A0A061AED1_CAEEL Loading...

BLOC-1-related complex subunit 7

AlphaFold DB , UniProt , Accession A0A061AED1, Species CAEEL (Caenorhabditis elegans), Gene n/a, Length 61 aa.

						>A0A061AED1_CAEEL|A0A061AED1
MQKVTESAADCFTSMQNVAAKLNVIHTNVTRLEDSVADLLEASQLIPKNLSNFELNIPEFI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.3	Low	81	Confident	200 Å²	200	107.7 Å²	107.7	99%	0.985	60%	0.602	S	S	*	*				0	-54.9	0	-66.5	-57.6	-89.6	0	0	112	K3 V4 T5	M1-K3 PolarHBondContact O-N 3.27Å; M1-V4 PolarHBondContact O-N 3.32Å; M1-V4 VanDerWaalsContact O-N 3.16Å; M1-T5 PolarHBondContact O-N 3.12Å; M1-T5 PolarHBondContact O-OG1 2.82Å
2	Q	70.6	Confident	82.2	Confident	141 Å²	141	109.3 Å²	109.3	66%	0.659	60%	0.598	S	S	*	*	H	α-helix	trans	-56	-44.1	-177.2	-174.1	178.2	-15.7	0	0	116	V4 T5 E6	Q2-V4 VanDerWaalsContact C-N 3.28Å; Q2-V4 PolarHBondContact O-N 3.11Å; Q2-T5 VanDerWaalsContact C-OG1 3.31Å; Q2-T5 WeakPolarHBondContact CA-OG1 3.45Å; Q2-T5 PolarHBondContact O-N 3.3Å; Q2-T5 PolarHBondContact O-OG1 3.49Å; Q2-E6 WeakPolarHBondContact CG-OE1 3.42Å; Q2-E6 PolarHBondContact NE2-OE1 3.41Å; Q2-E6 WeakPolarHBondContact O-CG 3.26Å; Q2-E6 PolarHBondContact O-N 3.4Å
3	K	69.6	Low	83.3	Confident	176 Å²	176	106.2 Å²	106.2	77%	0.765	58%	0.584	S	S	*	*	H	α-helix	trans	-64.6	-30	178.3	-73	-171.3	173.8	-173.2	0	114.2	M1 S7	M1-K3 PolarHBondContact O-N 3.27Å; K3-S7 WeakPolarHBondContact O-CB 3.44Å; K3-S7 PolarHBondContact O-N 3.39Å; K3-S7 VanDerWaalsContact O-N 3.13Å
4	V	74.3	Confident	84.3	Confident	107 Å²	107	103.5 Å²	103.5	65%	0.648	58%	0.577	S	S	*	*	H	α-helix	trans	-74.3	-38.3	178.6	178.6	0	0	0	0	109.9	M1 Q2 A8	M1-V4 PolarHBondContact O-N 3.32Å; M1-V4 VanDerWaalsContact O-N 3.16Å; Q2-V4 VanDerWaalsContact C-N 3.28Å; Q2-V4 PolarHBondContact O-N 3.11Å; V4-A8 WeakPolarHBondContact O-CB 3.37Å; V4-A8 PolarHBondContact O-N 3.48Å
5	T	77.4	Confident	85.2	Confident	90 Å²	90	104.9 Å²	104.9	55%	0.552	58%	0.58	S	S	*	*	H	α-helix	trans	-68.3	-37.6	175.8	43.9	0	0	0	0	112.7	M1 Q2 A8 A9	M1-T5 PolarHBondContact O-N 3.12Å; M1-T5 PolarHBondContact O-OG1 2.82Å; Q2-T5 VanDerWaalsContact C-OG1 3.31Å; Q2-T5 WeakPolarHBondContact CA-OG1 3.45Å; Q2-T5 PolarHBondContact O-N 3.3Å; Q2-T5 PolarHBondContact O-OG1 3.49Å; T5-A8 PolarHBondContact O-N 2.92Å; T5-A9 PolarHBondContact O-N 3.2Å; T5-A9 VanDerWaalsContact O-N 3.11Å
6	E	79.8	Confident	86	Confident	94 Å²	94	104.7 Å²	104.7	44%	0.439	57%	0.573	S	S	.	*	H	α-helix	trans	-64.1	-47.8	173.8	-72.3	164.6	-173.6	0	0	111.1	Q2 A8 A9 D10	Q2-E6 WeakPolarHBondContact CG-OE1 3.42Å; Q2-E6 PolarHBondContact NE2-OE1 3.41Å; Q2-E6 WeakPolarHBondContact O-CG 3.26Å; Q2-E6 PolarHBondContact O-N 3.4Å; E6-A8 VanDerWaalsContact C-N 3.3Å; E6-A8 PolarHBondContact O-N 3.02Å; E6-A9 WeakPolarHBondContact O-CB 3.45Å; E6-A9 PolarHBondContact O-N 2.93Å; E6-A9 VanDerWaalsContact O-N 3.13Å; E6-D10 PolarHBondContact O-N 2.86Å
7	S	87.8	Confident	86.7	Confident	79 Å²	79	104 Å²	104	55%	0.552	57%	0.569	S	S	*	*	H	α-helix	trans	-61.4	-35.3	177	178.3	0	0	0	0	113.5	K3 C11	K3-S7 WeakPolarHBondContact O-CB 3.44Å; K3-S7 PolarHBondContact O-N 3.39Å; K3-S7 VanDerWaalsContact O-N 3.13Å; S7-C11 WeakPolarHBondContact O-CB 3.37Å; S7-C11 PolarHBondContact O-N 3.3Å; S7-C11 VanDerWaalsContact O-N 3.1Å
