A0A061AKL8_CAEEL Loading...

Ubiquitin-like domain-containing protein

AlphaFold DB , UniProt , Accession A0A061AKL8, Species CAEEL (Caenorhabditis elegans), Gene n/a, Length 69 aa.

						>A0A061AKL8_CAEEL|A0A061AKL8
MLVKEIDVSGHILRLYFEGQELWIPDRTLASYRVRPGDTVDIYLENIAEQLAIKFGNQDKSPDGKLRDE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.2	Low	69.7	Low	221 Å²	221	124.9 Å²	124.9	100%	1.089	67%	0.669	S	S	*	*				0	113	0	-169.3	174.3	89.4	0	0	106.9	V3	M1-V3 HydrophobicContact CE-CG2 3.78Å; M1-V3 PolarHBondContact O-N 3.28Å
2	L	53.2	Low	70.7	Confident	174 Å²	174	119.9 Å²	119.9	91%	0.911	64%	0.641	S	S	*	*			trans	-83.3	108	177.7	-145	96.7	0	0	0	106.8
3	V	59.1	Low	71.8	Confident	109 Å²	109	117.8 Å²	117.8	66%	0.661	63%	0.629	S	S	*	*			trans	-81.8	119.7	173.1	-179.9	0	0	0	0	106.7	M1	M1-V3 HydrophobicContact CE-CG2 3.78Å; M1-V3 PolarHBondContact O-N 3.28Å
4	K	69.8	Low	72.8	Confident	175 Å²	175	114.1 Å²	114.1	76%	0.761	60%	0.602	S	S	*	*			trans	-102.3	113.9	173	-172.9	176.9	-179.7	-176.2	0	107.5
5	E	71.3	Confident	73.8	Confident	185 Å²	185	108.3 Å²	108.3	86%	0.864	57%	0.571	S	S	*	*			trans	-71	134	168.9	-67.5	-179	175.6	0	0	108.7
6	I	70.9	Confident	75	Confident	119 Å²	119	104.6 Å²	104.6	61%	0.61	55%	0.547	S	S	*	.			trans	-118	127.3	179.2	-57.7	174.2	0	0	0	106.4	V8	I6-V8 PolarHBondContact O-N 3.06Å
7	D	76.4	Confident	76.1	Confident	119 Å²	119	99.6 Å²	99.6	64%	0.636	52%	0.52	S	S	*	.			trans	-71.1	116.8	169.8	-177.4	13.5	0	0	0	109.1	S9	D7-S9 WeakPolarHBondContact OD1-CB 3.26Å; D7-S9 PolarHBondContact OD1-N 2.97Å; D7-S9 PolarHBondContact OD1-OG 2.97Å
8	V	75.8	Confident	77	Confident	72 Å²	72	103.8 Å²	103.8	44%	0.436	54%	0.537	S	S	.	.			trans	-101.2	8.1	179.2	-62.2	0	0	0	0	112.1	I6 G10 H11 L44	I6-V8 PolarHBondContact O-N 3.06Å; V8-G10 PolarHBondContact O-N 3.42Å; V8-H11 WeakPolarHBondContact O-CB 3.48Å; V8-H11 PolarHBondContact O-N 3.4Å; V8-H11 PolarHBondContact O-ND1 3.3Å; V8-L44 HydrophobicContact CB-CD2 4.23Å; V8-L44 HydrophobicContact CG1-CD1 3.88Å; V8-L44 HydrophobicContact CG1-CD2 3.76Å
9	S	79.3	Confident	77.7	Confident	86 Å²	86	101.9 Å²	101.9	60%	0.601	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.7	132.7	174.5	-58.8	0	0	0	0	110.2	D7 H11	D7-S9 WeakPolarHBondContact OD1-CB 3.26Å; D7-S9 PolarHBondContact OD1-N 2.97Å; D7-S9 PolarHBondContact OD1-OG 2.97Å; S9-H11 VanDerWaalsContact C-N 3.3Å; S9-H11 PolarHBondContact O-N 3.26Å; S9-H11 PolarHBondContact O-ND1 3.27Å
10	G	77.8	Confident	78.3	Confident	46 Å²	46	102.7 Å²	102.7	47%	0.474	55%	0.545	S	S	.	.	T	Hydrogen-bonded Turn	trans	75	12.1	-177.8	0	0	0	0	0	115.4	V8 I47	V8-G10 PolarHBondContact O-N 3.42Å; G10-I47 WeakPolarHBondContact O-CB 3.18Å; G10-I47 WeakPolarHBondContact O-CG1 3.3Å; G10-I47 PolarHBondContact O-N 3.2Å
11	H	82.4	Confident	78.9	Confident	68 Å²	68	101.3 Å²	101.3	32%	0.315	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	146.1	174.2	-60.9	73.3	0	0	0	111.7	V8 S9 L44 E45	V8-H11 WeakPolarHBondContact O-CB 3.48Å; V8-H11 PolarHBondContact O-N 3.4Å; V8-H11 PolarHBondContact O-ND1 3.3Å; S9-H11 VanDerWaalsContact C-N 3.3Å; S9-H11 PolarHBondContact O-N 3.26Å; S9-H11 PolarHBondContact O-ND1 3.27Å; H11-L44 HydrophobicContact CB-CB 4.4Å; H11-L44 HydrophobicContact CB-CD2 4.25Å; H11-E45 CarbonylContact C-O 3.46Å; H11-E45 WeakPolarHBondContact CA-O 3.33Å
