Å; V55-L59 WeakPolarHBondContact O-CG 3.28Å; V55-L59 PolarHBondContact O-N 2.94Å
56	I	86.7	Confident	84.2	Confident	38 Å²	38	87.8 Å²	87.8	20%	0.195	49%	0.491	C	S	.	.	H	α-helix	trans	-61.7	-43.3	178.6	-69.1	167.2	0	0	0	111.4	L31 C39 L52 S54 L59 R60	L31-I56 HydrophobicContact CD2-CG2 3.89Å; C39-I56 WeakPolarHBondContact SG-CD1 3.4Å; L52-I56 HydrophobicContact CD1-CD1 4.06Å; L52-I56 HydrophobicContact CD1-CG1 4.39Å; L52-I56 HydrophobicContact CD2-CD1 4.47Å; L52-I56 HydrophobicContact CG-CD1 3.78Å; L52-I56 VanDerWaalsContact O-CG1 3.26Å; L52-I56 WeakPolarHBondContact O-CG1 3.5Å; L52-I56 PolarHBondContact O-N 3.29Å; S54-I56 PolarHBondContact O-N 3.42Å; I56-L59 PolarHBondContact O-N 3.04Å; I56-R60 WeakPolarHBondContact O-CB 3.41Å; I56-R60 WeakPolarHBondContact O-CG 3.49Å; I56-R60 PolarHBondContact O-N 3.24Å
57	K	85.4	Confident	82.6	Confident	145 Å²	145	91.7 Å²	91.7	63%	0.63	49%	0.489	S	S	*	.	H	α-helix	trans	-62.4	-44.5	177.2	-75	169.8	-176.8	172.3	0	111.5	S53 S54 V55 R60 K61	S53-K57 WeakPolarHBondContact O-CB 3.32Å; S53-K57 VanDerWaalsContact O-CG 3.24Å; S53-K57 WeakPolarHBondContact O-CG 3.38Å; S53-K57 PolarHBondContact O-N 3.39Å; S54-K57 PolarHBondContact O-N 3.42Å; V55-K57 PolarHBondContact O-N 3.2Å; K57-R60 PolarHBondContact O-N 3.44Å; K57-K61 WeakPolarHBondContact O-CB 3.49Å; K57-K61 PolarHBondContact O-N 2.98Å
58	E	86.5	Confident	80.8	Confident	137 Å²	137	92.8 Å²	92.8	64%	0.64	50%	0.499	S	S	*	.	H	α-helix	trans	-65	-43.4	177.2	-71	-153.5	131	0	0	112.2	S54 V55 R60 K61 A62	S54-E58 WeakPolarHBondContact O-CG 3.45Å; S54-E58 PolarHBondContact O-N 3.1Å; V55-E58 PolarHBondContact O-N 3.34Å; E58-R60 PolarHBondContact O-N 3.4Å; E58-K61 PolarHBondContact O-N 3.4Å; E58-A62 WeakPolarHBondContact O-CB 3.3Å; E58-A62 PolarHBondContact O-N 3.44Å
59	L	85.8	Confident	78.7	Confident	106 Å²	106	96.8 Å²	96.8	56%	0.555	51%	0.507	S	S	*	.	H	α-helix	trans	-62.7	-40.9	177	-72.9	176.5	0	0	0	112.2	V55 I56 S63	V55-L59 HydrophobicContact CG1-CD1 3.84Å; V55-L59 HydrophobicContact CG1-CG 4.21Å; V55-L59 WeakPolarHBondContact O-CB 3.45Å; V55-L59 VanDerWaalsContact O-CG 3.28Å; V55-L59 WeakPolarHBondContact O-CG 3.28Å; V55-L59 PolarHBondContact O-N 2.94Å; I56-L59 PolarHBondContact O-N 3.04Å; L59-S63 VanDerWaalsContact O-CB 3.28Å; L59-S63 WeakPolarHBondContact O-CB 3.45Å; L59-S63 PolarHBondContact O-N 3.27Å; L59-S63 PolarHBondContact O-OG 3.13Å
