A0A061AE89_CAEEL Loading...

Vps8 domain-containing protein

AlphaFold DB , UniProt , Accession A0A061AE89, Species CAEEL (Caenorhabditis elegans), Gene vps-8, Length 89 aa.

						>A0A061AE89_CAEEL|A0A061AE89|vps-8
MEVSRRAPLMHNPNCITCEQPMHKSGYVFRCGHFQHIECSTNIDRTCTCDGIPDRLVVPREKPDRPEKRNIFENWDTKLNCRVFPKDSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	31.8	Very low	35.1	Very low	237 Å²	237	158.5 Å²	158.5	100%	1.167	79%	0.794	S	S	*	*				0	110.4	0	-83.2	174.9	172.6	0	0	107.8
2	E	27.1	Very low	36.1	Very low	203 Å²	203	150.3 Å²	150.3	95%	0.949	75%	0.754	S	S	*	*			trans	-71	124.3	-179.4	-66.7	173.1	123.3	0	0	109.8
3	V	30.4	Very low	37.3	Very low	130 Å²	130	144.5 Å²	144.5	79%	0.788	73%	0.734	S	S	*	*			trans	-105.6	111.8	175.2	-168.1	0	0	0	0	107.7
4	S	28.9	Very low	38.3	Very low	88 Å²	88	139.4 Å²	139.4	62%	0.615	71%	0.709	S	S	*	*			trans	-48.6	142.5	175.9	-171.7	0	0	0	0	111.1	R6	S4-R6 PolarHBondContact O-N 3.34Å
5	R	40.9	Very low	39.1	Very low	262 Å²	262	130.7 Å²	130.7	99%	0.989	67%	0.665	S	S	*	*	S	Bend	trans	-63.4	18	-179.9	-66.4	179.4	178.5	177	-0.3	114.9
6	R	34.8	Very low	39.7	Very low	204 Å²	204	130.1 Å²	130.1	77%	0.77	66%	0.663	S	S	*	*	S	Bend	trans	-115.1	122.5	177.5	-62.5	179.8	-175.3	-172.8	0.9	105.4	S4	S4-R6 PolarHBondContact O-N 3.34Å
7	A	35.3	Very low	40	Very low	70 Å²	70	129 Å²	129	58%	0.579	66%	0.664	S	S	*	*			trans	-46.7	134.6	170.1	0	0	0	0	0	108.3	L9	A7-L9 PolarHBondContact O-N 3.05Å
8	P	34.7	Very low	40.3	Very low	109 Å²	109	125.4 Å²	125.4	71%	0.708	65%	0.651	S	S	*	*			trans	-54.3	119.5	177.2	20.7	-29.5	0	0	0	107.4	M10	P8-M10 PolarHBondContact O-N 3.14Å
9	L	39.8	Very low	40.9	Very low	131 Å²	131	127.4 Å²	127.4	69%	0.686	66%	0.657	S	S	*	*			trans	-57.3	107.6	172.1	-86.9	130.9	0	0	0	106	A7 H11 Y27	A7-L9 PolarHBondContact O-N 3.05Å; L9-H11 PolarHBondContact O-N 3.36Å; L9-Y27 HydrophobicContact CD2-CE2 4.03Å
10	M	38.9	Very low	41.3	Very low	147 Å²	147	126.5 Å²	126.5	72%	0.724	65%	0.65	S	S	*	*			trans	-64.9	97.1	164.6	-70.7	-119.1	-57.7	0	0	105.9	P8 N12	P8-M10 PolarHBondContact O-N 3.14Å; M10-N12 VanDerWaalsContact C-N 3.26Å; M10-N12 PolarHBondContact O-N 3.28Å
11	H	43.6	Very low	41.8	Very low	163 Å²	163	125.1 Å²	125.1	76%	0.755	65%	0.649	S	S	*	*			trans	-75.5	87.3	173.3	179.1	-87.8	0	0	0	107.4	L9	L9-H11 PolarHBondContact O-N 3.36Å
12	N	46.7	Very low	42.6	Very low	60 Å²	60	115.6 Å²	115.6	32%	0.321	60%	0.602	S	S	.	*			trans	-88.7	118.1	166.8	-162.6	-13	0	0	0	107.6	M10 N14 I16 M22	M10-N12 VanDerWaalsContact C-N 3.26Å; M10-N12 PolarHBondContact O-N 3.28Å; N12-N14 PolarHBondContact ND2-O 2.8Å; N12-N14 PolarHBondContact O-N 3.37Å; N12-N14 PolarHBondContact OD1-N 3.36Å; N12-N14 PolarHBondContact OD1-O 3.45Å; N12-I16 WeakPolarHBondContact ND2-CG2 3.11Å; N12-M22 WeakPolarHBondContact O-CG 3.16Å
13	P	52.5	Low	43.6	Very low	75 Å²	75	114.7 Å²	114.7	49%	0.487	60%	0.598	S	S	.	*	S	Bend	trans	-64.9	-19.2	175.9	26.8	-34.8	0	0	0	112.2	P21 M22	P13-P21 WeakPolarHBondContact O-CA 3.16Å; P13-M22 PolarHBondContact O-N 3.44Å
14	N	50.7	Low	44.4	Very low	72 Å²	72	117.6 Å²	117.6	39%	0.385	60%	0.6	S	S	.	*	B	Isolated β-bridge	trans	-120.9	147.6	-175.2	-61.2	-20.6	0	0	0	111.7	N12 I16 Q20	N12-N14 PolarHBondContact ND2-O 2.8Å; N12-N14 PolarHBondContact O-N 3.37Å; N12-N14 PolarHBondContact OD1-N 3.36Å; N12-N14 PolarHBondContact OD1-O 3.45Å; N14-I16 PolarHBondContact O-N 2.72Å; N14-Q20 CarbonylContact C-O 3.55Å; N14-Q20 WeakPolarHBondContact CA-O 2.93Å