12	I	81.6	Confident	80.7	Confident	65 Å²	65	91.1 Å²	91.1	33%	0.333	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	126.6	162.5	-68.1	159.5	0	0	0	107	R14 E45 I47	I12-R14 HydrophobicContact CG2-CG 4.23Å; I12-E45 PolarHBondContact N-O 2.72Å; I12-E45 PolarHBondContact O-N 2.89Å; I12-I47 HydrophobicContact CD1-CG1 3.9Å; I12-I47 HydrophobicContact CG1-CD1 3.97Å; I12-I47 HydrophobicContact CG1-CG1 3.64Å
13	L	84.1	Confident	82	Confident	93 Å²	93	91.7 Å²	91.7	49%	0.487	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.6	126	175.5	-177.7	140.9	0	0	0	109.4	L15 I42 L44	L13-L15 HydrophobicContact CD2-CD1 3.36Å; L13-L15 HydrophobicContact CD2-CD2 4.09Å; L13-L15 HydrophobicContact CD2-CG 4.34Å; L13-I42 HydrophobicContact CD1-CG2 3.78Å; L13-I42 HydrophobicContact CG-CG2 3.91Å; L13-L44 HydrophobicContact CB-CD2 4.3Å; L13-L44 HydrophobicContact CD1-CD2 4.05Å; L13-L44 HydrophobicContact CG-CD2 4.43Å
14	R	86.3	Confident	82.6	Confident	66 Å²	66	90.4 Å²	90.4	25%	0.249	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	132.3	173.2	-60.3	-172.2	-174.2	-131.4	16.3	110.4	I12 Y16 E21 Y43 E45	I12-R14 HydrophobicContact CG2-CG 4.23Å; R14-Y16 HydrophobicContact CB-CD2 4.37Å; R14-Y16 HydrophobicContact CB-CE2 3.62Å; R14-Y16 WeakPolarHBondContact CD-OH 3.23Å; R14-E21 WeakPolarHBondContact CD-OE1 3.49Å; R14-E21 IonicContact CZ-OE1 3.05Å; R14-E21 IonicContact NE-OE1 3.9Å; R14-E21 IonicContact NH1-OE1 2.8Å; R14-E21 PolarHBondContact NH1-OE1 3.45Å; R14-E21 IonicContact NH1-OE2 3.92Å; R14-E21 PolarHBondContact NH1-OE2 2.96Å; R14-Y43 PolarHBondContact N-O 3.32Å; R14-Y43 PolarHBondContact O-N 2.9Å; R14-E45 IonicContact CZ-OE1 3.77Å; R14-E45 IonicContact CZ-OE2 3.96Å; R14-E45 VanDerWaalsContact NE-CD 3.27Å; R14-E45 IonicContact NE-OE1 3.37Å; R14-E45 PolarHBondContact NE-OE1 3.49Å; R14-E45 IonicContact NE-OE2 3.31Å; R14-E45 PolarHBondContact NE-OE2 2.8Å; R14-E45 IonicContact NH2-OE1 2.89Å; R14-E45 IonicContact NH2-OE2 3.41Å; R14-E45 PolarHBondContact NH2-OE2 3.41Å
15	L	88.4	Confident	82.4	Confident	26 Å²	26	85.5 Å²	85.5	14%	0.136	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	140.8	173.6	-69	79.7	0	0	0	109.4	L13 E21 L22 I24 V40 D41 I42	L13-L15 HydrophobicContact CD2-CD1 3.36Å; L13-L15 HydrophobicContact CD2-CD2 4.09Å; L13-L15 HydrophobicContact CD2-CG 4.34Å; L15-E21 WeakPolarHBondContact O-CA 3.2Å; L15-L22 HydrophobicContact CB-CB 3.94Å; L15-L22 HydrophobicContact CB-CD1 3.94Å; L15-L22 HydrophobicContact CB-CG 4.01Å; L15-L22 PolarHBondContact O-N 2.99Å; L15-I24 HydrophobicContact CB-CD1 4.47Å; L15-I24 HydrophobicContact CD1-CD1 3.41Å; L15-I24 VanDerWaalsContact CD1-CD1 3.41Å; L15-I24 HydrophobicContact CD1-CG1 4.28Å; L15-I24 HydrophobicContact CG-CD1 3.86Å; L15-V40 HydrophobicContact CB-CG1 4.25Å; L15-V40 HydrophobicContact CD2-CG1 4.06Å; L15-V40 HydrophobicContact CG-CG1 4.45Å; L15-D41 CarbonylContact C-O 3.57Å; L15-D41 WeakPolarHBondContact CA-O 3.46Å; L15-I42 HydrophobicContact CD2-CD1 4.24Å; L15-I42 HydrophobicContact CD2-CG1 3.7Å