8	A	89.6	Confident	87.3	Confident	60 Å²	60	103.2 Å²	103.2	50%	0.496	57%	0.567	S	S	.	*	H	α-helix	trans	-69	-37.9	175.3	0	0	0	0	0	112.3	V4 T5 E6 C11 F12	V4-A8 WeakPolarHBondContact O-CB 3.37Å; V4-A8 PolarHBondContact O-N 3.48Å; T5-A8 PolarHBondContact O-N 2.92Å; E6-A8 VanDerWaalsContact C-N 3.3Å; E6-A8 PolarHBondContact O-N 3.02Å; A8-C11 PolarHBondContact O-N 3.48Å; A8-F12 WeakPolarHBondContact O-CB 3.33Å; A8-F12 PolarHBondContact O-N 2.9Å
9	A	92.3	Very high	87.9	Confident	52 Å²	52	100.5 Å²	100.5	43%	0.43	56%	0.56	S	S	.	*	H	α-helix	trans	-66.5	-40.3	176.6	0	0	0	0	0	112.1	T5 E6 F12 T13	T5-A9 PolarHBondContact O-N 3.2Å; T5-A9 VanDerWaalsContact O-N 3.11Å; E6-A9 WeakPolarHBondContact O-CB 3.45Å; E6-A9 PolarHBondContact O-N 2.93Å; E6-A9 VanDerWaalsContact O-N 3.13Å; A9-F12 PolarHBondContact O-N 2.94Å; A9-T13 WeakPolarHBondContact O-CB 3.34Å; A9-T13 PolarHBondContact O-N 3.14Å; A9-T13 PolarHBondContact O-OG1 3.37Å
10	D	93.9	Very high	88.4	Confident	115 Å²	115	98.2 Å²	98.2	62%	0.615	55%	0.554	S	S	*	*	H	α-helix	trans	-63.9	-43.2	175	-69.4	-21.4	0	0	0	111.4	E6 T13 S14	E6-D10 PolarHBondContact O-N 2.86Å; D10-T13 PolarHBondContact O-N 3.31Å; D10-S14 WeakPolarHBondContact O-CB 3.49Å; D10-S14 PolarHBondContact O-N 2.97Å
11	C	94.1	Very high	88.9	Confident	71 Å²	71	100.5 Å²	100.5	48%	0.48	56%	0.558	S	S	.	*	H	α-helix	trans	-60.3	-47.3	175.3	-174.1	0	0	0	0	111.5	S7 A8 T13 S14 M15	S7-C11 WeakPolarHBondContact O-CB 3.37Å; S7-C11 PolarHBondContact O-N 3.3Å; S7-C11 VanDerWaalsContact O-N 3.1Å; A8-C11 PolarHBondContact O-N 3.48Å; C11-T13 VanDerWaalsContact C-N 3.34Å; C11-T13 PolarHBondContact O-N 3.45Å; C11-S14 WeakPolarHBondContact O-CB 3.49Å; C11-S14 PolarHBondContact O-N 2.91Å; C11-M15 WeakPolarHBondContact O-CG 3.43Å; C11-M15 PolarHBondContact O-N 3.29Å
12	F	95.6	Very high	90.7	Very high	126 Å²	126	96 Å²	96	55%	0.553	54%	0.538	S	S	*	.	H	α-helix	trans	-60.6	-43	178	-177.2	-104.6	0	0	0	112.2	A8 A9 M15 Q16	A8-F12 WeakPolarHBondContact O-CB 3.33Å; A8-F12 PolarHBondContact O-N 2.9Å; A9-F12 PolarHBondContact O-N 2.94Å; F12-M15 PolarHBondContact O-N 2.68Å; F12-Q16 VanDerWaalsContact CE1-CD 3.44Å; F12-Q16 HydrophobicContact CE1-CG 4.18Å; F12-Q16 HydrophobicContact CZ-CG 4.25Å; F12-Q16 WeakPolarHBondContact O-CG 3.29Å; F12-Q16 PolarHBondContact O-N 3.16Å
13	T	96.6	Very high	92	Very high	69 Å²	69	94.7 Å²	94.7	42%	0.423	54%	0.535	S	S	.	.	H	α-helix	trans	-63.6	-43.5	176.1	-57.6	0	0	0	0	111.4	A9 D10 C11 M15 Q16 N17	A9-T13 WeakPolarHBondContact O-CB 3.34Å; A9-T13 PolarHBondContact O-N 3.14Å; A9-T13 PolarHBondContact O-OG1 3.37Å; D10-T13 PolarHBondContact O-N 3.31Å; C11-T13 VanDerWaalsContact C-N 3.34Å; C11-T13 PolarHBondContact O-N 3.45Å; T13-M15 PolarHBondContact O-N 3.05Å; T13-Q16 PolarHBondContact O-N 3.31Å; T13-N17 PolarHBondContact O-N 3.19Å; T13-N17 PolarHBondContact O-ND2 3.24Å
14	S	97.5	Very high	93.3	Very high	69 Å²	69	90.3 Å²	90.3	48%	0.483	52%	0.523	S	S	.	.	H	α-helix	trans	-60.2	-44.6	175.6	-171.5	0	0	0	0	111.8	D10 C11 Q16 N17 V18	D10-S14 WeakPolarHBondContact O-CB 3.49Å; D10-S14 PolarHBondContact O-N 2.97Å; C11-S14 WeakPolarHBondContact O-CB 3.49Å; C11-S14 PolarHBondContact O-N 2.91Å; S14-Q16 PolarHBondContact O-N 3.37Å; S14-N17 WeakPolarHBondContact O-CB 3.47Å; S14-N17 PolarHBondContact O-N 3.36Å; S14-V18 WeakPolarHBondContact O-CG2 3.48Å; S14-V18 PolarHBondContact O-N 3.33Å