15	C	50.8	Low	45	Very low	9 Å²	9	116.6 Å²	116.6	6%	0.061	59%	0.593	C	S	.	*			trans	-66.5	126.9	176.3	-172.4	0	0	0	0	112.3	T17 C18 E19 Q20 E38	C15-T17 PolarHBondContact O-N 2.79Å; C15-T17 VanDerWaalsContact O-N 3.12Å; C15-T17 PolarHBondContact SG-N 3.25Å; C15-T17 VanDerWaalsContact SG-N 3.44Å; C15-C18 WeakPolarHBondContact CB-SG 3.34Å; C15-C18 PolarHBondContact O-N 3.24Å; C15-C18 VanDerWaalsContact SG-SG 3.66Å; C15-E19 WeakPolarHBondContact O-CA 2.91Å; C15-E19 PolarHBondContact O-N 2.83Å; C15-Q20 PolarHBondContact N-O 3.01Å; C15-E38 WeakPolarHBondContact CA-OE2 3.48Å; C15-E38 WeakPolarHBondContact CB-OE2 3.39Å; C15-E38 PolarHBondContact SG-OE2 2.93Å
16	I	48.7	Very low	45.2	Very low	122 Å²	122	105.7 Å²	105.7	63%	0.626	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.5	-17	176.6	62.4	169.3	0	0	0	113.2	N12 N14	N12-I16 WeakPolarHBondContact ND2-CG2 3.11Å; N14-I16 PolarHBondContact O-N 2.72Å
17	T	44.3	Very low	45.8	Very low	111 Å²	111	100.6 Å²	100.6	68%	0.681	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.5	-35.5	-178.1	-54.3	0	0	0	0	112.5	C15	C15-T17 PolarHBondContact O-N 2.79Å; C15-T17 VanDerWaalsContact O-N 3.12Å; C15-T17 PolarHBondContact SG-N 3.25Å; C15-T17 VanDerWaalsContact SG-N 3.44Å
18	C	45.3	Very low	46.1	Very low	64 Å²	64	100.1 Å²	100.1	43%	0.432	53%	0.533	S	S	.	.	T	Hydrogen-bonded Turn	trans	-130.1	3.4	-175.2	66.4	0	0	0	0	114.9	C15 Q20	C15-C18 WeakPolarHBondContact CB-SG 3.34Å; C15-C18 PolarHBondContact O-N 3.24Å; C15-C18 VanDerWaalsContact SG-SG 3.66Å; C18-Q20 PolarHBondContact O-N 3.1Å
19	E	51	Low	46.5	Very low	163 Å²	163	101.1 Å²	101.1	76%	0.762	53%	0.527	S	S	*	.			trans	57.7	7.6	179.7	-58.5	-178	174	0	0	115.3	C15	C15-E19 WeakPolarHBondContact O-CA 2.91Å; C15-E19 PolarHBondContact O-N 2.83Å
20	Q	49.1	Very low	46.4	Very low	109 Å²	109	101.4 Å²	101.4	51%	0.509	52%	0.518	S	S	.	.			trans	-81.7	155.7	178.2	-68.3	-174.1	-14.7	0	0	112.2	N14 C15 C18 M22	N14-Q20 CarbonylContact C-O 3.55Å; N14-Q20 WeakPolarHBondContact CA-O 2.93Å; C15-Q20 PolarHBondContact N-O 3.01Å; C18-Q20 PolarHBondContact O-N 3.1Å; Q20-M22 PolarHBondContact O-N 3.12Å
21	P	51.9	Low	46.2	Very low	99 Å²	99	98.1 Å²	98.1	64%	0.643	51%	0.509	S	S	*	.	B	Isolated β-bridge	trans	-57	130.8	177.8	-25.6	34.7	0	0	0	113.5	P13 H23	P13-P21 WeakPolarHBondContact O-CA 3.16Å; P21-H23 PolarHBondContact O-N 3.14Å
22	M	49.8	Very low	46	Very low	37 Å²	37	91.4 Å²	91.4	18%	0.182	48%	0.484	C	S	.	.			trans	-67.3	107.4	177.4	-82.3	-128	67.2	0	0	112	N12 P13 Q20 S25 E38	N12-M22 WeakPolarHBondContact O-CG 3.16Å; P13-M22 PolarHBondContact O-N 3.44Å; Q20-M22 PolarHBondContact O-N 3.12Å; M22-S25 WeakPolarHBondContact SD-CB 3.44Å; M22-S25 PolarHBondContact SD-OG 3.42Å; M22-S25 VanDerWaalsContact SD-OG 3.35Å; M22-E38 HydrophobicContact CE-CB 3.53Å; M22-E38 HydrophobicContact CE-CG 3.2Å; M22-E38 WeakPolarHBondContact CE-OE2 3.39Å; M22-E38 WeakPolarHBondContact CG-OE2 3.45Å; M22-E38 HydrophobicContact SD-CG 3.76Å
23	H	46.4	Very low	45.7	Very low	184 Å²	184	93.4 Å²	93.4	85%	0.852	49%	0.492	S	S	*	.	S	Bend	trans	-85.8	-16.8	177.1	-111.9	-83.4	0	0	0	114.5	P21	P21-H23 PolarHBondContact O-N 3.14Å
24	K	47.5	Very low	45.4	Very low	190 Å²	190	96.8 Å²	96.8	83%	0.826	50%	0.499	S	S	*	.			trans	-172.7	115.8	169.5	-104	163.8	-173.7	-179.2	0	109.3
25	S	41.7	Very low	45.1	Very low	67 Å²	67	96.4 Å²	96.4	47%	0.469	50%	0.495	S	S	.	.			trans	-95	136	171.8	13.3	0	0	0	0	111	M22 H36	M22-S25 WeakPolarHBondContact SD-CB 3.44Å; M22-S25 PolarHBondContact SD-OG 3.42Å; M22-S25 VanDerWaalsContact SD-OG 3.35Å; S25-H36 WeakPolarHBondContact CB-NE2 3.13Å