60	R	83.6	Confident	76.7	Confident	131 Å²	131	96.2 Å²	96.2	49%	0.494	50%	0.503	S	S	.	.	H	α-helix	trans	-64.4	-44.1	175.1	-71.8	178.3	101.7	-109.6	3.4	111.1	G30 I56 K57 E58 S63 D64	G30-R60 PolarHBondContact O-NH2 2.95Å; I56-R60 WeakPolarHBondContact O-CB 3.41Å; I56-R60 WeakPolarHBondContact O-CG 3.49Å; I56-R60 PolarHBondContact O-N 3.24Å; K57-R60 PolarHBondContact O-N 3.44Å; E58-R60 PolarHBondContact O-N 3.4Å; R60-S63 PolarHBondContact O-N 3.1Å; R60-D64 WeakPolarHBondContact O-CB 3.25Å; R60-D64 PolarHBondContact O-N 3.1Å
61	K	81.9	Confident	74.5	Confident	168 Å²	168	93.4 Å²	93.4	73%	0.73	50%	0.498	S	S	*	.	H	α-helix	trans	-64.3	-42.4	177.6	-171.5	-179.7	-179.5	-175.2	0	112.4	K57 E58 S65	K57-K61 WeakPolarHBondContact O-CB 3.49Å; K57-K61 PolarHBondContact O-N 2.98Å; E58-K61 PolarHBondContact O-N 3.4Å; K61-S65 WeakPolarHBondContact O-CB 3.36Å; K61-S65 PolarHBondContact O-N 3.36Å; K61-S65 VanDerWaalsContact O-N 3.09Å
62	A	80.7	Confident	72.3	Confident	57 Å²	57	94 Å²	94	47%	0.471	50%	0.499	S	S	.	.	H	α-helix	trans	-66.8	-40	176.5	0	0	0	0	0	111.8	E58 S65 L66	E58-A62 WeakPolarHBondContact O-CB 3.3Å; E58-A62 PolarHBondContact O-N 3.44Å; A62-S65 PolarHBondContact O-N 3.42Å; A62-L66 VanDerWaalsContact O-CB 3.29Å; A62-L66 WeakPolarHBondContact O-CB 3.44Å; A62-L66 PolarHBondContact O-N 3.31Å
63	S	78.7	Confident	70.3	Confident	67 Å²	67	94.4 Å²	94.4	47%	0.469	51%	0.508	S	S	.	.	H	α-helix	trans	-66.2	-39.8	177.6	-61	0	0	0	0	112.5	L59 R60 L66 K67	L59-S63 VanDerWaalsContact O-CB 3.28Å; L59-S63 WeakPolarHBondContact O-CB 3.45Å; L59-S63 PolarHBondContact O-N 3.27Å; L59-S63 PolarHBondContact O-OG 3.13Å; R60-S63 PolarHBondContact O-N 3.1Å; S63-L66 PolarHBondContact O-N 2.89Å; S63-K67 PolarHBondContact O-N 3.25Å
64	D	73.3	Confident	68.4	Low	110 Å²	110	96.5 Å²	96.5	59%	0.588	52%	0.516	S	S	*	.	H	α-helix	trans	-63.8	-47.3	174.7	-166.3	-84.5	0	0	0	111.3	R60 L66 K67 V68	R60-D64 WeakPolarHBondContact O-CB 3.25Å; R60-D64 PolarHBondContact O-N 3.1Å; D64-L66 VanDerWaalsContact C-N 3.29Å; D64-L66 PolarHBondContact O-N 3.42Å; D64-K67 PolarHBondContact O-N 3.34Å; D64-V68 WeakPolarHBondContact O-CG2 3.4Å; D64-V68 PolarHBondContact O-N 3.15Å; D64-V68 VanDerWaalsContact O-N 3.16Å
65	S	69.8	Low	66.4	Low	69 Å²	69	101.6 Å²	101.6	48%	0.483	53%	0.525	S	S	.	.	H	α-helix	trans	-59	-37.8	172.6	172.8	0	0	0	0	113	K61 A62 V68 R69	K61-S65 WeakPolarHBondContact O-CB 3.36Å; K61-S65 PolarHBondContact O-N 3.36Å; K61-S65 VanDerWaalsContact O-N 3.09Å; A62-S65 PolarHBondContact O-N 3.42Å; S65-V68 PolarHBondContact O-N 3.34Å; S65-R69 PolarHBondContact O-N 3.25Å