15	M	97.6	Very high	94.5	Very high	125 Å²	125	89.9 Å²	89.9	62%	0.616	52%	0.516	S	S	*	.	H	α-helix	trans	-60.9	-43.5	176.5	-73.5	-179.5	65.5	0	0	112.4	C11 F12 T13 N17 V18 A19	C11-M15 WeakPolarHBondContact O-CG 3.43Å; C11-M15 PolarHBondContact O-N 3.29Å; F12-M15 PolarHBondContact O-N 2.68Å; T13-M15 PolarHBondContact O-N 3.05Å; M15-N17 VanDerWaalsContact C-N 3.33Å; M15-N17 PolarHBondContact O-N 3.02Å; M15-V18 PolarHBondContact O-N 2.87Å; M15-A19 WeakPolarHBondContact O-CB 3.45Å; M15-A19 PolarHBondContact O-N 2.79Å
16	Q	98	Very high	95.5	Very high	101 Å²	101	91.4 Å²	91.4	47%	0.472	52%	0.517	S	S	.	.	H	α-helix	trans	-61.9	-41.2	175.7	-72.4	-178.5	99.3	0	0	111.9	F12 T13 S14 V18 A19 A20	F12-Q16 VanDerWaalsContact CE1-CD 3.44Å; F12-Q16 HydrophobicContact CE1-CG 4.18Å; F12-Q16 HydrophobicContact CZ-CG 4.25Å; F12-Q16 WeakPolarHBondContact O-CG 3.29Å; F12-Q16 PolarHBondContact O-N 3.16Å; T13-Q16 PolarHBondContact O-N 3.31Å; S14-Q16 PolarHBondContact O-N 3.37Å; Q16-V18 PolarHBondContact O-N 3.3Å; Q16-A19 PolarHBondContact O-N 3.25Å; Q16-A20 WeakPolarHBondContact O-CB 3.5Å; Q16-A20 PolarHBondContact O-N 3.04Å
17	N	98.1	Very high	96.4	Very high	93 Å²	93	90.6 Å²	90.6	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-64.1	-40.7	176.4	-72.8	-26.2	0	0	0	112.3	T13 S14 M15 A20 K21	T13-N17 PolarHBondContact O-N 3.19Å; T13-N17 PolarHBondContact O-ND2 3.24Å; S14-N17 WeakPolarHBondContact O-CB 3.47Å; S14-N17 PolarHBondContact O-N 3.36Å; M15-N17 VanDerWaalsContact C-N 3.33Å; M15-N17 PolarHBondContact O-N 3.02Å; N17-A20 PolarHBondContact O-N 3.5Å; N17-K21 WeakPolarHBondContact O-CG 3.38Å; N17-K21 PolarHBondContact O-N 3.5Å
18	V	98.3	Very high	96.9	Very high	90 Å²	90	91 Å²	91	55%	0.545	51%	0.514	S	S	.	.	H	α-helix	trans	-63.9	-45.4	174.8	170.8	0	0	0	0	110.6	S14 M15 Q16 A20 K21 L22	S14-V18 WeakPolarHBondContact O-CG2 3.48Å; S14-V18 PolarHBondContact O-N 3.33Å; M15-V18 PolarHBondContact O-N 2.87Å; Q16-V18 PolarHBondContact O-N 3.3Å; V18-A20 VanDerWaalsContact C-N 3.34Å; V18-A20 PolarHBondContact O-N 3.13Å; V18-K21 PolarHBondContact O-N 2.9Å; V18-L22 WeakPolarHBondContact O-CB 3.27Å; V18-L22 PolarHBondContact O-N 2.76Å
19	A	98.2	Very high	97.3	Very high	51 Å²	51	91.1 Å²	91.1	42%	0.421	51%	0.508	S	S	.	.	H	α-helix	trans	-60.4	-43.1	177.7	0	0	0	0	0	112.1	M15 Q16 L22 N23	M15-A19 WeakPolarHBondContact O-CB 3.45Å; M15-A19 PolarHBondContact O-N 2.79Å; Q16-A19 PolarHBondContact O-N 3.25Å; A19-L22 PolarHBondContact O-N 2.86Å; A19-N23 PolarHBondContact O-N 3.28Å
20	A	98	Very high	97.5	Very high	55 Å²	55	91.1 Å²	91.1	46%	0.455	50%	0.503	S	S	.	.	H	α-helix	trans	-61.5	-45.7	176.2	0	0	0	0	0	112	Q16 N17 V18 L22 N23 V24	Q16-A20 WeakPolarHBondContact O-CB 3.5Å; Q16-A20 PolarHBondContact O-N 3.04Å; N17-A20 PolarHBondContact O-N 3.5Å; V18-A20 VanDerWaalsContact C-N 3.34Å; V18-A20 PolarHBondContact O-N 3.13Å; A20-L22 VanDerWaalsContact C-N 3.32Å; A20-L22 PolarHBondContact O-N 2.84Å; A20-N23 PolarHBondContact O-N 3.01Å; A20-V24 PolarHBondContact O-N 3.49Å
21	K	98.4	Very high	97.7	Very high	147 Å²	147	93.8 Å²	93.8	64%	0.639	51%	0.505	S	S	*	.	H	α-helix	trans	-62	-40.5	175.9	-73.1	176.2	179.6	-177	0	111.9	N17 V18 N23 V24 I25	N17-K21 WeakPolarHBondContact O-CG 3.38Å; N17-K21 PolarHBondContact O-N 3.5Å; V18-K21 PolarHBondContact O-N 2.9Å; K21-N23 VanDerWaalsContact C-N 3.35Å; K21-N23 PolarHBondContact O-N 3.22Å; K21-V24 PolarHBondContact O-N 3.04Å; K21-I25 WeakPolarHBondContact O-CG1 3.44Å; K21-I25 PolarHBondContact O-N 3.04Å