26	G	44.9	Very low	44.8	Very low	33 Å²	33	98.4 Å²	98.4	34%	0.34	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	149.1	168.1	0	0	0	0	0	110.6	I37	G26-I37 PolarHBondContact N-O 3.09Å; G26-I37 PolarHBondContact O-N 2.07Å
27	Y	48	Very low	44.7	Very low	98 Å²	98	96 Å²	96	38%	0.384	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	129.8	170.2	-69.4	-89.2	0	0	0	109.1	L9 Q35 H36	L9-Y27 HydrophobicContact CD2-CE2 4.03Å; Y27-Q35 WeakPolarHBondContact CA-O 3.36Å; Y27-H36 HydrophobicContact CD1-CB 4.31Å; Y27-H36 AromaticContact CD1-CD2 3.99Å; Y27-H36 HydrophobicContact CE1-CB 4.02Å; Y27-H36 AromaticContact CE1-CD2 3.58Å; Y27-H36 AromaticContact CE2-CD2 3.93Å; Y27-H36 AromaticContact CZ-CD2 3.54Å; Y27-H36 AromaticContact CZ-NE2 3.94Å
28	V	42.8	Very low	44.4	Very low	60 Å²	60	92 Å²	92	36%	0.364	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	133.4	172.5	-176.1	0	0	0	0	108.6	R30 Q35 I37	V28-R30 HydrophobicContact CG1-CG 4.24Å; V28-Q35 PolarHBondContact N-O 3.11Å; V28-Q35 PolarHBondContact O-N 3.15Å; V28-I37 HydrophobicContact CB-CD1 3.75Å; V28-I37 HydrophobicContact CB-CG1 4.21Å; V28-I37 HydrophobicContact CG2-CD1 3.37Å; V28-I37 HydrophobicContact CG2-CG1 3.96Å
29	F	41.2	Very low	44.1	Very low	130 Å²	130	93.1 Å²	93.1	57%	0.57	47%	0.472	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.5	108.9	173.4	-167.3	-99.1	0	0	0	108.7	H33 F34	F29-H33 WeakPolarHBondContact CA-O 3.43Å; F29-F34 AromaticContact CD2-CD2 3.96Å; F29-F34 HydrophobicContact CD2-CD2 3.96Å; F29-F34 AromaticContact CD2-CE2 3.96Å; F29-F34 HydrophobicContact CD2-CE2 3.96Å; F29-F34 HydrophobicContact CD2-CG 4.27Å; F29-F34 HydrophobicContact CD2-CZ 4.25Å; F29-F34 HydrophobicContact CE2-CD2 4.17Å; F29-F34 HydrophobicContact CE2-CE2 4.14Å
30	R	38.4	Very low	43.3	Very low	136 Å²	136	88.3 Å²	88.3	51%	0.513	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	138.9	179.4	-102	-168.4	171.1	-142.4	-0.8	110.3	V28 G32 H33	V28-R30 HydrophobicContact CG1-CG 4.24Å; R30-G32 PolarHBondContact O-N 3.18Å; R30-H33 PolarHBondContact N-O 2.89Å; R30-H33 PolarHBondContact O-N 3.39Å
31	C	34.8	Very low	42.8	Very low	78 Å²	78	89.9 Å²	89.9	53%	0.527	47%	0.474	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.3	35.8	172.8	-53.7	0	0	0	0	112.9	H33 C49	C31-H33 PolarHBondContact O-CE1 3.21Å; C31-H33 PolarHBondContact O-ND1 3.25Å; C31-C49 HydrophobicContact CB-CB 4.34Å; C31-C49 WeakPolarHBondContact CB-SG 3.37Å; C31-C49 WeakPolarHBondContact SG-CB 3.47Å; C31-C49 CovalentContact SG-SG 2.07Å; C31-C49 PolarHBondContact SG-SG 3.11Å
32	G	39	Very low	42.1	Very low	23 Å²	23	92.1 Å²	92.1	24%	0.237	48%	0.48	C	S	.	.	T	Hydrogen-bonded Turn	trans	85.2	-0.5	179.8	0	0	0	0	0	116.8	R30	R30-G32 PolarHBondContact O-N 3.18Å
33	H	41.3	Very low	41.5	Very low	102 Å²	102	94.8 Å²	94.8	47%	0.472	49%	0.494	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	145.3	-171.3	-60.2	82.8	0	0	0	110.9	F29 R30 C31 Q35	F29-H33 WeakPolarHBondContact CA-O 3.43Å; R30-H33 PolarHBondContact N-O 2.89Å; R30-H33 PolarHBondContact O-N 3.39Å; C31-H33 PolarHBondContact O-CE1 3.21Å; C31-H33 PolarHBondContact O-ND1 3.25Å; H33-Q35 PolarHBondContact O-N 2.8Å