16	Y	91.9	Very high	82.2	Confident	49 Å²	49	84.2 Å²	84.2	19%	0.192	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.6	142.4	169.6	-64.6	-101.6	0	0	0	111	R14 Q20 E21 V40 D41 Y43	R14-Y16 HydrophobicContact CB-CD2 4.37Å; R14-Y16 HydrophobicContact CB-CE2 3.62Å; R14-Y16 WeakPolarHBondContact CD-OH 3.23Å; Y16-Q20 CarbonylContact C-O 3.59Å; Y16-Q20 VanDerWaalsContact CA-O 3.23Å; Y16-Q20 WeakPolarHBondContact CA-O 3.46Å; Y16-E21 HydrophobicContact CD1-CB 3.96Å; Y16-E21 HydrophobicContact CE1-CB 3.54Å; Y16-E21 HydrophobicContact CE1-CG 3.99Å; Y16-V40 WeakPolarHBondContact O-CG1 3.4Å; Y16-D41 PolarHBondContact N-O 3.37Å; Y16-D41 PolarHBondContact O-N 2.79Å; Y16-Y43 AromaticContact CD2-CD2 3.41Å; Y16-Y43 HydrophobicContact CD2-CD2 3.41Å; Y16-Y43 VanDerWaalsContact CD2-CD2 3.41Å; Y16-Y43 AromaticContact CD2-CE2 3.67Å; Y16-Y43 HydrophobicContact CD2-CE2 3.67Å; Y16-Y43 HydrophobicContact CD2-CG 4.45Å; Y16-Y43 AromaticContact CE2-CD2 3.67Å; Y16-Y43 HydrophobicContact CE2-CD2 3.67Å; Y16-Y43 HydrophobicContact CE2-CE2 4.17Å; Y16-Y43 HydrophobicContact CE2-CG 4.33Å; Y16-Y43 HydrophobicContact CG-CD2 4.43Å; Y16-Y43 HydrophobicContact CG-CE2 4.3Å
17	F	93.9	Very high	82.2	Confident	20 Å²	20	85.8 Å²	85.8	9%	0.088	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	125.4	169.8	-179.5	-117.1	0	0	0	108.8	G19 Q20 L22 V34 D38 T39 V40	F17-G19 PolarHBondContact O-N 2.73Å; F17-G19 VanDerWaalsContact O-N 3.12Å; F17-Q20 PolarHBondContact N-O 3.49Å; F17-Q20 WeakPolarHBondContact O-CB 3.46Å; F17-Q20 PolarHBondContact O-N 3.19Å; F17-L22 HydrophobicContact CB-CD1 4.04Å; F17-L22 HydrophobicContact CB-CD2 3.77Å; F17-L22 HydrophobicContact CB-CG 4.29Å; F17-V34 HydrophobicContact CB-CG2 4.13Å; F17-V34 HydrophobicContact CD1-CG2 3.62Å; F17-V34 HydrophobicContact CD2-CG2 3.95Å; F17-V34 HydrophobicContact CE1-CG2 3.94Å; F17-V34 HydrophobicContact CE2-CG2 4.28Å; F17-V34 HydrophobicContact CG-CG2 3.61Å; F17-V34 HydrophobicContact CZ-CG2 4.26Å; F17-D38 HydrophobicContact CE2-CB 3.76Å; F17-D38 HydrophobicContact CZ-CB 4.2Å; F17-T39 WeakPolarHBondContact CD2-O 3.23Å; F17-V40 HydrophobicContact CD2-CG2 4.34Å
18	E	92.8	Very high	82.6	Confident	176 Å²	176	84.3 Å²	84.3	82%	0.822	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.4	36.3	-176.5	-59	-171.7	147.8	0	0	113.4	Q20	E18-Q20 VanDerWaalsContact C-N 3.26Å; E18-Q20 PolarHBondContact O-N 3.32Å
19	G	90.6	Very high	83.2	Confident	67 Å²	67	84.7 Å²	84.7	69%	0.691	44%	0.442	S	S	*	.	T	Hydrogen-bonded Turn	trans	79	-1.4	-177.8	0	0	0	0	0	115.3	F17	F17-G19 PolarHBondContact O-N 2.73Å; F17-G19 VanDerWaalsContact O-N 3.12Å
20	Q	90.4	Very high	83.6	Confident	117 Å²	117	84 Å²	84	55%	0.547	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	128.8	174.7	-177.1	-178.3	-31.3	0	0	111.2	Y16 F17 E18 L22	Y16-Q20 CarbonylContact C-O 3.59Å; Y16-Q20 VanDerWaalsContact CA-O 3.23Å; Y16-Q20 WeakPolarHBondContact CA-O 3.46Å; F17-Q20 PolarHBondContact N-O 3.49Å; F17-Q20 WeakPolarHBondContact O-CB 3.46Å; F17-Q20 PolarHBondContact O-N 3.19Å; E18-Q20 VanDerWaalsContact C-N 3.26Å; E18-Q20 PolarHBondContact O-N 3.32Å; Q20-L22 WeakPolarHBondContact O-CD2 3.4Å; Q20-L22 PolarHBondContact O-N 3.22Å