22	L	98.4	Very high	97.8	Very high	106 Å²	106	95.7 Å²	95.7	56%	0.555	51%	0.509	S	S	*	.	H	α-helix	trans	-64.5	-39.5	178.9	-172.9	60.8	0	0	0	111.8	V18 A19 A20 V24 I25 H26	V18-L22 WeakPolarHBondContact O-CB 3.27Å; V18-L22 PolarHBondContact O-N 2.76Å; A19-L22 PolarHBondContact O-N 2.86Å; A20-L22 VanDerWaalsContact C-N 3.32Å; A20-L22 PolarHBondContact O-N 2.84Å; L22-V24 VanDerWaalsContact C-N 3.33Å; L22-V24 PolarHBondContact O-N 2.9Å; L22-I25 PolarHBondContact O-N 3.01Å; L22-H26 WeakPolarHBondContact O-CB 3.4Å; L22-H26 PolarHBondContact O-N 3.39Å
23	N	98.1	Very high	98	Very high	113 Å²	113	95.3 Å²	95.3	60%	0.604	51%	0.51	S	S	*	.	H	α-helix	trans	-62.3	-39.2	174.8	-76.9	-9.5	0	0	0	112.6	A19 A20 K21 H26 T27	A19-N23 PolarHBondContact O-N 3.28Å; A20-N23 PolarHBondContact O-N 3.01Å; K21-N23 VanDerWaalsContact C-N 3.35Å; K21-N23 PolarHBondContact O-N 3.22Å; N23-H26 PolarHBondContact O-N 3.37Å; N23-T27 WeakPolarHBondContact O-CB 3.44Å; N23-T27 PolarHBondContact O-N 3.45Å; N23-T27 PolarHBondContact O-OG1 3.34Å
24	V	98.4	Very high	97.9	Very high	84 Å²	84	96.5 Å²	96.5	51%	0.509	51%	0.513	S	S	.	.	H	α-helix	trans	-64.6	-45.8	174.9	174	0	0	0	0	110.7	A20 K21 L22 H26 T27 N28	A20-V24 PolarHBondContact O-N 3.49Å; K21-V24 PolarHBondContact O-N 3.04Å; L22-V24 VanDerWaalsContact C-N 3.33Å; L22-V24 PolarHBondContact O-N 2.9Å; V24-H26 PolarHBondContact O-N 3.15Å; V24-T27 PolarHBondContact O-N 3.21Å; V24-N28 VanDerWaalsContact O-CG 3.3Å; V24-N28 PolarHBondContact O-N 3.01Å
25	I	98.2	Very high	97.8	Very high	98 Å²	98	96 Å²	96	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-59.4	-47.9	177.1	-68.8	166.3	0	0	0	110.5	K21 L22 T27 N28 V29	K21-I25 WeakPolarHBondContact O-CG1 3.44Å; K21-I25 PolarHBondContact O-N 3.04Å; L22-I25 PolarHBondContact O-N 3.01Å; I25-T27 VanDerWaalsContact C-N 3.32Å; I25-T27 PolarHBondContact O-N 3.27Å; I25-N28 PolarHBondContact O-N 3.5Å; I25-N28 VanDerWaalsContact O-N 3.15Å; I25-V29 HydrophobicContact CG2-CG2 4.33Å; I25-V29 WeakPolarHBondContact O-CG2 3.3Å; I25-V29 PolarHBondContact O-N 3.26Å
26	H	98.3	Very high	97.7	Very high	122 Å²	122	94.6 Å²	94.6	57%	0.565	51%	0.508	S	S	*	.	H	α-helix	trans	-55.7	-48.1	177.4	179.8	-71.6	0	0	0	111.4	L22 N23 V24 N28 V29 T30	L22-H26 WeakPolarHBondContact O-CB 3.4Å; L22-H26 PolarHBondContact O-N 3.39Å; N23-H26 PolarHBondContact O-N 3.37Å; V24-H26 PolarHBondContact O-N 3.15Å; H26-N28 VanDerWaalsContact C-N 3.3Å; H26-N28 PolarHBondContact O-N 2.98Å; H26-V29 PolarHBondContact O-N 2.76Å; H26-T30 PolarHBondContact O-N 3.18Å; H26-T30 PolarHBondContact O-OG1 3.01Å
27	T	98.3	Very high	97.5	Very high	77 Å²	77	92 Å²	92	47%	0.472	50%	0.504	S	S	.	.	H	α-helix	trans	-59.7	-41.4	178.3	-56.6	0	0	0	0	111.8	N23 V24 I25 R31	N23-T27 WeakPolarHBondContact O-CB 3.44Å; N23-T27 PolarHBondContact O-N 3.45Å; N23-T27 PolarHBondContact O-OG1 3.34Å; V24-T27 PolarHBondContact O-N 3.21Å; I25-T27 VanDerWaalsContact C-N 3.32Å; I25-T27 PolarHBondContact O-N 3.27Å; T27-R31 WeakPolarHBondContact O-CG 3.47Å; T27-R31 PolarHBondContact O-N 3.13Å