34	F	45.3	Very low	41	Very low	146 Å²	146	93.9 Å²	93.9	64%	0.64	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.2	105.7	163.7	-84.8	-86.4	0	0	0	108	F29	F29-F34 AromaticContact CD2-CD2 3.96Å; F29-F34 HydrophobicContact CD2-CD2 3.96Å; F29-F34 AromaticContact CD2-CE2 3.96Å; F29-F34 HydrophobicContact CD2-CE2 3.96Å; F29-F34 HydrophobicContact CD2-CG 4.27Å; F29-F34 HydrophobicContact CD2-CZ 4.25Å; F29-F34 HydrophobicContact CE2-CD2 4.17Å; F29-F34 HydrophobicContact CE2-CE2 4.14Å
35	Q	45.6	Very low	40.5	Very low	63 Å²	63	93.5 Å²	93.5	29%	0.294	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	119.6	170.5	-73	-178.2	-22.9	0	0	108.2	Y27 V28 H33 I37	Y27-Q35 WeakPolarHBondContact CA-O 3.36Å; V28-Q35 PolarHBondContact N-O 3.11Å; V28-Q35 PolarHBondContact O-N 3.15Å; H33-Q35 PolarHBondContact O-N 2.8Å; Q35-I37 PolarHBondContact O-N 3.09Å
36	H	44.8	Very low	40.1	Very low	52 Å²	52	96.2 Å²	96.2	24%	0.241	50%	0.503	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.5	112.7	164.7	-168.1	-145	0	0	0	107.2	S25 Y27 E38	S25-H36 WeakPolarHBondContact CB-NE2 3.13Å; Y27-H36 HydrophobicContact CD1-CB 4.31Å; Y27-H36 AromaticContact CD1-CD2 3.99Å; Y27-H36 HydrophobicContact CE1-CB 4.02Å; Y27-H36 AromaticContact CE1-CD2 3.58Å; Y27-H36 AromaticContact CE2-CD2 3.93Å; Y27-H36 AromaticContact CZ-CD2 3.54Å; Y27-H36 AromaticContact CZ-NE2 3.94Å; H36-E38 VanDerWaalsContact CE1-CD 3.44Å; H36-E38 WeakPolarHBondContact CE1-CG 3.25Å; H36-E38 IonicContact CE1-OE1 2.81Å; H36-E38 PolarHBondContact CE1-OE1 3.34Å; H36-E38 IonicContact ND1-OE1 3.11Å; H36-E38 PolarHBondContact ND1-OE1 3.43Å; H36-E38 VanDerWaalsContact ND1-OE1 3.11Å; H36-E38 IonicContact NE2-OE1 3.96Å
37	I	45.8	Very low	39.7	Very low	71 Å²	71	98.8 Å²	98.8	36%	0.364	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	111.1	174.1	-54.1	-167.1	0	0	0	106.7	G26 V28 Q35	G26-I37 PolarHBondContact N-O 3.09Å; G26-I37 PolarHBondContact O-N 2.07Å; V28-I37 HydrophobicContact CB-CD1 3.75Å; V28-I37 HydrophobicContact CB-CG1 4.21Å; V28-I37 HydrophobicContact CG2-CD1 3.37Å; V28-I37 HydrophobicContact CG2-CG1 3.96Å; Q35-I37 PolarHBondContact O-N 3.09Å
38	E	38.8	Very low	39	Very low	27 Å²	27	99 Å²	99	13%	0.126	53%	0.526	C	S	.	.			trans	-119.1	117.4	159.2	-38.8	-171.2	-163.6	0	0	107.3	C15 M22 H36	C15-E38 WeakPolarHBondContact CA-OE2 3.48Å; C15-E38 WeakPolarHBondContact CB-OE2 3.39Å; C15-E38 PolarHBondContact SG-OE2 2.93Å; M22-E38 HydrophobicContact CE-CB 3.53Å; M22-E38 HydrophobicContact CE-CG 3.2Å; M22-E38 WeakPolarHBondContact CE-OE2 3.39Å; M22-E38 WeakPolarHBondContact CG-OE2 3.45Å; M22-E38 HydrophobicContact SD-CG 3.76Å; H36-E38 VanDerWaalsContact CE1-CD 3.44Å; H36-E38 WeakPolarHBondContact CE1-CG 3.25Å; H36-E38 IonicContact CE1-OE1 2.81Å; H36-E38 PolarHBondContact CE1-OE1 3.34Å; H36-E38 IonicContact ND1-OE1 3.11Å; H36-E38 PolarHBondContact ND1-OE1 3.43Å; H36-E38 VanDerWaalsContact ND1-OE1 3.11Å; H36-E38 IonicContact NE2-OE1 3.96Å
39	C	38.4	Very low	38.8	Very low	87 Å²	87	99 Å²	99	59%	0.588	53%	0.528	S	S	*	.			trans	-123.9	119.3	169.3	-80.8	0	0	0	0	109.5
40	S	34.9	Very low	38.6	Very low	62 Å²	62	99.5 Å²	99.5	43%	0.434	54%	0.537	S	S	.	.			trans	-54.9	137.5	149.7	176.4	0	0	0	0	108.6	N42	S40-N42 PolarHBondContact O-N 2.88Å
41	T	37.8	Very low	38.6	Very low	143 Å²	143	95.9 Å²	95.9	88%	0.877	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.3	20.3	-166	45.9	0	0	0	0	116
42	N	36	Very low	38.6	Very low	146 Å²	146	99.7 Å²	99.7	78%	0.781	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-140.4	14	-169.4	-119.3	-24.1	0	0	0	115.2	S40	S40-N42 PolarHBondContact O-N 2.88Å