21	E	90	Very high	84	Confident	74 Å²	74	84.9 Å²	84.9	35%	0.346	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.4	128.7	172	-167.8	171.2	-179.4	0	0	110.8	R14 L15 Y16	R14-E21 WeakPolarHBondContact CD-OE1 3.49Å; R14-E21 IonicContact CZ-OE1 3.05Å; R14-E21 IonicContact NE-OE1 3.9Å; R14-E21 IonicContact NH1-OE1 2.8Å; R14-E21 PolarHBondContact NH1-OE1 3.45Å; R14-E21 IonicContact NH1-OE2 3.92Å; R14-E21 PolarHBondContact NH1-OE2 2.96Å; L15-E21 WeakPolarHBondContact O-CA 3.2Å; Y16-E21 HydrophobicContact CD1-CB 3.96Å; Y16-E21 HydrophobicContact CE1-CB 3.54Å; Y16-E21 HydrophobicContact CE1-CG 3.99Å
22	L	89.1	Confident	84.3	Confident	7 Å²	7	83.3 Å²	83.3	4%	0.037	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	107.8	177.3	-40.1	-178.3	0	0	0	108.8	L15 F17 Q20 I24 L29 Y32 V40	L15-L22 HydrophobicContact CB-CB 3.94Å; L15-L22 HydrophobicContact CB-CD1 3.94Å; L15-L22 HydrophobicContact CB-CG 4.01Å; L15-L22 PolarHBondContact O-N 2.99Å; F17-L22 HydrophobicContact CB-CD1 4.04Å; F17-L22 HydrophobicContact CB-CD2 3.77Å; F17-L22 HydrophobicContact CB-CG 4.29Å; Q20-L22 WeakPolarHBondContact O-CD2 3.4Å; Q20-L22 PolarHBondContact O-N 3.22Å; L22-I24 HydrophobicContact CB-CD1 4.47Å; L22-I24 HydrophobicContact CB-CG1 4.25Å; L22-I24 WeakPolarHBondContact O-CG1 3.41Å; L22-I24 PolarHBondContact O-N 2.92Å; L22-L29 HydrophobicContact CD1-CD2 3.77Å; L22-Y32 HydrophobicContact CB-CD2 4.33Å; L22-Y32 HydrophobicContact CB-CE1 4.41Å; L22-Y32 HydrophobicContact CB-CE2 4.13Å; L22-Y32 HydrophobicContact CD2-CD1 3.46Å; L22-Y32 VanDerWaalsContact CD2-CD1 3.46Å; L22-Y32 HydrophobicContact CD2-CD2 4.15Å; L22-Y32 HydrophobicContact CD2-CE1 3.93Å; L22-Y32 HydrophobicContact CD2-CG 3.58Å; L22-Y32 HydrophobicContact CG-CG 4.47Å; L22-V40 HydrophobicContact CD1-CG1 4.31Å
23	W	81.3	Confident	84.8	Confident	186 Å²	186	90.1 Å²	90.1	71%	0.705	45%	0.454	S	S	*	.			trans	-86.8	107.7	176.9	-143.2	64	0	0	0	109.8	P25 Y32	W23-P25 HydrophobicContact CD2-CG 3.98Å; W23-P25 HydrophobicContact CE3-CG 3.33Å; W23-P25 HydrophobicContact CH2-CG 4.01Å; W23-P25 HydrophobicContact CZ3-CG 3.35Å; W23-P25 WeakPolarHBondContact O-CD 3.13Å; W23-Y32 PolarHBondContact N-OH 2.85Å; W23-Y32 PolarHBondContact O-OH 3.48Å
24	I	70.2	Confident	85.2	Confident	83 Å²	83	86.8 Å²	86.8	43%	0.426	44%	0.437	S	S	.	.			trans	-109.5	55.1	-169	-36.7	-174.6	0	0	0	114.2	L15 L22 R27	L15-I24 HydrophobicContact CB-CD1 4.47Å; L15-I24 HydrophobicContact CD1-CD1 3.41Å; L15-I24 VanDerWaalsContact CD1-CD1 3.41Å; L15-I24 HydrophobicContact CD1-CG1 4.28Å; L15-I24 HydrophobicContact CG-CD1 3.86Å; L22-I24 HydrophobicContact CB-CD1 4.47Å; L22-I24 HydrophobicContact CB-CG1 4.25Å; L22-I24 WeakPolarHBondContact O-CG1 3.41Å; L22-I24 PolarHBondContact O-N 2.92Å; I24-R27 WeakPolarHBondContact CG2-O 3.5Å
25	P	66.5	Low	85.6	Confident	71 Å²	71	92.3 Å²	92.3	46%	0.461	46%	0.458	S	S	.	.	S	Bend	trans	-72.5	-42.1	162.4	-5.1	17.8	0	0	0	111.1	W23	W23-P25 HydrophobicContact CD2-CG 3.98Å; W23-P25 HydrophobicContact CE3-CG 3.33Å; W23-P25 HydrophobicContact CH2-CG 4.01Å; W23-P25 HydrophobicContact CZ3-CG 3.35Å; W23-P25 WeakPolarHBondContact O-CD 3.13Å
26	D	67.3	Low	85.8	Confident	158 Å²	158	97.7 Å²	97.7	85%	0.845	50%	0.495	S	S	*	.	S	Bend	trans	-146.9	25	-168.1	-59.8	-61.9	0	0	0	114.1
27	R	70.3	Confident	85.9	Confident	152 Å²	152	99.2 Å²	99.2	57%	0.574	53%	0.525	S	S	*	.			trans	-122.1	152.5	-176.2	-68.1	-175.2	-180	-138	1.1	111.9	I24 Y32	I24-R27 WeakPolarHBondContact CG2-O 3.5Å; R27-Y32 HydrophobicContact CB-CE2 3.92Å; R27-Y32 WeakPolarHBondContact CD-OH 3.41Å