66	L	64.8	Low	64.5	Low	96 Å²	96	103.7 Å²	103.7	50%	0.503	53%	0.534	S	S	.	.	H	α-helix	trans	-74.1	-36.6	178.9	-157.4	71	0	0	0	111.9	A62 S63 D64 V68 R69 T70	A62-L66 VanDerWaalsContact O-CB 3.29Å; A62-L66 WeakPolarHBondContact O-CB 3.44Å; A62-L66 PolarHBondContact O-N 3.31Å; S63-L66 PolarHBondContact O-N 2.89Å; D64-L66 VanDerWaalsContact C-N 3.29Å; D64-L66 PolarHBondContact O-N 3.42Å; L66-V68 VanDerWaalsContact C-N 3.28Å; L66-V68 PolarHBondContact O-N 3.04Å; L66-R69 CarbonylContact O-C 3.49Å; L66-R69 WeakPolarHBondContact O-CA 3.48Å; L66-R69 WeakPolarHBondContact O-CB 3.35Å; L66-R69 PolarHBondContact O-N 2.93Å; L66-T70 PolarHBondContact O-N 3.5Å
67	K	58	Low	62.5	Low	148 Å²	148	110.9 Å²	110.9	64%	0.643	56%	0.558	S	S	*	*	H	α-helix	trans	-58.5	-40.5	171.9	-83.7	-178.6	175.9	-177	0	111.6	S63 D64 R69 T70 C71	S63-K67 PolarHBondContact O-N 3.25Å; D64-K67 PolarHBondContact O-N 3.34Å; K67-R69 VanDerWaalsContact C-N 3.26Å; K67-R69 PolarHBondContact O-N 3.13Å; K67-T70 WeakPolarHBondContact CA-OG1 3.35Å; K67-T70 PolarHBondContact O-N 2.94Å; K67-T70 PolarHBondContact O-OG1 3.33Å; K67-C71 PolarHBondContact O-N 3.15Å; K67-C71 PolarHBondContact O-SG 3.03Å
68	V	52.5	Low	60.6	Low	90 Å²	90	111.5 Å²	111.5	55%	0.545	56%	0.558	S	S	.	*	H	α-helix	trans	-60.4	-38	173.4	172.2	0	0	0	0	111.3	D64 S65 L66 S72	D64-V68 WeakPolarHBondContact O-CG2 3.4Å; D64-V68 PolarHBondContact O-N 3.15Å; D64-V68 VanDerWaalsContact O-N 3.16Å; S65-V68 PolarHBondContact O-N 3.34Å; L66-V68 VanDerWaalsContact C-N 3.28Å; L66-V68 PolarHBondContact O-N 3.04Å; V68-S72 PolarHBondContact O-N 3.2Å; V68-S72 PolarHBondContact O-OG 3.49Å
69	R	48.2	Very low	58.7	Low	171 Å²	171	111.2 Å²	111.2	65%	0.645	56%	0.56	S	S	*	*	H	α-helix	trans	-74.5	-31.7	176.3	-70.4	-179.7	69.6	-155.2	2.3	113.1	S65 L66 K67 S72 G73	S65-R69 PolarHBondContact O-N 3.25Å; L66-R69 CarbonylContact O-C 3.49Å; L66-R69 WeakPolarHBondContact O-CA 3.48Å; L66-R69 WeakPolarHBondContact O-CB 3.35Å; L66-R69 PolarHBondContact O-N 2.93Å; K67-R69 VanDerWaalsContact C-N 3.26Å; K67-R69 PolarHBondContact O-N 3.13Å; R69-S72 CarbonylContact O-C 3.53Å; R69-S72 PolarHBondContact O-N 3.49Å; R69-G73 WeakPolarHBondContact O-CA 3.41Å; R69-G73 PolarHBondContact O-N 3.32Å
70	T	46.4	Very low	57	Low	72 Å²	72	114.1 Å²	114.1	44%	0.442	57%	0.571	S	S	.	*	H	α-helix	trans	-73.8	-32.5	175.8	56.1	0	0	0	0	111.6	L66 K67 S72 G73 D74	L66-T70 PolarHBondContact O-N 3.5Å; K67-T70 WeakPolarHBondContact CA-OG1 3.35Å; K67-T70 PolarHBondContact O-N 2.94Å; K67-T70 PolarHBondContact O-OG1 3.33Å; T70-S72 PolarHBondContact O-N 3.1Å; T70-G73 PolarHBondContact O-N 3.39Å; T70-D74 PolarHBondContact O-N 2.86Å