43	I	38.4	Very low	38.6	Very low	92 Å²	92	104.1 Å²	104.1	47%	0.472	58%	0.58	S	S	.	*			trans	-127.8	102.5	-177.9	-53.5	176.9	0	0	0	108.5	R45	I43-R45 HydrophobicContact CG2-CB 3.83Å; I43-R45 VanDerWaalsContact CG2-CD 3.47Å; I43-R45 HydrophobicContact CG2-CG 3.4Å; I43-R45 PolarHBondContact O-N 3.47Å
44	D	35.6	Very low	38.4	Very low	165 Å²	165	103.4 Å²	103.4	88%	0.882	58%	0.58	S	S	*	*			trans	-73.4	61.7	171	-132.8	-12.3	0	0	0	109.1	T46	D44-T46 PolarHBondContact O-N 3.21Å
45	R	36.9	Very low	37.9	Very low	183 Å²	183	108.1 Å²	108.1	69%	0.691	59%	0.593	S	S	*	*			trans	-87.9	92	175.9	-94.8	175	-168.7	-163.8	-1.1	108.3	I43 C47	I43-R45 HydrophobicContact CG2-CB 3.83Å; I43-R45 VanDerWaalsContact CG2-CD 3.47Å; I43-R45 HydrophobicContact CG2-CG 3.4Å; I43-R45 PolarHBondContact O-N 3.47Å; R45-C47 PolarHBondContact O-N 3.34Å
46	T	33.8	Very low	37.4	Very low	124 Å²	124	112.2 Å²	112.2	76%	0.761	62%	0.616	S	S	*	*			trans	-70.5	107.4	167.9	-23.3	0	0	0	0	108.3	D44 T48	D44-T46 PolarHBondContact O-N 3.21Å; T46-T48 PolarHBondContact O-N 2.81Å
47	C	36.9	Very low	36.9	Very low	86 Å²	86	112.4 Å²	112.4	58%	0.581	62%	0.621	S	S	*	*			trans	-73.8	109.7	171.9	-62.7	0	0	0	0	109.2	R45	R45-C47 PolarHBondContact O-N 3.34Å
48	T	33.5	Very low	36.2	Very low	102 Å²	102	113.6 Å²	113.6	63%	0.626	63%	0.632	S	S	*	*			trans	-76.3	128.5	168.5	54.7	0	0	0	0	109.2	T46 D50	T46-T48 PolarHBondContact O-N 2.81Å; T48-D50 VanDerWaalsContact C-N 3.29Å; T48-D50 WeakPolarHBondContact CB-OD2 3.46Å; T48-D50 PolarHBondContact O-N 3.35Å; T48-D50 VanDerWaalsContact O-N 3.11Å; T48-D50 PolarHBondContact OG1-OD2 3.24Å
49	C	37	Very low	35.9	Very low	62 Å²	62	117.5 Å²	117.5	42%	0.419	66%	0.659	S	S	.	*			trans	-82.1	79.2	171.5	-83.8	0	0	0	0	108.5	C31	C31-C49 HydrophobicContact CB-CB 4.34Å; C31-C49 WeakPolarHBondContact CB-SG 3.37Å; C31-C49 WeakPolarHBondContact SG-CB 3.47Å; C31-C49 CovalentContact SG-SG 2.07Å; C31-C49 PolarHBondContact SG-SG 3.11Å
50	D	38.2	Very low	35.9	Very low	139 Å²	139	125 Å²	125	74%	0.743	68%	0.675	S	S	*	*			trans	-91.4	17.3	169.2	-60.2	-51	0	0	0	111.9	T48	T48-D50 VanDerWaalsContact C-N 3.29Å; T48-D50 WeakPolarHBondContact CB-OD2 3.46Å; T48-D50 PolarHBondContact O-N 3.35Å; T48-D50 VanDerWaalsContact O-N 3.11Å; T48-D50 PolarHBondContact OG1-OD2 3.24Å
51	G	38	Very low	35.8	Very low	61 Å²	61	130 Å²	130	63%	0.629	69%	0.691	S	S	*	*	S	Bend	trans	-71.6	133.7	176.6	0	0	0	0	0	111.2	P53	G51-P53 WeakPolarHBondContact O-CD 3.41Å; G51-P53 VanDerWaalsContact O-N 3.15Å
52	I	35.6	Very low	35.9	Very low	158 Å²	158	131.9 Å²	131.9	81%	0.81	69%	0.688	S	S	*	*			trans	-52	122.3	171.1	-58.8	171.9	0	0	0	107.2	D54	I52-D54 VanDerWaalsContact C-N 3.35Å; I52-D54 PolarHBondContact O-N 3.01Å
53	P	38.5	Very low	36.1	Very low	116 Å²	116	129.5 Å²	129.5	75%	0.753	68%	0.68	S	S	*	*			trans	-63.1	100.8	176.6	24.2	-31.3	0	0	0	107.8	G51 R55	G51-P53 WeakPolarHBondContact O-CD 3.41Å; G51-P53 VanDerWaalsContact O-N 3.15Å; P53-R55 PolarHBondContact O-N 2.99Å
54	D	36.6	Very low	36.5	Very low	86 Å²	86	133.2 Å²	133.2	46%	0.46	70%	0.701	S	S	.	*			trans	-66.4	118.7	176.9	-167.7	-22.3	0	0	0	107.6	I52 L56 V57	I52-D54 VanDerWaalsContact C-N 3.35Å; I52-D54 PolarHBondContact O-N 3.01Å; D54-L56 PolarHBondContact O-N 3.19Å; D54-L56 WeakPolarHBondContact OD1-CB 3.5Å; D54-L56 PolarHBondContact OD1-N 2.83Å; D54-V57 HydrophobicContact CB-CG2 4.3Å; D54-V57 WeakPolarHBondContact O-CB 3.45Å; D54-V57 PolarHBondContact O-N 3.45Å
