A0A061AE10_CAEEL Loading...

NADH dehydrogenase subunit 5

AlphaFold DB , UniProt , Accession A0A061AE10, Species CAEEL (Caenorhabditis elegans), Gene n/a, Length 34 aa.

						>A0A061AE10_CAEEL|A0A061AE10
MLLLLLLLLSTTQLDLLIWTKGPGSSYQNQSING
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	81.9	Confident	85.4	Confident	211 Å²	211	117.5 Å²	117.5	100%	1.039	62%	0.622	S	S	*	*				0	-44.1	0	-62.3	-143.5	170.3	0	112.7	L3 L4	M1-L3 PolarHBondContact O-N 3.31Å; M1-L3 VanDerWaalsContact C-N 3.3Å; M1-L4 VanDerWaalsContact O-N 3.16Å; M1-L4 PolarHBondContact O-N 3.07Å
2	L	90.6	Very high	84.8	Confident	134 Å²	134	113.1 Å²	113.1	70%	0.702	60%	0.604	S	S	*	*	H	α-helix	trans	-56.8	-36.8	179.9	-162.5	146.8	0	0	114.5	L4 L5 L6	L2-L4 PolarHBondContact O-N 3.15Å; L2-L4 VanDerWaalsContact C-N 3.31Å; L2-L5 PolarHBondContact O-N 2.62Å; L2-L6 HydrophobicContact CD2-CD1 4.48Å; L2-L6 PolarHBondContact O-N 2.67Å
3	L	90.8	Very high	83.9	Confident	148 Å²	148	113.5 Å²	113.5	78%	0.775	60%	0.6	S	S	*	*	H	α-helix	trans	-57.4	-39.9	176.9	-168.6	80.8	0	0	113.3	M1 L6 L7	M1-L3 PolarHBondContact O-N 3.31Å; M1-L3 VanDerWaalsContact C-N 3.3Å; L3-L6 PolarHBondContact O-N 2.82Å; L3-L7 PolarHBondContact O-N 3.2Å
4	L	88.8	Confident	82.8	Confident	132 Å²	132	112.6 Å²	112.6	69%	0.691	60%	0.595	S	S	*	*	H	α-helix	trans	-66.9	-38.9	-179.4	-101.5	157.4	0	0	111.8	M1 L2 L6 L7 L8	M1-L4 VanDerWaalsContact O-N 3.16Å; M1-L4 PolarHBondContact O-N 3.07Å; L2-L4 PolarHBondContact O-N 3.15Å; L2-L4 VanDerWaalsContact C-N 3.31Å; L4-L6 VanDerWaalsContact C-N 3.33Å; L4-L7 PolarHBondContact O-N 2.88Å; L4-L8 PolarHBondContact O-N 2.88Å
5	L	86	Confident	81.9	Confident	121 Å²	121	112.6 Å²	112.6	63%	0.634	60%	0.595	S	S	*	*	H	α-helix	trans	-65.6	-38.6	176.2	-69	171.9	0	0	111.6	L2 L8 L9	L2-L5 PolarHBondContact O-N 2.62Å; L5-L8 PolarHBondContact O-N 3.21Å; L5-L9 WeakPolarHBondContact O-CB 2.77Å; L5-L9 PolarHBondContact O-N 3.29Å
6	L	87.3	Confident	81.1	Confident	111 Å²	111	111.9 Å²	111.9	58%	0.581	59%	0.591	S	S	*	*	H	α-helix	trans	-69.6	-37.1	-180	-153.4	138.8	0	0	111.7	L2 L3 L4 S10	L2-L6 HydrophobicContact CD2-CD1 4.48Å; L2-L6 PolarHBondContact O-N 2.67Å; L3-L6 PolarHBondContact O-N 2.82Å; L4-L6 VanDerWaalsContact C-N 3.33Å; L6-S10 PolarHBondContact O-N 3.07Å; L6-S10 PolarHBondContact O-OG 2.83Å