28	T	85.6	Confident	85.9	Confident	89 Å²	89	101.6 Å²	101.6	55%	0.546	54%	0.539	S	S	.	.			trans	-97.2	159.2	172.7	67.5	0	0	0	0	109.9	A30 S31	T28-A30 PolarHBondContact O-N 3.05Å; T28-S31 VanDerWaalsContact O-CB 3.23Å; T28-S31 WeakPolarHBondContact O-CB 3.45Å; T28-S31 PolarHBondContact O-N 3.46Å; T28-S31 PolarHBondContact O-OG 2.87Å; T28-S31 PolarHBondContact OG1-OG 2.91Å
29	L	87.7	Confident	86	Confident	79 Å²	79	98.4 Å²	98.4	41%	0.414	53%	0.532	S	S	.	.	G	3₁₀ helix	trans	-56.3	-32.9	173.4	-65.3	178.5	0	0	0	112.2	L22 S31 Y32 R33 V34	L22-L29 HydrophobicContact CD1-CD2 3.77Å; L29-S31 PolarHBondContact O-N 3.35Å; L29-Y32 CarbonylContact O-C 3.58Å; L29-Y32 WeakPolarHBondContact O-CA 3.39Å; L29-Y32 WeakPolarHBondContact O-CB 3.35Å; L29-Y32 PolarHBondContact O-N 2.89Å; L29-R33 PolarHBondContact O-N 2.64Å; L29-V34 HydrophobicContact CB-CB 4.01Å; L29-V34 HydrophobicContact CB-CG1 4.37Å; L29-V34 HydrophobicContact CB-CG2 4.31Å; L29-V34 WeakPolarHBondContact O-CB 3.22Å; L29-V34 PolarHBondContact O-N 2.94Å
30	A	86.7	Confident	86	Confident	71 Å²	71	97.2 Å²	97.2	59%	0.587	51%	0.51	S	S	*	.	G	3₁₀ helix	trans	-62.2	-29.5	176.2	0	0	0	0	0	112.9	T28 Y32 R33	T28-A30 PolarHBondContact O-N 3.05Å; A30-Y32 PolarHBondContact O-N 2.91Å; A30-R33 PolarHBondContact O-N 2.88Å
31	S	87.5	Confident	86.1	Confident	66 Å²	66	95.2 Å²	95.2	46%	0.462	50%	0.504	S	S	.	.	G	3₁₀ helix	trans	-64.5	-22.4	174.2	-53.6	0	0	0	0	112.6	T28 L29	T28-S31 VanDerWaalsContact O-CB 3.23Å; T28-S31 WeakPolarHBondContact O-CB 3.45Å; T28-S31 PolarHBondContact O-N 3.46Å; T28-S31 PolarHBondContact O-OG 2.87Å; T28-S31 PolarHBondContact OG1-OG 2.91Å; L29-S31 PolarHBondContact O-N 3.35Å
32	Y	88.4	Confident	86	Confident	34 Å²	34	96.8 Å²	96.8	13%	0.133	51%	0.513	C	S	.	.	G	3₁₀ helix	trans	-96.8	11.8	173.7	-64.3	-84.5	0	0	0	112.7	L22 W23 R27 L29 A30 V34	L22-Y32 HydrophobicContact CB-CD2 4.33Å; L22-Y32 HydrophobicContact CB-CE1 4.41Å; L22-Y32 HydrophobicContact CB-CE2 4.13Å; L22-Y32 HydrophobicContact CD2-CD1 3.46Å; L22-Y32 VanDerWaalsContact CD2-CD1 3.46Å; L22-Y32 HydrophobicContact CD2-CD2 4.15Å; L22-Y32 HydrophobicContact CD2-CE1 3.93Å; L22-Y32 HydrophobicContact CD2-CG 3.58Å; L22-Y32 HydrophobicContact CG-CG 4.47Å; W23-Y32 PolarHBondContact N-OH 2.85Å; W23-Y32 PolarHBondContact O-OH 3.48Å; R27-Y32 HydrophobicContact CB-CE2 3.92Å; R27-Y32 WeakPolarHBondContact CD-OH 3.41Å; L29-Y32 CarbonylContact O-C 3.58Å; L29-Y32 WeakPolarHBondContact O-CA 3.39Å; L29-Y32 WeakPolarHBondContact O-CB 3.35Å; L29-Y32 PolarHBondContact O-N 2.89Å; A30-Y32 PolarHBondContact O-N 2.91Å; Y32-V34 PolarHBondContact O-N 3.38Å
33	R	91.2	Very high	85.9	Confident	209 Å²	209	102.5 Å²	102.5	79%	0.789	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.5	14.9	-178.6	-53.2	176.5	175.6	177	-1	114.8	L29 A30 R35	L29-R33 PolarHBondContact O-N 2.64Å; A30-R33 PolarHBondContact O-N 2.88Å; R33-R35 PolarHBondContact O-N 3.12Å