55	R	34.7	Very low	36.8	Very low	246 Å²	246	135.5 Å²	135.5	93%	0.928	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.4	-12.4	179	-71.8	-179.1	168.6	-178.7	-3.5	112.5	P53 V57	P53-R55 PolarHBondContact O-N 2.99Å; R55-V57 VanDerWaalsContact C-N 3.29Å
56	L	34.6	Very low	37.3	Very low	148 Å²	148	132.5 Å²	132.5	78%	0.775	70%	0.702	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.7	-11.4	172.6	-68.5	166.4	0	0	0	113.5	D54 V58	D54-L56 PolarHBondContact O-N 3.19Å; D54-L56 WeakPolarHBondContact OD1-CB 3.5Å; D54-L56 PolarHBondContact OD1-N 2.83Å; L56-V58 PolarHBondContact O-N 2.79Å
57	V	34.8	Very low	37.8	Very low	56 Å²	56	134.2 Å²	134.2	34%	0.339	70%	0.701	S	S	.	*			trans	-90.5	87.8	171.1	-177.7	0	0	0	0	108.3	D54 R55 P59	D54-V57 HydrophobicContact CB-CG2 4.3Å; D54-V57 WeakPolarHBondContact O-CB 3.45Å; D54-V57 PolarHBondContact O-N 3.45Å; R55-V57 VanDerWaalsContact C-N 3.29Å; V57-P59 WeakPolarHBondContact O-CD 3.5Å
58	V	30.6	Very low	38.2	Very low	97 Å²	97	140.5 Å²	140.5	59%	0.588	72%	0.718	S	S	*	*			trans	-66.6	125.6	167.3	-133.5	0	0	0	0	107.7	L56 R60	L56-V58 PolarHBondContact O-N 2.79Å; V58-R60 PolarHBondContact O-N 3.03Å
59	P	33.3	Very low	38.7	Very low	109 Å²	109	144.6 Å²	144.6	71%	0.708	72%	0.722	S	S	*	*			trans	-49.4	145.5	158	-20.3	31.8	0	0	0	107.7	V57 E61	V57-P59 WeakPolarHBondContact O-CD 3.5Å; P59-E61 PolarHBondContact O-N 2.96Å
60	R	37.2	Very low	39.2	Very low	243 Å²	243	146.8 Å²	146.8	92%	0.917	73%	0.73	S	S	*	*			trans	-63.6	71.8	-172.4	-151.1	-175.6	-167.5	171.6	3.6	111.2	V58 K62	V58-R60 PolarHBondContact O-N 3.03Å; R60-K62 PolarHBondContact O-N 3.23Å; R60-K62 VanDerWaalsContact O-N 3.1Å
61	E	34.7	Very low	39.4	Very low	167 Å²	167	145.6 Å²	145.6	78%	0.78	72%	0.722	S	S	*	*			trans	-62.7	110.8	153	-76.1	-169	155.3	0	0	104.4	P59 P63	P59-E61 PolarHBondContact O-N 2.96Å; E61-P63 WeakPolarHBondContact O-CD 3.44Å
62	K	39.9	Very low	39.7	Very low	184 Å²	184	149.2 Å²	149.2	80%	0.8	72%	0.721	S	S	*	*			trans	-54.6	109.4	168.5	-89.7	-178.6	175.3	175.7	0	105.5	R60 D64	R60-K62 PolarHBondContact O-N 3.23Å; R60-K62 VanDerWaalsContact O-N 3.1Å; K62-D64 PolarHBondContact O-N 3.07Å
63	P	39.5	Very low	39.9	Very low	96 Å²	96	147.3 Å²	147.3	62%	0.623	71%	0.709	S	S	*	*			trans	-70.7	128	167.8	18.7	-6.1	0	0	0	105.4	E61 R65	E61-P63 WeakPolarHBondContact O-CD 3.44Å; P63-R65 PolarHBondContact O-N 2.85Å
64	D	45.8	Very low	39.9	Very low	169 Å²	169	146.3 Å²	146.3	90%	0.904	70%	0.697	S	S	*	*	S	Bend	trans	-56.6	-16.3	176.2	-78.3	-38.2	0	0	0	112.2	K62	K62-D64 PolarHBondContact O-N 3.07Å
65	R	43.6	Very low	40.1	Very low	213 Å²	213	149.5 Å²	149.5	80%	0.804	70%	0.703	S	S	*	*	S	Bend	trans	-132.2	119.3	174.8	-64.4	-176.1	-178.2	178.5	0.7	111.1	P63 E67	P63-R65 PolarHBondContact O-N 2.85Å; R65-E67 PolarHBondContact O-N 2.87Å; R65-E67 VanDerWaalsContact O-N 3.15Å
66	P	46	Very low	40.2	Very low	121 Å²	121	142.8 Å²	142.8	79%	0.786	69%	0.685	S	S	*	*			trans	-75.4	103.3	178.8	29.1	-31.7	0	0	0	110.3
67	E	45.4	Very low	40.4	Very low	160 Å²	160	140.1 Å²	140.1	75%	0.748	68%	0.675	S	S	*	*			trans	-76	132.3	161.1	-83.9	-175.3	160.7	0	0	110	R65 R69	R65-E67 PolarHBondContact O-N 2.87Å; R65-E67 VanDerWaalsContact O-N 3.15Å; E67-R69 PolarHBondContact O-N 2.93Å; E67-R69 VanDerWaalsContact O-N 3.16Å
68	K	45.2	Very low	40.6	Very low	217 Å²	217	143 Å²	143	94%	0.943	68%	0.683	S	S	*	*			trans	-69.5	109.4	178.2	-66.5	179.8	-179.2	177.2	0	109.1