28	N	98.2	Very high	97.3	Very high	86 Å²	86	92.5 Å²	92.5	46%	0.46	51%	0.507	S	S	.	.	H	α-helix	trans	-67.4	-40.2	178	-69.1	-12.2	0	0	0	112.1	V24 I25 H26 R31 L32	V24-N28 VanDerWaalsContact O-CG 3.3Å; V24-N28 PolarHBondContact O-N 3.01Å; I25-N28 PolarHBondContact O-N 3.5Å; I25-N28 VanDerWaalsContact O-N 3.15Å; H26-N28 VanDerWaalsContact C-N 3.3Å; H26-N28 PolarHBondContact O-N 2.98Å; N28-R31 PolarHBondContact O-N 3.02Å; N28-L32 WeakPolarHBondContact O-CG 3.37Å; N28-L32 PolarHBondContact O-N 2.86Å
29	V	97.9	Very high	97	Very high	63 Å²	63	94 Å²	94	38%	0.382	51%	0.511	S	S	.	.	H	α-helix	trans	-61.6	-48.3	176.7	169.2	0	0	0	0	110.6	I25 H26 R31 L32 E33	I25-V29 HydrophobicContact CG2-CG2 4.33Å; I25-V29 WeakPolarHBondContact O-CG2 3.3Å; I25-V29 PolarHBondContact O-N 3.26Å; H26-V29 PolarHBondContact O-N 2.76Å; V29-R31 VanDerWaalsContact C-N 3.31Å; V29-R31 PolarHBondContact O-N 3.02Å; V29-L32 WeakPolarHBondContact O-CB 3.46Å; V29-L32 PolarHBondContact O-N 3.46Å; V29-E33 HydrophobicContact CG1-CG 4.33Å; V29-E33 WeakPolarHBondContact O-CG 3.38Å; V29-E33 PolarHBondContact O-N 3.46Å
30	T	97.9	Very high	96.6	Very high	52 Å²	52	96.4 Å²	96.4	32%	0.319	52%	0.516	S	S	.	.	H	α-helix	trans	-56.3	-45	177	-56.7	0	0	0	0	111.8	H26 L32 E33 D34	H26-T30 PolarHBondContact O-N 3.18Å; H26-T30 PolarHBondContact O-OG1 3.01Å; T30-L32 VanDerWaalsContact C-N 3.3Å; T30-L32 PolarHBondContact O-N 3.28Å; T30-E33 WeakPolarHBondContact O-CB 3.4Å; T30-E33 PolarHBondContact O-N 2.89Å; T30-D34 PolarHBondContact O-N 3.48Å
31	R	97.4	Very high	96.2	Very high	171 Å²	171	99.9 Å²	99.9	65%	0.645	52%	0.523	S	S	*	.	H	α-helix	trans	-63.5	-34.7	177.3	-70.5	174.9	62.1	105	6.7	113.3	T27 N28 V29 S35	T27-R31 WeakPolarHBondContact O-CG 3.47Å; T27-R31 PolarHBondContact O-N 3.13Å; N28-R31 PolarHBondContact O-N 3.02Å; V29-R31 VanDerWaalsContact C-N 3.31Å; V29-R31 PolarHBondContact O-N 3.02Å; R31-S35 WeakPolarHBondContact O-CB 3.39Å; R31-S35 PolarHBondContact O-N 3.44Å; R31-S35 PolarHBondContact O-OG 2.9Å
32	L	97.4	Very high	95.6	Very high	111 Å²	111	95.3 Å²	95.3	58%	0.581	51%	0.513	S	S	*	.	H	α-helix	trans	-70.7	-40.9	176.5	-74.7	170.4	0	0	0	111.1	N28 V29 T30 D34 S35 V36	N28-L32 WeakPolarHBondContact O-CG 3.37Å; N28-L32 PolarHBondContact O-N 2.86Å; V29-L32 WeakPolarHBondContact O-CB 3.46Å; V29-L32 PolarHBondContact O-N 3.46Å; T30-L32 VanDerWaalsContact C-N 3.3Å; T30-L32 PolarHBondContact O-N 3.28Å; L32-D34 VanDerWaalsContact C-N 3.33Å; L32-D34 PolarHBondContact O-N 3.31Å; L32-S35 PolarHBondContact O-N 3.49Å; L32-V36 WeakPolarHBondContact O-CB 3.42Å; L32-V36 VanDerWaalsContact O-CG2 3.29Å; L32-V36 WeakPolarHBondContact O-CG2 3.36Å; L32-V36 PolarHBondContact O-N 3.5Å
33	E	97.9	Very high	94.8	Very high	119 Å²	119	93 Å²	93	56%	0.556	51%	0.505	S	S	*	.	H	α-helix	trans	-58.5	-46.3	174.6	-70	170.9	158	0	0	110.9	V29 T30 S35 V36 A37	V29-E33 HydrophobicContact CG1-CG 4.33Å; V29-E33 WeakPolarHBondContact O-CG 3.38Å; V29-E33 PolarHBondContact O-N 3.46Å; T30-E33 WeakPolarHBondContact O-CB 3.4Å; T30-E33 PolarHBondContact O-N 2.89Å; E33-S35 PolarHBondContact O-N 3.32Å; E33-V36 PolarHBondContact O-N 3.29Å; E33-A37 PolarHBondContact O-N 3.46Å
34	D	95.9	Very high	94.1	Very high	94 Å²	94	94.5 Å²	94.5	50%	0.503	51%	0.509	S	S	.	.	H	α-helix	trans	-59.7	-47.5	174.5	-65.4	-23.7	0	0	0	111.4	T30 L32 V36 A37 D38	T30-D34 PolarHBondContact O-N 3.48Å; L32-D34 VanDerWaalsContact C-N 3.33Å; L32-D34 PolarHBondContact O-N 3.31Å; D34-V36 VanDerWaalsContact C-N 3.29Å; D34-V36 PolarHBondContact O-N 2.93Å; D34-A37 WeakPolarHBondContact O-CB 3.44Å; D34-A37 PolarHBondContact O-N 2.92Å; D34-A37 VanDerWaalsContact O-N 3.13Å; D34-D38 PolarHBondContact O-N 3.27Å