7	L	87.2	Confident	80.3	Confident	109 Å²	109	109.8 Å²	109.8	57%	0.571	58%	0.58	S	S	*	*	H	α-helix	trans	-65.4	-42.9	172.1	-172.1	70.9	0	0	111.7	L3 L4 S10 T11	L3-L7 PolarHBondContact O-N 3.2Å; L4-L7 PolarHBondContact O-N 2.88Å; L7-S10 PolarHBondContact O-N 2.79Å; L7-S10 PolarHBondContact O-OG 2.91Å; L7-T11 PolarHBondContact O-OG1 3.24Å; L7-T11 PolarHBondContact O-N 3.3Å; L7-T11 WeakPolarHBondContact O-CG2 3.44Å; L7-T11 VanDerWaalsContact O-N 3.13Å
8	L	86.5	Confident	79.3	Confident	112 Å²	112	110.1 Å²	110.1	59%	0.586	58%	0.58	S	S	*	*	H	α-helix	trans	-64.2	-45	177.2	-171.9	65.5	0	0	111	L4 L5 S10 T11 T12	L4-L8 PolarHBondContact O-N 2.88Å; L5-L8 PolarHBondContact O-N 3.21Å; L8-S10 PolarHBondContact O-N 3.24Å; L8-T11 PolarHBondContact O-N 3.42Å; L8-T11 PolarHBondContact O-OG1 3.48Å; L8-T12 WeakPolarHBondContact O-CG2 3.36Å; L8-T12 PolarHBondContact O-N 3.06Å
9	L	83.1	Confident	78.5	Confident	96 Å²	96	114.7 Å²	114.7	50%	0.503	59%	0.589	S	S	.	*	H	α-helix	trans	-59.9	-44.3	177.6	-174.6	64.4	0	0	111.7	L5 T11 T12 Q13	L5-L9 WeakPolarHBondContact O-CB 2.77Å; L5-L9 PolarHBondContact O-N 3.29Å; L9-T11 VanDerWaalsContact C-N 3.33Å; L9-T11 PolarHBondContact O-N 3.49Å; L9-T12 PolarHBondContact O-N 3.04Å; L9-T12 PolarHBondContact O-OG1 3.41Å; L9-T12 WeakPolarHBondContact CA-OG1 3.48Å; L9-Q13 WeakPolarHBondContact O-CG 3.44Å; L9-Q13 PolarHBondContact O-N 3.06Å
10	S	78.8	Confident	77.6	Confident	46 Å²	46	113.6 Å²	113.6	32%	0.322	59%	0.588	S	S	.	*	H	α-helix	trans	-64.1	-37.3	179.1	67.9	0	0	0	112.4	L6 L7 L8 Q13 L14	L6-S10 PolarHBondContact O-N 3.07Å; L6-S10 PolarHBondContact O-OG 2.83Å; L7-S10 PolarHBondContact O-N 2.79Å; L7-S10 PolarHBondContact O-OG 2.91Å; L8-S10 PolarHBondContact O-N 3.24Å; S10-Q13 PolarHBondContact O-N 2.74Å; S10-L14 WeakPolarHBondContact O-CG 3.48Å; S10-L14 PolarHBondContact O-N 3.42Å
11	T	78.9	Confident	76.8	Confident	72 Å²	72	115.8 Å²	115.8	44%	0.442	59%	0.593	S	S	.	*	H	α-helix	trans	-65.5	-40.6	174.3	59.6	0	0	0	112.5	L7 L8 L9 Q13 L14 D15	L7-T11 PolarHBondContact O-OG1 3.24Å; L7-T11 PolarHBondContact O-N 3.3Å; L7-T11 WeakPolarHBondContact O-CG2 3.44Å; L7-T11 VanDerWaalsContact O-N 3.13Å; L8-T11 PolarHBondContact O-N 3.42Å; L8-T11 PolarHBondContact O-OG1 3.48Å; L9-T11 VanDerWaalsContact C-N 3.33Å; L9-T11 PolarHBondContact O-N 3.49Å; T11-Q13 PolarHBondContact O-N 2.91Å; T11-L14 PolarHBondContact O-N 3.45Å; T11-D15 PolarHBondContact O-N 3.01Å