69	R	44.3	Very low	40.9	Very low	189 Å²	189	142.9 Å²	142.9	71%	0.713	68%	0.679	S	S	*	*			trans	-103.3	131.6	170	-63.7	-175.3	-178.3	-176.5	0.6	109.6	E67 I71	E67-R69 PolarHBondContact O-N 2.93Å; E67-R69 VanDerWaalsContact O-N 3.16Å; R69-I71 VanDerWaalsContact C-N 3.34Å; R69-I71 HydrophobicContact CB-CG2 4.45Å; R69-I71 PolarHBondContact O-N 3.24Å
70	N	46	Very low	41	Very low	108 Å²	108	144.8 Å²	144.8	58%	0.578	68%	0.683	S	S	*	*			trans	-78.5	84.7	174	-172.9	6.1	0	0	0	109.8	F72 E73	N70-F72 PolarHBondContact O-N 3.45Å; N70-F72 VanDerWaalsContact O-N 3.16Å; N70-F72 PolarHBondContact OD1-N 3.43Å; N70-E73 PolarHBondContact O-N 3.43Å
71	I	44	Very low	40.9	Very low	114 Å²	114	138.1 Å²	138.1	59%	0.585	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-11	-176.6	60.4	172.4	0	0	0	114	R69	R69-I71 VanDerWaalsContact C-N 3.34Å; R69-I71 HydrophobicContact CB-CG2 4.45Å; R69-I71 PolarHBondContact O-N 3.24Å
72	F	43.6	Very low	40.8	Very low	137 Å²	137	140.3 Å²	140.3	60%	0.601	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.8	-5.8	-179.8	-61.2	-72.9	0	0	0	113.7	N70 N74 W75	N70-F72 PolarHBondContact O-N 3.45Å; N70-F72 VanDerWaalsContact O-N 3.16Å; N70-F72 PolarHBondContact OD1-N 3.43Å; F72-N74 PolarHBondContact O-N 2.87Å; F72-W75 PolarHBondContact O-N 2.93Å
73	E	40	Very low	40.6	Very low	117 Å²	117	138.1 Å²	138.1	55%	0.547	68%	0.676	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.6	121.9	172.7	-166	172	-163.4	0	0	109.4	N70 W75 K78	N70-E73 PolarHBondContact O-N 3.43Å; E73-W75 PolarHBondContact O-N 2.92Å; E73-K78 PolarHBondContact O-NZ 3.31Å
74	N	38.8	Very low	40.4	Very low	95 Å²	95	141.9 Å²	141.9	51%	0.508	68%	0.682	S	S	.	*	T	Hydrogen-bonded Turn	trans	57.6	40.7	-179.7	-46.5	-37.6	0	0	0	113.6	F72 D76 T77 K78	F72-N74 PolarHBondContact O-N 2.87Å; N74-D76 VanDerWaalsContact C-N 3.27Å; N74-D76 WeakPolarHBondContact CA-OD1 3.41Å; N74-D76 PolarHBondContact O-N 3.05Å; N74-T77 HydrophobicContact CB-CG2 4.4Å; N74-T77 WeakPolarHBondContact CB-OG1 3.43Å; N74-T77 PolarHBondContact O-N 2.89Å; N74-T77 PolarHBondContact O-OG1 3.16Å; N74-K78 WeakPolarHBondContact O-CG 3.04Å
75	W	40.9	Very low	39.6	Very low	153 Å²	153	139.1 Å²	139.1	58%	0.58	67%	0.673	S	S	*	*			trans	-65.3	-32.7	-179.8	88.7	-80.8	0	0	0	112.7	F72 E73 T77 K78 L79	F72-W75 PolarHBondContact O-N 2.93Å; E73-W75 PolarHBondContact O-N 2.92Å; W75-T77 VanDerWaalsContact C-N 3.31Å; W75-T77 PolarHBondContact O-N 3.3Å; W75-K78 WeakPolarHBondContact O-CB 3.46Å; W75-K78 PolarHBondContact O-N 3.43Å; W75-K78 VanDerWaalsContact O-N 3.09Å; W75-L79 HydrophobicContact CE3-CD1 3.94Å; W75-L79 HydrophobicContact CE3-CG 4.15Å; W75-L79 HydrophobicContact CH2-CD1 3.72Å; W75-L79 HydrophobicContact CZ3-CD1 3.35Å; W75-L79 HydrophobicContact CZ3-CD2 4.16Å; W75-L79 HydrophobicContact CZ3-CG 3.92Å
76	D	36.8	Very low	39.5	Very low	105 Å²	105	138.6 Å²	138.6	56%	0.561	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-62.3	-35.9	176.2	56.9	-52.4	0	0	0	111.8	N74 K78	N74-D76 VanDerWaalsContact C-N 3.27Å; N74-D76 WeakPolarHBondContact CA-OD1 3.41Å; N74-D76 PolarHBondContact O-N 3.05Å; D76-K78 VanDerWaalsContact C-N 3.27Å; D76-K78 PolarHBondContact O-N 2.99Å
77	T	38.6	Very low	39.5	Very low	93 Å²	93	140.3 Å²	140.3	57%	0.571	68%	0.679	S	S	*	*	G	3₁₀ helix	trans	-78.3	-11.2	175.5	69.1	0	0	0	0	113.4	N74 W75	N74-T77 HydrophobicContact CB-CG2 4.4Å; N74-T77 WeakPolarHBondContact CB-OG1 3.43Å; N74-T77 PolarHBondContact O-N 2.89Å; N74-T77 PolarHBondContact O-OG1 3.16Å; W75-T77 VanDerWaalsContact C-N 3.31Å; W75-T77 PolarHBondContact O-N 3.3Å