71	C	41	Very low	55.3	Low	90 Å²	90	114.1 Å²	114.1	61%	0.608	58%	0.581	S	S	*	*	H	α-helix	trans	-71.2	-17.2	170.4	-57.8	0	0	0	0	113.8	K67	K67-C71 PolarHBondContact O-N 3.15Å; K67-C71 PolarHBondContact O-SG 3.03Å
72	S	44.3	Very low	53.8	Low	64 Å²	64	109.5 Å²	109.5	45%	0.448	58%	0.581	S	S	.	*	H	α-helix	trans	-98.3	-22	171.3	-59.5	0	0	0	0	112.8	V68 R69 T70	V68-S72 PolarHBondContact O-N 3.2Å; V68-S72 PolarHBondContact O-OG 3.49Å; R69-S72 CarbonylContact O-C 3.53Å; R69-S72 PolarHBondContact O-N 3.49Å; T70-S72 PolarHBondContact O-N 3.1Å
73	G	45.9	Very low	52.5	Low	31 Å²	31	111.1 Å²	111.1	32%	0.32	59%	0.585	S	S	.	*	H	α-helix	trans	-88.2	-15.4	-175.1	0	0	0	0	0	115.2	R69 T70	R69-G73 WeakPolarHBondContact O-CA 3.41Å; R69-G73 PolarHBondContact O-N 3.32Å; T70-G73 PolarHBondContact O-N 3.39Å
74	D	45.8	Very low	51.4	Low	92 Å²	92	114.1 Å²	114.1	49%	0.492	60%	0.596	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.2	-2.3	170.8	-73	-57	0	0	0	113.4	T70	T70-D74 PolarHBondContact O-N 2.86Å
75	R	47.6	Very low	50.3	Low	173 Å²	173	119.4 Å²	119.4	65%	0.653	61%	0.607	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.8	-34.8	170.8	-86.6	-168.6	-85.5	-147.6	-2.3	113.3
76	D	47.2	Very low	49.5	Very low	123 Å²	123	123.2 Å²	123.2	66%	0.658	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.1	-23.8	-179.6	-69.2	-40.5	0	0	0	113.1
77	R	45	Very low	48.9	Very low	188 Å²	188	124.2 Å²	124.2	71%	0.709	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.5	-18.1	179	-101.2	-168.2	-92.9	157.2	-5.9	115.2
78	Y	45	Very low	48.5	Very low	158 Å²	158	123.7 Å²	123.7	62%	0.62	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.9	-18	-178.7	-105.1	-86.8	0	0	0	114.7
79	L	47.9	Very low	48.2	Very low	131 Å²	131	128.1 Å²	128.1	69%	0.686	65%	0.65	S	S	*	*	G	3₁₀ helix	trans	-81.9	-12.2	178.7	-78.7	156.8	0	0	0	113.6	N81	L79-N81 VanDerWaalsContact C-N 3.34Å
80	Q	48.6	Very low	48.2	Very low	168 Å²	168	129.4 Å²	129.4	79%	0.785	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-79.1	-14.9	178.9	-145.7	90.6	30.1	0	0	113.5
81	N	49.3	Very low	48.1	Very low	130 Å²	130	129.1 Å²	129.1	70%	0.695	68%	0.675	S	S	*	*	G	3₁₀ helix	trans	-112.4	12.6	-170.8	-74.1	-24.1	0	0	0	115.5	L79 V83	L79-N81 VanDerWaalsContact C-N 3.34Å; N81-V83 VanDerWaalsContact C-N 3.34Å; N81-V83 HydrophobicContact CB-CG2 4.48Å; N81-V83 PolarHBondContact O-N 3.25Å
82	G	50.6	Low	48.3	Very low	72 Å²	72	131.1 Å²	131.1	74%	0.742	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	60.9	34.7	169.6	0	0	0	0	0	115.6
83	V	52.4	Low	48.4	Very low	91 Å²	91	133.9 Å²	133.9	55%	0.552	71%	0.705	S	S	*	*			trans	-93.3	125.7	177.6	-170.6	0	0	0	0	109.8	N81	N81-V83 VanDerWaalsContact C-N 3.34Å; N81-V83 HydrophobicContact CB-CG2 4.48Å; N81-V83 PolarHBondContact O-N 3.25Å