12	T	77.4	Confident	75.4	Confident	65 Å²	65	106.2 Å²	106.2	40%	0.399	55%	0.549	S	S	.	.	H	α-helix	trans	-67.1	-35.6	177.2	59.6	0	0	0	113.1	L8 L9 L16	L8-T12 WeakPolarHBondContact O-CG2 3.36Å; L8-T12 PolarHBondContact O-N 3.06Å; L9-T12 PolarHBondContact O-N 3.04Å; L9-T12 PolarHBondContact O-OG1 3.41Å; L9-T12 WeakPolarHBondContact CA-OG1 3.48Å; T12-L16 PolarHBondContact O-N 3.25Å; T12-L16 WeakPolarHBondContact O-CB 3.21Å; T12-L16 VanDerWaalsContact O-N 3.07Å
13	Q	73.1	Confident	74	Confident	118 Å²	118	107 Å²	107	55%	0.551	56%	0.561	S	S	*	*	H	α-helix	trans	-70.5	-39.5	176.8	-73.1	-179.1	-15.7	0	112	L9 S10 T11 L17	L9-Q13 WeakPolarHBondContact O-CG 3.44Å; L9-Q13 PolarHBondContact O-N 3.06Å; S10-Q13 PolarHBondContact O-N 2.74Å; T11-Q13 PolarHBondContact O-N 2.91Å; Q13-L17 VanDerWaalsContact O-CB 3.29Å; Q13-L17 WeakPolarHBondContact O-CB 3.44Å; Q13-L17 PolarHBondContact O-N 3.42Å
14	L	69.3	Low	72.4	Confident	101 Å²	101	102 Å²	102	53%	0.529	55%	0.546	S	S	.	.	H	α-helix	trans	-65.2	-40.7	175.7	-73.2	171.2	0	0	111.3	S10 T11 L17 I18	S10-L14 WeakPolarHBondContact O-CG 3.48Å; S10-L14 PolarHBondContact O-N 3.42Å; T11-L14 PolarHBondContact O-N 3.45Å; L14-L17 PolarHBondContact O-N 3.03Å; L14-I18 WeakPolarHBondContact O-CB 3.29Å; L14-I18 WeakPolarHBondContact O-CD1 3.44Å; L14-I18 WeakPolarHBondContact O-CG1 3.46Å; L14-I18 PolarHBondContact O-N 3.45Å
15	D	69.4	Low	70.8	Confident	113 Å²	113	100.1 Å²	100.1	60%	0.604	54%	0.544	S	S	*	.	H	α-helix	trans	-65.6	-44.2	177.7	-162.7	-114	0	0	112	T11 L17 I18 W19	T11-D15 PolarHBondContact O-N 3.01Å; D15-L17 VanDerWaalsContact C-N 3.33Å; D15-L17 PolarHBondContact O-N 3.44Å; D15-I18 CarbonylContact O-C 3.49Å; D15-I18 PolarHBondContact O-N 3.2Å; D15-W19 WeakPolarHBondContact O-CB 3.44Å; D15-W19 PolarHBondContact O-N 3.34Å
16	L	67.8	Low	69.3	Low	101 Å²	101	98.9 Å²	98.9	53%	0.529	55%	0.546	S	S	.	.	H	α-helix	trans	-61.9	-38.6	172.7	-81.8	161.8	0	0	112.6	T12 W19 T20	T12-L16 PolarHBondContact O-N 3.25Å; T12-L16 WeakPolarHBondContact O-CB 3.21Å; T12-L16 VanDerWaalsContact O-N 3.07Å; L16-W19 PolarHBondContact O-N 3.13Å; L16-T20 PolarHBondContact O-OG1 2.91Å; L16-T20 PolarHBondContact O-N 3.42Å; L16-T20 WeakPolarHBondContact O-CB 3.5Å; L16-T20 WeakPolarHBondContact O-CG2 3.42Å