78	K	37.9	Very low	39.4	Very low	115 Å²	115	138.1 Å²	138.1	50%	0.5	68%	0.682	S	S	.	*	G	3₁₀ helix	trans	-95.7	-7.2	-178.2	-69.7	167.3	179.4	158	0	113.1	E73 N74 W75 D76 N80	E73-K78 PolarHBondContact O-NZ 3.31Å; N74-K78 WeakPolarHBondContact O-CG 3.04Å; W75-K78 WeakPolarHBondContact O-CB 3.46Å; W75-K78 PolarHBondContact O-N 3.43Å; W75-K78 VanDerWaalsContact O-N 3.09Å; D76-K78 VanDerWaalsContact C-N 3.27Å; D76-K78 PolarHBondContact O-N 2.99Å; K78-N80 PolarHBondContact O-N 2.64Å; K78-N80 VanDerWaalsContact O-N 3.09Å
79	L	37.3	Very low	38.9	Very low	96 Å²	96	136.9 Å²	136.9	50%	0.503	70%	0.701	S	S	.	*			trans	-79.9	81	173.8	-73.5	172.4	0	0	0	110.7	W75 C81	W75-L79 HydrophobicContact CE3-CD1 3.94Å; W75-L79 HydrophobicContact CE3-CG 4.15Å; W75-L79 HydrophobicContact CH2-CD1 3.72Å; W75-L79 HydrophobicContact CZ3-CD1 3.35Å; W75-L79 HydrophobicContact CZ3-CD2 4.16Å; W75-L79 HydrophobicContact CZ3-CG 3.92Å; L79-C81 PolarHBondContact O-N 3.5Å
80	N	35.4	Very low	38.6	Very low	148 Å²	148	134.3 Å²	134.3	79%	0.791	70%	0.7	S	S	*	*			trans	-80.8	52.5	170.7	-80.4	-45.7	0	0	0	112.1	K78 R82	K78-N80 PolarHBondContact O-N 2.64Å; K78-N80 VanDerWaalsContact O-N 3.09Å; N80-R82 PolarHBondContact O-N 3.03Å; N80-R82 VanDerWaalsContact O-N 3.1Å
81	C	34.3	Very low	38.3	Very low	104 Å²	104	135.6 Å²	135.6	70%	0.703	71%	0.706	S	S	*	*			trans	-78.5	91.7	171.7	-66.3	0	0	0	0	108.9	L79 V83	L79-C81 PolarHBondContact O-N 3.5Å; C81-V83 PolarHBondContact O-N 2.77Å
82	R	33.5	Very low	37.9	Very low	213 Å²	213	136.8 Å²	136.8	80%	0.804	71%	0.713	S	S	*	*			trans	-72	119.5	168.9	-74.3	-174	178.4	-179.1	-0	109.2	N80 F84	N80-R82 PolarHBondContact O-N 3.03Å; N80-R82 VanDerWaalsContact O-N 3.1Å; R82-F84 PolarHBondContact O-N 3.1Å
83	V	34.9	Very low	37.6	Very low	138 Å²	138	136.8 Å²	136.8	84%	0.836	72%	0.72	S	S	*	*			trans	-75	111.6	168.9	179.8	0	0	0	0	107.2	C81	C81-V83 PolarHBondContact O-N 2.77Å
84	F	35.3	Very low	37.4	Very low	175 Å²	175	138.1 Å²	138.1	77%	0.768	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-77.3	129.6	168.3	-67.2	-83.9	0	0	0	108.2	R82 K86	R82-F84 PolarHBondContact O-N 3.1Å; F84-K86 PolarHBondContact O-N 3.16Å
85	P	29.8	Very low	37.4	Very low	110 Å²	110	140.9 Å²	140.9	71%	0.714	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-58.3	134.9	171.9	23.5	-29.4	0	0	0	108.3	D87	P85-D87 PolarHBondContact O-N 3.31Å; P85-D87 VanDerWaalsContact O-N 3.14Å
86	K	42.4	Very low	37.1	Very low	203 Å²	203	140.1 Å²	140.1	88%	0.883	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-58.3	120	165.6	-92.4	-178.2	174.4	176.8	0	106.1	F84 S88	F84-K86 PolarHBondContact O-N 3.16Å; K86-S88 PolarHBondContact O-N 2.95Å
87	D	44.2	Very low	37.1	Very low	156 Å²	156	142.8 Å²	142.8	83%	0.834	77%	0.772	S	S	*	*			trans	-42.3	118	175.5	-65.3	-53.9	0	0	0	109.5	P85 S89	P85-D87 PolarHBondContact O-N 3.31Å; P85-D87 VanDerWaalsContact O-N 3.14Å; D87-S89 PolarHBondContact O-N 3.15Å
88	S	43.7	Very low	37	Very low	114 Å²	114	146.9 Å²	146.9	80%	0.797	79%	0.789	S	S	*	*			trans	-82.1	101.3	168.9	48	0	0	0	0	107.8	K86	K86-S88 PolarHBondContact O-N 2.95Å
89	S	35.4	Very low	36.9	Very low	191 Å²	191	149.8 Å²	149.8	100%	1.336	82%	0.815	S	S	*	*			trans	102	0	168.4	-44.4	0	0	0	0	116.3	D87	D87-S89 PolarHBondContact O-N 3.15Å

Retrieved 89 of 89 residues in 37.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).