84	N	55	Low	48.2	Very low	130 Å²	130	141 Å²	141	70%	0.695	73%	0.729	S	S	*	*			trans	-55.6	141.6	-179.8	-66.7	-65.6	0	0	0	112.3	D86	N84-D86 PolarHBondContact O-N 3.21Å; N84-D86 VanDerWaalsContact O-N 3.07Å
85	R	51.2	Low	47.8	Very low	221 Å²	221	149.9 Å²	149.9	83%	0.834	76%	0.764	S	S	*	*	G	3₁₀ helix	trans	-67.1	-4.5	-171	-76.1	-171.8	-175.1	-176.8	2.4	115.6	T87	R85-T87 VanDerWaalsContact C-N 3.3Å; R85-T87 PolarHBondContact O-N 2.96Å
86	D	53.4	Low	47.8	Very low	149 Å²	149	148.8 Å²	148.8	80%	0.797	77%	0.77	S	S	*	*	G	3₁₀ helix	trans	-81.1	0.5	-167.1	-54.5	-56.4	0	0	0	115	N84	N84-D86 PolarHBondContact O-N 3.21Å; N84-D86 VanDerWaalsContact O-N 3.07Å
87	T	52	Low	47.9	Very low	117 Å²	117	150.1 Å²	150.1	72%	0.718	78%	0.776	S	S	*	*	G	3₁₀ helix	trans	-107.6	8.9	-174.6	-42.3	0	0	0	0	114.5	R85	R85-T87 VanDerWaalsContact C-N 3.3Å; R85-T87 PolarHBondContact O-N 2.96Å
88	I	48.4	Very low	48	Very low	137 Å²	137	148 Å²	148	70%	0.703	78%	0.78	S	S	*	*			trans	-107.4	60.9	-176.9	-47.5	-65.9	0	0	0	111.4
89	E	47.6	Very low	48.2	Very low	182 Å²	182	147.4 Å²	147.4	85%	0.85	79%	0.789	S	S	*	*	S	Bend	trans	-140.8	14.6	174.8	-97.1	-89	98.4	0	0	113.7
90	Q	47.5	Very low	48.2	Very low	198 Å²	198	148.4 Å²	148.4	93%	0.925	80%	0.795	S	S	*	*	S	Bend	trans	-146.9	86.4	174.8	-66.3	-172.2	6.7	0	0	111.4
91	G	45.1	Very low	48.2	Very low	67 Å²	67	147.1 Å²	147.1	69%	0.691	80%	0.796	S	S	*	*			trans	171.3	23.8	173.5	0	0	0	0	0	118.5	P93	G91-P93 VanDerWaalsContact C-CD 3.49Å; G91-P93 VanDerWaalsContact O-CD 3.28Å; G91-P93 WeakPolarHBondContact O-CD 3.28Å
92	C	44.8	Very low	48.1	Very low	132 Å²	132	148.4 Å²	148.4	89%	0.892	80%	0.803	S	S	*	*			trans	-107	87.6	164.1	-66.3	0	0	0	0	108.4	H94	C92-H94 PolarHBondContact O-N 3.28Å
93	P	46.2	Very low	47.9	Very low	122 Å²	122	154.2 Å²	154.2	79%	0.792	81%	0.808	S	S	*	*			trans	-69.6	112.9	165.7	28.4	-29	0	0	0	107.7	G91 F95	G91-P93 VanDerWaalsContact C-CD 3.49Å; G91-P93 VanDerWaalsContact O-CD 3.28Å; G91-P93 WeakPolarHBondContact O-CD 3.28Å; P93-F95 PolarHBondContact O-N 3.34Å
94	H	42.6	Very low	47.6	Very low	179 Å²	179	159.5 Å²	159.5	83%	0.829	83%	0.829	S	S	*	*			trans	-76.2	100.5	167.8	-159.8	108.6	0	0	0	107.2	C92	C92-H94 PolarHBondContact O-N 3.28Å
95	F	36.9	Very low	46.9	Very low	280 Å²	280	162.2 Å²	162.2	100%	1.228	84%	0.842	S	S	*	*			trans	-158.9	0	154.8	-99.5	-71.9	0	0	0	109.7	P93	P93-F95 PolarHBondContact O-N 3.34Å

Retrieved 95 of 95 residues in 51.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).