34	V	92.9	Very high	86	Confident	23 Å²	23	97 Å²	97	14%	0.139	52%	0.519	C	S	.	.			trans	-63.3	131.9	171.1	-176.5	0	0	0	0	109.1	F17 L29 Y32 D38 V40	F17-V34 HydrophobicContact CB-CG2 4.13Å; F17-V34 HydrophobicContact CD1-CG2 3.62Å; F17-V34 HydrophobicContact CD2-CG2 3.95Å; F17-V34 HydrophobicContact CE1-CG2 3.94Å; F17-V34 HydrophobicContact CE2-CG2 4.28Å; F17-V34 HydrophobicContact CG-CG2 3.61Å; F17-V34 HydrophobicContact CZ-CG2 4.26Å; L29-V34 HydrophobicContact CB-CB 4.01Å; L29-V34 HydrophobicContact CB-CG1 4.37Å; L29-V34 HydrophobicContact CB-CG2 4.31Å; L29-V34 WeakPolarHBondContact O-CB 3.22Å; L29-V34 PolarHBondContact O-N 2.94Å; Y32-V34 PolarHBondContact O-N 3.38Å; V34-D38 HydrophobicContact CG1-CB 4.07Å; V34-V40 HydrophobicContact CG1-CG2 3.99Å; V34-V40 HydrophobicContact CG2-CG2 4.47Å
35	R	94.3	Very high	86.6	Confident	182 Å²	182	95.8 Å²	95.8	69%	0.687	51%	0.512	S	S	*	.			trans	-119.1	161.6	-178.9	-61.5	-178.7	-177.5	-174.8	-0.6	111.1	R33 G37 D38	R33-R35 PolarHBondContact O-N 3.12Å; R35-G37 PolarHBondContact O-N 2.88Å; R35-D38 WeakPolarHBondContact CB-OD2 3.48Å; R35-D38 PolarHBondContact N-OD2 3.01Å; R35-D38 VanDerWaalsContact O-CB 3.26Å; R35-D38 WeakPolarHBondContact O-CB 3.43Å; R35-D38 PolarHBondContact O-N 3.42Å
36	P	93.1	Very high	87.4	Confident	139 Å²	139	94.9 Å²	94.9	90%	0.903	50%	0.503	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.7	129.1	169.9	-24.5	34.9	0	0	0	111.3
37	G	93.6	Very high	87.8	Confident	80 Å²	80	90.3 Å²	90.3	83%	0.825	48%	0.478	S	S	*	.	T	Hydrogen-bonded Turn	trans	97.7	-14.1	-176.4	0	0	0	0	0	114.2	R35	R35-G37 PolarHBondContact O-N 2.88Å
38	D	94.9	Very high	87.9	Confident	71 Å²	71	86 Å²	86	38%	0.38	48%	0.475	S	S	.	.			trans	-73.6	151.1	173.6	-68.4	-12.5	0	0	0	111.5	F17 V34 R35	F17-D38 HydrophobicContact CE2-CB 3.76Å; F17-D38 HydrophobicContact CZ-CB 4.2Å; V34-D38 HydrophobicContact CG1-CB 4.07Å; R35-D38 WeakPolarHBondContact CB-OD2 3.48Å; R35-D38 PolarHBondContact N-OD2 3.01Å; R35-D38 VanDerWaalsContact O-CB 3.26Å; R35-D38 WeakPolarHBondContact O-CB 3.43Å; R35-D38 PolarHBondContact O-N 3.42Å
39	T	94.3	Very high	87.2	Confident	109 Å²	109	87.8 Å²	87.8	67%	0.669	48%	0.477	S	S	*	.			trans	-98	134.1	176.5	-57.4	0	0	0	0	110.3	F17	F17-T39 WeakPolarHBondContact CD2-O 3.23Å
40	V	91.4	Very high	86.3	Confident	41 Å²	41	87.4 Å²	87.4	25%	0.248	47%	0.473	C	S	.	.			trans	-116.8	129.8	172.8	177.6	0	0	0	0	108.2	L15 Y16 F17 L22 V34	L15-V40 HydrophobicContact CB-CG1 4.25Å; L15-V40 HydrophobicContact CD2-CG1 4.06Å; L15-V40 HydrophobicContact CG-CG1 4.45Å; Y16-V40 WeakPolarHBondContact O-CG1 3.4Å; F17-V40 HydrophobicContact CD2-CG2 4.34Å; L22-V40 HydrophobicContact CD1-CG1 4.31Å; V34-V40 HydrophobicContact CG1-CG2 3.99Å; V34-V40 HydrophobicContact CG2-CG2 4.47Å
41	D	92.3	Very high	85.4	Confident	76 Å²	76	88 Å²	88	41%	0.406	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.7	137.7	177.7	-61.2	-49	0	0	0	110.2	L15 Y16 Y43	L15-D41 CarbonylContact C-O 3.57Å; L15-D41 WeakPolarHBondContact CA-O 3.46Å; Y16-D41 PolarHBondContact N-O 3.37Å; Y16-D41 PolarHBondContact O-N 2.79Å; D41-Y43 HydrophobicContact CB-CD2 4.44Å; D41-Y43 HydrophobicContact CB-CE2 3.78Å
42	I	87.3	Confident	84.4	Confident	107 Å²	107	87.8 Å²	87.8	55%	0.549	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	123.3	178.6	-53.3	-178.7	0	0	0	108.4	L13 L15	L13-I42 HydrophobicContact CD1-CG2 3.78Å; L13-I42 HydrophobicContact CG-CG2 3.91Å; L15-I42 HydrophobicContact CD2-CD1 4.24Å; L15-I42 HydrophobicContact CD2-CG1 3.7Å