17	L	68.4	Low	67.9	Low	77 Å²	77	104 Å²	104	40%	0.403	56%	0.559	S	S	.	*	H	α-helix	trans	-67.9	-40.5	176	-173.8	65.6	0	0	111.2	Q13 L14 D15 W19 T20 K21	Q13-L17 VanDerWaalsContact O-CB 3.29Å; Q13-L17 WeakPolarHBondContact O-CB 3.44Å; Q13-L17 PolarHBondContact O-N 3.42Å; L14-L17 PolarHBondContact O-N 3.03Å; D15-L17 VanDerWaalsContact C-N 3.33Å; D15-L17 PolarHBondContact O-N 3.44Å; L17-W19 VanDerWaalsContact C-N 3.26Å; L17-W19 PolarHBondContact O-N 2.72Å; L17-T20 WeakPolarHBondContact CA-OG1 3.33Å; L17-T20 PolarHBondContact O-OG1 3.07Å; L17-K21 WeakPolarHBondContact O-CG 3.4Å; L17-K21 PolarHBondContact O-N 3.46Å; L17-K21 WeakPolarHBondContact O-CB 3.18Å; L17-K21 HydrophobicContact CG-CD 4.12Å; L17-K21 HydrophobicContact CD1-CG 4.2Å; L17-K21 HydrophobicContact CD1-CD 3.92Å
18	I	62.4	Low	66.4	Low	114 Å²	114	107.6 Å²	107.6	59%	0.585	57%	0.573	S	S	*	*	H	α-helix	trans	-70.6	-22.5	174.2	-66.8	162.8	0	0	111	L14 D15 G22	L14-I18 WeakPolarHBondContact O-CB 3.29Å; L14-I18 WeakPolarHBondContact O-CD1 3.44Å; L14-I18 WeakPolarHBondContact O-CG1 3.46Å; L14-I18 PolarHBondContact O-N 3.45Å; D15-I18 CarbonylContact O-C 3.49Å; D15-I18 PolarHBondContact O-N 3.2Å; I18-G22 WeakPolarHBondContact O-CA 3.4Å; I18-G22 PolarHBondContact O-N 3.01Å
19	W	63.8	Low	65	Low	199 Å²	199	109.4 Å²	109.4	75%	0.754	58%	0.583	S	S	*	*	H	α-helix	trans	-80.8	-44.4	173	-177.3	65.3	0	0	111.9	D15 L16 L17 G22	D15-W19 WeakPolarHBondContact O-CB 3.44Å; D15-W19 PolarHBondContact O-N 3.34Å; L16-W19 PolarHBondContact O-N 3.13Å; L17-W19 VanDerWaalsContact C-N 3.26Å; L17-W19 PolarHBondContact O-N 2.72Å; W19-G22 PolarHBondContact O-N 3.36Å
20	T	61.3	Low	63.6	Low	92 Å²	92	113.3 Å²	113.3	56%	0.564	60%	0.598	S	S	*	*	H	α-helix	trans	-71.1	-31.9	177.5	52.9	0	0	0	113.3	L16 L17	L16-T20 PolarHBondContact O-OG1 2.91Å; L16-T20 PolarHBondContact O-N 3.42Å; L16-T20 WeakPolarHBondContact O-CB 3.5Å; L16-T20 WeakPolarHBondContact O-CG2 3.42Å; L17-T20 WeakPolarHBondContact CA-OG1 3.33Å; L17-T20 PolarHBondContact O-OG1 3.07Å
21	K	59.5	Low	62.6	Low	160 Å²	160	116.3 Å²	116.3	70%	0.696	62%	0.619	S	S	*	*	S	Bend	trans	-95.1	-6.5	167.7	-61.9	-176.6	174.7	175.3	113.1	L17	L17-K21 WeakPolarHBondContact O-CG 3.4Å; L17-K21 PolarHBondContact O-N 3.46Å; L17-K21 WeakPolarHBondContact O-CB 3.18Å; L17-K21 HydrophobicContact CG-CD 4.12Å; L17-K21 HydrophobicContact CD1-CG 4.2Å; L17-K21 HydrophobicContact CD1-CD 3.92Å