35	S	95.5	Very high	93.3	Very high	59 Å²	59	97.6 Å²	97.6	41%	0.413	52%	0.521	S	S	.	.	H	α-helix	trans	-63.1	-35.5	179.9	-57.1	0	0	0	0	112.5	R31 L32 E33 L39	R31-S35 WeakPolarHBondContact O-CB 3.39Å; R31-S35 PolarHBondContact O-N 3.44Å; R31-S35 PolarHBondContact O-OG 2.9Å; L32-S35 PolarHBondContact O-N 3.49Å; E33-S35 PolarHBondContact O-N 3.32Å; S35-L39 WeakPolarHBondContact O-CB 3.39Å; S35-L39 VanDerWaalsContact O-CG 3.27Å; S35-L39 WeakPolarHBondContact O-CG 3.4Å; S35-L39 PolarHBondContact O-N 2.96Å
36	V	95.1	Very high	92.1	Very high	94 Å²	94	97.6 Å²	97.6	57%	0.57	52%	0.521	S	S	*	.	H	α-helix	trans	-69.5	-39.2	175.7	168.1	0	0	0	0	110.8	L32 E33 D34 L39 L40	L32-V36 WeakPolarHBondContact O-CB 3.42Å; L32-V36 VanDerWaalsContact O-CG2 3.29Å; L32-V36 WeakPolarHBondContact O-CG2 3.36Å; L32-V36 PolarHBondContact O-N 3.5Å; E33-V36 PolarHBondContact O-N 3.29Å; D34-V36 VanDerWaalsContact C-N 3.29Å; D34-V36 PolarHBondContact O-N 2.93Å; V36-L39 PolarHBondContact O-N 3.39Å; V36-L40 WeakPolarHBondContact O-CB 3.46Å; V36-L40 PolarHBondContact O-N 2.96Å
37	A	93.9	Very high	90.7	Very high	46 Å²	46	95.6 Å²	95.6	38%	0.38	52%	0.52	S	S	.	.	H	α-helix	trans	-61.7	-47.1	174.2	0	0	0	0	0	111.2	E33 D34 L39 L40 E41	E33-A37 PolarHBondContact O-N 3.46Å; D34-A37 WeakPolarHBondContact O-CB 3.44Å; D34-A37 PolarHBondContact O-N 2.92Å; D34-A37 VanDerWaalsContact O-N 3.13Å; A37-L39 VanDerWaalsContact C-N 3.34Å; A37-L39 PolarHBondContact O-N 3.43Å; A37-L40 WeakPolarHBondContact O-CB 3.47Å; A37-L40 PolarHBondContact O-N 3.21Å; A37-L40 VanDerWaalsContact O-N 3.14Å; A37-E41 PolarHBondContact O-N 3Å
38	D	93.1	Very high	89.1	Confident	105 Å²	105	102 Å²	102	56%	0.561	54%	0.54	S	S	*	.	H	α-helix	trans	-58.7	-44.7	176.2	-70.2	-16.6	0	0	0	111.7	D34 L40 E41 A42	D34-D38 PolarHBondContact O-N 3.27Å; D38-L40 VanDerWaalsContact C-N 3.34Å; D38-L40 PolarHBondContact O-N 3.06Å; D38-E41 PolarHBondContact O-N 2.92Å; D38-A42 WeakPolarHBondContact O-CB 3.49Å; D38-A42 PolarHBondContact O-N 3.37Å
39	L	91.5	Very high	87	Confident	120 Å²	120	104.4 Å²	104.4	63%	0.628	55%	0.554	S	S	*	*	H	α-helix	trans	-63.9	-39	176.6	-76.2	173.3	0	0	0	112.2	S35 V36 A37 A42 S43	S35-L39 WeakPolarHBondContact O-CB 3.39Å; S35-L39 VanDerWaalsContact O-CG 3.27Å; S35-L39 WeakPolarHBondContact O-CG 3.4Å; S35-L39 PolarHBondContact O-N 2.96Å; V36-L39 PolarHBondContact O-N 3.39Å; A37-L39 VanDerWaalsContact C-N 3.34Å; A37-L39 PolarHBondContact O-N 3.43Å; L39-A42 PolarHBondContact O-N 3.48Å; L39-S43 WeakPolarHBondContact O-CB 3.48Å; L39-S43 PolarHBondContact O-N 3.22Å
40	L	90.9	Very high	85	Confident	102 Å²	102	105.2 Å²	105.2	53%	0.534	56%	0.555	S	S	.	*	H	α-helix	trans	-64.5	-44.9	177.4	-178.8	62.4	0	0	0	110.7	V36 A37 D38 S43 Q44	V36-L40 WeakPolarHBondContact O-CB 3.46Å; V36-L40 PolarHBondContact O-N 2.96Å; A37-L40 WeakPolarHBondContact O-CB 3.47Å; A37-L40 PolarHBondContact O-N 3.21Å; A37-L40 VanDerWaalsContact O-N 3.14Å; D38-L40 VanDerWaalsContact C-N 3.34Å; D38-L40 PolarHBondContact O-N 3.06Å; L40-S43 PolarHBondContact O-N 3.37Å; L40-S43 PolarHBondContact O-OG 3.42Å; L40-Q44 WeakPolarHBondContact O-CG 3.44Å; L40-Q44 PolarHBondContact O-N 3.04Å