43	Y	86.8	Confident	83.5	Confident	127 Å²	127	91.9 Å²	91.9	50%	0.498	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	128.8	173.5	-66	-99.1	0	0	0	109.3	R14 Y16 D41	R14-Y43 PolarHBondContact N-O 3.32Å; R14-Y43 PolarHBondContact O-N 2.9Å; Y16-Y43 AromaticContact CD2-CD2 3.41Å; Y16-Y43 HydrophobicContact CD2-CD2 3.41Å; Y16-Y43 VanDerWaalsContact CD2-CD2 3.41Å; Y16-Y43 AromaticContact CD2-CE2 3.67Å; Y16-Y43 HydrophobicContact CD2-CE2 3.67Å; Y16-Y43 HydrophobicContact CD2-CG 4.45Å; Y16-Y43 AromaticContact CE2-CD2 3.67Å; Y16-Y43 HydrophobicContact CE2-CD2 3.67Å; Y16-Y43 HydrophobicContact CE2-CE2 4.17Å; Y16-Y43 HydrophobicContact CE2-CG 4.33Å; Y16-Y43 HydrophobicContact CG-CD2 4.43Å; Y16-Y43 HydrophobicContact CG-CE2 4.3Å; D41-Y43 HydrophobicContact CB-CD2 4.44Å; D41-Y43 HydrophobicContact CB-CE2 3.78Å
44	L	84.6	Confident	82.2	Confident	69 Å²	69	89.1 Å²	89.1	36%	0.361	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	108.5	172.1	-67.8	171.6	0	0	0	107.6	V8 H11 L13	V8-L44 HydrophobicContact CB-CD2 4.23Å; V8-L44 HydrophobicContact CG1-CD1 3.88Å; V8-L44 HydrophobicContact CG1-CD2 3.76Å; H11-L44 HydrophobicContact CB-CB 4.4Å; H11-L44 HydrophobicContact CB-CD2 4.25Å; L13-L44 HydrophobicContact CB-CD2 4.3Å; L13-L44 HydrophobicContact CD1-CD2 4.05Å; L13-L44 HydrophobicContact CG-CD2 4.43Å
45	E	82.8	Confident	80.8	Confident	58 Å²	58	92.8 Å²	92.8	27%	0.271	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	126.1	176.8	-64.4	-178.7	165.8	0	0	109.5	H11 I12 R14 I47 Q50	H11-E45 CarbonylContact C-O 3.46Å; H11-E45 WeakPolarHBondContact CA-O 3.33Å; I12-E45 PolarHBondContact N-O 2.72Å; I12-E45 PolarHBondContact O-N 2.89Å; R14-E45 IonicContact CZ-OE1 3.77Å; R14-E45 IonicContact CZ-OE2 3.96Å; R14-E45 VanDerWaalsContact NE-CD 3.27Å; R14-E45 IonicContact NE-OE1 3.37Å; R14-E45 PolarHBondContact NE-OE1 3.49Å; R14-E45 IonicContact NE-OE2 3.31Å; R14-E45 PolarHBondContact NE-OE2 2.8Å; R14-E45 IonicContact NH2-OE1 2.89Å; R14-E45 IonicContact NH2-OE2 3.41Å; R14-E45 PolarHBondContact NH2-OE2 3.41Å; E45-I47 PolarHBondContact O-N 3.05Å; E45-Q50 PolarHBondContact OE2-NE2 2.87Å
46	N	82.1	Confident	79	Confident	53 Å²	53	86.1 Å²	86.1	28%	0.283	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72	122.1	178.6	-173.2	-27.1	0	0	0	110.7	A48 E49 Q50	N46-A48 VanDerWaalsContact C-N 3.3Å; N46-A48 PolarHBondContact O-N 3.4Å; N46-A48 VanDerWaalsContact OD1-CB 3.29Å; N46-A48 WeakPolarHBondContact OD1-CB 3.21Å; N46-A48 PolarHBondContact OD1-N 3.26Å; N46-E49 HydrophobicContact CB-CB 4.34Å; N46-E49 HydrophobicContact CB-CG 4.1Å; N46-E49 PolarHBondContact O-N 3.31Å; N46-Q50 PolarHBondContact O-N 2.87Å
47	I	75.9	Confident	77.2	Confident	61 Å²	61	85.3 Å²	85.3	31%	0.313	48%	0.475	S	S	.	.	H	α-helix	trans	-63.4	-37.5	-179.6	-65.8	169.6	0	0	0	110.9	G10 I12 E45 E49 Q50 L51	G10-I47 WeakPolarHBondContact O-CB 3.18Å; G10-I47 WeakPolarHBondContact O-CG1 3.3Å; G10-I47 PolarHBondContact O-N 3.2Å; I12-I47 HydrophobicContact CD1-CG1 3.9Å; I12-I47 HydrophobicContact CG1-CD1 3.97Å; I12-I47 HydrophobicContact CG1-CG1 3.64Å; E45-I47 PolarHBondContact O-N 3.05Å; I47-E49 VanDerWaalsContact C-N 3.3Å; I47-E49 PolarHBondContact O-N 3.4Å; I47-Q50 PolarHBondContact O-N 3.21Å; I47-L51 HydrophobicContact CG2-CD1 3.77Å; I47-L51 HydrophobicContact CG2-CG 4.01Å; I47-L51 WeakPolarHBondContact O-CB 3.44Å; I47-L51 VanDerWaalsContact O-CG 3.3Å; I47-L51 WeakPolarHBondContact O-CG 3.5Å; I47-L51 PolarHBondContact O-N 3.46Å