22	G	52.9	Low	61.8	Low	10 Å²	10	121 Å²	121	10%	0.103	64%	0.64	C	S	.	*	S	Bend	trans	-63.8	174.8	170.9	0	0	0	0	109.9	I18 W19 G24	I18-G22 WeakPolarHBondContact O-CA 3.4Å; I18-G22 PolarHBondContact O-N 3.01Å; W19-G22 PolarHBondContact O-N 3.36Å; G22-G24 PolarHBondContact O-N 3.33Å
23	P	60.4	Low	60.8	Low	149 Å²	149	126 Å²	126	97%	0.968	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.2	62.8	-160.4	29.6	-36.3	0	0	114.1
24	G	57.5	Low	59.5	Low	44 Å²	44	126.4 Å²	126.4	45%	0.454	70%	0.7	S	S	.	*	T	Hydrogen-bonded Turn	trans	-128.3	3.4	169.2	0	0	0	0	113	G22 S26	G22-G24 PolarHBondContact O-N 3.33Å; G24-S26 PolarHBondContact O-N 3.25Å; G24-S26 VanDerWaalsContact O-N 3.15Å
25	S	55.2	Low	59	Low	92 Å²	92	127.7 Å²	127.7	64%	0.643	71%	0.708	S	S	*	*			trans	-85.1	33.9	174.2	-164.4	0	0	0	113.9	Y27	S25-Y27 PolarHBondContact O-N 3.26Å; S25-Y27 VanDerWaalsContact O-N 3.07Å
26	S	55.8	Low	58.5	Low	96 Å²	96	128.4 Å²	128.4	67%	0.671	71%	0.714	S	S	*	*	G	3₁₀ helix	trans	-65.2	5.7	162.2	-63.4	0	0	0	113.2	G24 Q28	G24-S26 PolarHBondContact O-N 3.25Å; G24-S26 VanDerWaalsContact O-N 3.15Å; S26-Q28 PolarHBondContact O-N 3.16Å
27	Y	57.2	Low	57.9	Low	218 Å²	218	129.9 Å²	129.9	86%	0.855	72%	0.724	S	S	*	*	G	3₁₀ helix	trans	-74.3	-0.9	174.9	-79.6	-77.6	0	0	114.9	S25	S25-Y27 PolarHBondContact O-N 3.26Å; S25-Y27 VanDerWaalsContact O-N 3.07Å
28	Q	55.8	Low	57.3	Low	185 Å²	185	133.1 Å²	133.1	86%	0.864	74%	0.743	S	S	*	*	G	3₁₀ helix	trans	-114.1	12.8	176.5	-134	-177	24.3	0	115.1	S26	S26-Q28 PolarHBondContact O-N 3.16Å
29	N	57.6	Low	57	Low	150 Å²	150	134.3 Å²	134.3	80%	0.802	75%	0.753	S	S	*	*	S	Bend	trans	-132.2	56.5	168	-159	15.7	0	0	111.8
30	Q	53.9	Low	56.6	Low	177 Å²	177	129.9 Å²	129.9	83%	0.827	75%	0.753	S	S	*	*	S	Bend	trans	-132.1	122.8	156.4	-70.3	-166.3	49.8	0	108.9
31	S	57.5	Low	56.2	Low	109 Å²	109	132.6 Å²	132.6	76%	0.762	77%	0.766	S	S	*	*			trans	84.3	63.7	160.5	-156.8	0	0	0	119.3
32	I	61.7	Low	56	Low	170 Å²	170	130.5 Å²	130.5	87%	0.872	77%	0.772	S	S	*	*			trans	-124.5	61.2	137.6	8	170.2	0	0	108.2
33	N	57.2	Low	56.2	Low	171 Å²	171	140.6 Å²	140.6	91%	0.914	83%	0.828	S	S	*	*			trans	-124.3	56.2	156.2	-149.7	-3.4	0	0	107.2
34	G	45.1	Very low	55.8	Low	126 Å²	126	139.8 Å²	139.8	100%	1.299	82%	0.815	S	S	*	*			trans	-151.6	0	170.6	0	0	0	0	106.9

Retrieved 34 of 34 residues in 16.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).