41	E	89.1	Confident	82.9	Confident	128 Å²	128	107.4 Å²	107.4	60%	0.598	57%	0.573	S	S	*	*	H	α-helix	trans	-61.6	-47.3	175	-71.2	-175.2	-175.7	0	0	111.5	A37 D38 S43 Q44	A37-E41 PolarHBondContact O-N 3Å; D38-E41 PolarHBondContact O-N 2.92Å; E41-S43 VanDerWaalsContact C-N 3.28Å; E41-S43 PolarHBondContact O-N 3.35Å; E41-Q44 WeakPolarHBondContact O-CB 3.44Å; E41-Q44 PolarHBondContact O-N 2.88Å; E41-Q44 VanDerWaalsContact O-N 3.11Å
42	A	85.4	Confident	80.9	Confident	52 Å²	52	106.6 Å²	106.6	43%	0.43	58%	0.582	S	S	.	*	H	α-helix	trans	-59.4	-38.9	176.4	0	0	0	0	0	112.1	D38 L39 Q44 L45	D38-A42 WeakPolarHBondContact O-CB 3.49Å; D38-A42 PolarHBondContact O-N 3.37Å; L39-A42 PolarHBondContact O-N 3.48Å; A42-Q44 PolarHBondContact O-N 2.89Å; A42-L45 WeakPolarHBondContact O-CB 3.34Å; A42-L45 PolarHBondContact O-N 2.69Å; A42-L45 VanDerWaalsContact O-N 3.12Å
43	S	81.6	Confident	78.8	Confident	56 Å²	56	108.8 Å²	108.8	39%	0.392	59%	0.586	S	S	.	*	H	α-helix	trans	-63.6	-29.1	178.5	80.5	0	0	0	0	113.1	L39 L40 E41 L45 I46	L39-S43 WeakPolarHBondContact O-CB 3.48Å; L39-S43 PolarHBondContact O-N 3.22Å; L40-S43 PolarHBondContact O-N 3.37Å; L40-S43 PolarHBondContact O-OG 3.42Å; E41-S43 VanDerWaalsContact C-N 3.28Å; E41-S43 PolarHBondContact O-N 3.35Å; S43-L45 VanDerWaalsContact C-N 3.28Å; S43-L45 PolarHBondContact O-N 3.36Å; S43-I46 WeakPolarHBondContact O-CB 3.45Å; S43-I46 PolarHBondContact O-N 3.46Å
44	Q	83.5	Confident	76.8	Confident	146 Å²	146	111.3 Å²	111.3	68%	0.682	60%	0.598	S	S	*	*	H	α-helix	trans	-73	-24	177.2	-66	173.5	19.2	0	0	112.4	L40 E41 A42 I46	L40-Q44 WeakPolarHBondContact O-CG 3.44Å; L40-Q44 PolarHBondContact O-N 3.04Å; E41-Q44 WeakPolarHBondContact O-CB 3.44Å; E41-Q44 PolarHBondContact O-N 2.88Å; E41-Q44 VanDerWaalsContact O-N 3.11Å; A42-Q44 PolarHBondContact O-N 2.89Å; Q44-I46 VanDerWaalsContact C-N 3.26Å
45	L	81.3	Confident	74.8	Confident	148 Å²	148	113.3 Å²	113.3	78%	0.775	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.9	-13.5	174.9	-58.1	176.3	0	0	0	112.4	A42 S43 P47	A42-L45 WeakPolarHBondContact O-CB 3.34Å; A42-L45 PolarHBondContact O-N 2.69Å; A42-L45 VanDerWaalsContact O-N 3.12Å; S43-L45 VanDerWaalsContact C-N 3.28Å; S43-L45 PolarHBondContact O-N 3.36Å; L45-P47 VanDerWaalsContact O-CD 3.26Å; L45-P47 WeakPolarHBondContact O-CD 3.49Å
46	I	73.8	Confident	72.9	Confident	98 Å²	98	117.4 Å²	117.4	50%	0.503	63%	0.626	S	S	.	*	S	Bend	trans	-72	115.5	174.8	-58.8	-178.7	0	0	0	108.1	S43 Q44 K48 L50	S43-I46 WeakPolarHBondContact O-CB 3.45Å; S43-I46 PolarHBondContact O-N 3.46Å; Q44-I46 VanDerWaalsContact C-N 3.26Å; I46-K48 PolarHBondContact O-N 3.11Å; I46-L50 HydrophobicContact CG2-CD1 3.3Å; I46-L50 HydrophobicContact CG2-CG 4.42Å
47	P	69.1	Low	71.3	Confident	81 Å²	81	119 Å²	119	53%	0.526	63%	0.63	S	S	.	*			trans	-60.1	130.9	-180	-20.6	31.9	0	0	0	110.6	L45 N49 L50	L45-P47 VanDerWaalsContact O-CD 3.26Å; L45-P47 WeakPolarHBondContact O-CD 3.49Å; P47-N49 PolarHBondContact O-N 3.28Å; P47-L50 WeakPolarHBondContact O-CG 3.33Å; P47-L50 PolarHBondContact O-N 3.27Å
48	K	63.8	Low	69.2	Low	210 Å²	210	121.7 Å²	121.7	91%	0.913	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.9	-14.4	176.4	-79.5	-178.5	175.2	177	0	114.4	I46	I46-K48 PolarHBondContact O-N 3.11Å
49	N	54.8	Low	67.3	Low	138 Å²	138	125 Å²	125	74%	0.738	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.5	31.7	-176.7	-56.7	-8.9	0	0	0	112.4	P47 S51	P47-N49 PolarHBondContact O-N 3.28Å; N49-S51 PolarHBondContact O-N 3.03Å; N49-S51 PolarHBondContact O-OG 3.13Å
50	L	56.4	Low	65.3	Low	79 Å²	79	129.3 Å²	129.3	41%	0.414	67%	0.669	S	S	.	*			trans	-71.7	58	164.2	-68.8	172.5	0	0	0	110.2	I46 P47 N52 F53	I46-L50 HydrophobicContact CG2-CD1 3.3Å; I46-L50 HydrophobicContact CG2-CG 4.42Å; P47-L50 WeakPolarHBondContact O-CG 3.33Å; P47-L50 PolarHBondContact O-N 3.27Å; L50-N52 PolarHBondContact O-N 3.13Å; L50-F53 HydrophobicContact CD2-CD2 3.33Å; L50-F53 HydrophobicContact CD2-CE2 3.68Å; L50-F53 HydrophobicContact CD2-CG 4.2Å
51	S	52.4	Low	63.1	Low	99 Å²	99	135.2 Å²	135.2	69%	0.692	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.1	103.3	158.4	46.5	0	0	0	0	106.9	N49	N49-S51 PolarHBondContact O-N 3.03Å; N49-S51 PolarHBondContact O-OG 3.13Å
52	N	55.8	Low	61.8	Low	154 Å²	154	135.6 Å²	135.6	82%	0.824	70%	0.704	S	S	*	*	T	Hydrogen-bonded Turn	trans	81.5	46.1	166.9	-49.7	-12	0	0	0	117.7	L50 E54	L50-N52 PolarHBondContact O-N 3.13Å; N52-E54 PolarHBondContact O-N 3.31Å
53	F	53.5	Low	60.6	Low	156 Å²	156	139.9 Å²	139.9	68%	0.684	72%	0.718	S	S	*	*			trans	-80.5	102.2	145.8	-91.6	-96.8	0	0	0	107.1	L50 L55	L50-F53 HydrophobicContact CD2-CD2 3.33Å; L50-F53 HydrophobicContact CD2-CE2 3.68Å; L50-F53 HydrophobicContact CD2-CG 4.2Å; F53-L55 PolarHBondContact O-N 3.03Å
54	E	57.3	Low	59.4	Low	172 Å²	172	144.6 Å²	144.6	80%	0.804	74%	0.737	S	S	*	*			trans	-57.3	87.9	160.4	-81	-179.4	158.5	0	0	107.3	N52 N56	N52-E54 PolarHBondContact O-N 3.31Å; E54-N56 PolarHBondContact O-N 3.1Å
55	L	53.4	Low	58	Low	137 Å²	137	144.5 Å²	144.5	72%	0.717	74%	0.74	S	S	*	*			trans	-68.3	87.2	166.4	-71.4	170.6	0	0	0	105.7	F53 I57	F53-L55 PolarHBondContact O-N 3.03Å; L55-I57 HydrophobicContact CB-CD1 4.37Å; L55-I57 HydrophobicContact CB-CG1 4.13Å; L55-I57 PolarHBondContact O-N 3Å
56	N	55	Low	56.6	Low	145 Å²	145	144.3 Å²	144.3	78%	0.775	74%	0.738	S	S	*	*			trans	-64.4	72.5	163	-90.4	-42.2	0	0	0	107.9	E54 P58	E54-N56 PolarHBondContact O-N 3.1Å; N56-P58 VanDerWaalsContact O-CD 3.3Å; N56-P58 WeakPolarHBondContact O-CD 3.45Å
57	I	61.1	Low	55.4	Low	128 Å²	128	147.4 Å²	147.4	66%	0.656	75%	0.753	S	S	*	*			trans	-79.3	111.9	164.1	-57.9	175	0	0	0	104.4	L55 E59	L55-I57 HydrophobicContact CB-CD1 4.37Å; L55-I57 HydrophobicContact CB-CG1 4.13Å; L55-I57 PolarHBondContact O-N 3Å; I57-E59 PolarHBondContact O-N 3.32Å; I57-E59 VanDerWaalsContact O-N 3.13Å
58	P	51.5	Low	54.4	Low	102 Å²	102	152.1 Å²	152.1	66%	0.662	77%	0.769	S	S	*	*			trans	-61	120.9	175.2	-17	30.9	0	0	0	108	N56 F60	N56-P58 VanDerWaalsContact O-CD 3.3Å; N56-P58 WeakPolarHBondContact O-CD 3.45Å; P58-F60 PolarHBondContact O-N 3.36Å
59	E	52.8	Low	53.7	Low	173 Å²	173	147.7 Å²	147.7	81%	0.808	76%	0.758	S	S	*	*			trans	-57.4	121.3	166.8	-79.4	-179.3	157.4	0	0	107.6	I57 I61	I57-E59 PolarHBondContact O-N 3.32Å; I57-E59 VanDerWaalsContact O-N 3.13Å; E59-I61 PolarHBondContact O-N 3.16Å
60	F	48.5	Very low	53.6	Low	212 Å²	212	148.5 Å²	148.5	93%	0.93	76%	0.76	S	S	*	*			trans	-70.4	98.2	168	-78.8	-87.4	0	0	0	107.4	P58	P58-F60 PolarHBondContact O-N 3.36Å
61	I	45.8	Very low	53.4	Low	225 Å²	225	154.8 Å²	154.8	100%	1.154	79%	0.792	S	S	*	*			trans	-77.1	0	166.6	-56.3	-174.3	0	0	0	109.4	E59	E59-I61 PolarHBondContact O-N 3.16Å

Retrieved 61 of 61 residues in 35.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).