48	A	72.3	Confident	75.2	Confident	63 Å²	63	88.3 Å²	88.3	52%	0.521	47%	0.468	S	S	.	.	H	α-helix	trans	-62.5	-39.1	-179.2	0	0	0	0	0	111.7	N46 L51 A52	N46-A48 VanDerWaalsContact C-N 3.3Å; N46-A48 PolarHBondContact O-N 3.4Å; N46-A48 VanDerWaalsContact OD1-CB 3.29Å; N46-A48 WeakPolarHBondContact OD1-CB 3.21Å; N46-A48 PolarHBondContact OD1-N 3.26Å; A48-L51 PolarHBondContact O-N 2.89Å; A48-A52 VanDerWaalsContact O-CB 3.31Å; A48-A52 WeakPolarHBondContact O-CB 3.15Å; A48-A52 PolarHBondContact O-N 3.31Å
49	E	71.4	Confident	73	Confident	126 Å²	126	91.8 Å²	91.8	59%	0.589	49%	0.486	S	S	*	.	H	α-helix	trans	-66.9	-41.4	175.5	-67.7	179.3	175.6	0	0	111.5	N46 I47 A52 I53	N46-E49 HydrophobicContact CB-CB 4.34Å; N46-E49 HydrophobicContact CB-CG 4.1Å; N46-E49 PolarHBondContact O-N 3.31Å; I47-E49 VanDerWaalsContact C-N 3.3Å; I47-E49 PolarHBondContact O-N 3.4Å; E49-A52 PolarHBondContact O-N 2.93Å; E49-I53 VanDerWaalsContact O-CG1 3.31Å; E49-I53 WeakPolarHBondContact O-CG1 3.29Å; E49-I53 PolarHBondContact O-N 3.33Å
50	Q	68.3	Low	70.7	Confident	70 Å²	70	94.8 Å²	94.8	33%	0.327	49%	0.49	S	S	.	.	H	α-helix	trans	-64.8	-41.3	175.7	-69.3	-164	29.8	0	0	112.7	E45 N46 I47 A52 I53 K54	E45-Q50 PolarHBondContact OE2-NE2 2.87Å; N46-Q50 PolarHBondContact O-N 2.87Å; I47-Q50 PolarHBondContact O-N 3.21Å; Q50-A52 VanDerWaalsContact C-N 3.35Å; Q50-I53 PolarHBondContact O-N 2.81Å; Q50-K54 WeakPolarHBondContact O-CB 3.31Å; Q50-K54 PolarHBondContact O-N 3.35Å
51	L	67.5	Low	68.6	Low	85 Å²	85	95.8 Å²	95.8	45%	0.445	50%	0.499	S	S	.	.	H	α-helix	trans	-65.6	-39.9	175.3	-67.9	176.4	0	0	0	111	I47 A48 K54 F55	I47-L51 HydrophobicContact CG2-CD1 3.77Å; I47-L51 HydrophobicContact CG2-CG 4.01Å; I47-L51 WeakPolarHBondContact O-CB 3.44Å; I47-L51 VanDerWaalsContact O-CG 3.3Å; I47-L51 WeakPolarHBondContact O-CG 3.5Å; I47-L51 PolarHBondContact O-N 3.46Å; A48-L51 PolarHBondContact O-N 2.89Å; L51-K54 PolarHBondContact O-N 3.41Å; L51-F55 HydrophobicContact CB-CD2 4.32Å; L51-F55 HydrophobicContact CD2-CD2 3.83Å; L51-F55 HydrophobicContact CD2-CE2 3.53Å; L51-F55 WeakPolarHBondContact O-CB 3.35Å; L51-F55 WeakPolarHBondContact O-CD2 3.31Å; L51-F55 PolarHBondContact O-N 2.89Å
52	A	67.7	Low	66.8	Low	61 Å²	61	98.3 Å²	98.3	50%	0.504	52%	0.519	S	S	.	.	H	α-helix	trans	-63.7	-39.6	175.4	0	0	0	0	0	112.4	A48 E49 Q50 G56	A48-A52 VanDerWaalsContact O-CB 3.31Å; A48-A52 WeakPolarHBondContact O-CB 3.15Å; A48-A52 PolarHBondContact O-N 3.31Å; E49-A52 PolarHBondContact O-N 2.93Å; Q50-A52 VanDerWaalsContact C-N 3.35Å; A52-G56 WeakPolarHBondContact O-CA 3.08Å; A52-G56 PolarHBondContact O-N 3.23Å
53	I	68	Low	65.4	Low	120 Å²	120	99.8 Å²	99.8	62%	0.615	53%	0.528	S	S	*	.	H	α-helix	trans	-69.1	-42.8	174.9	-67.3	164.5	0	0	0	111	E49 Q50	E49-I53 VanDerWaalsContact O-CG1 3.31Å; E49-I53 WeakPolarHBondContact O-CG1 3.29Å; E49-I53 PolarHBondContact O-N 3.33Å; Q50-I53 PolarHBondContact O-N 2.81Å
54	K	64.7	Low	63.6	Low	150 Å²	150	97.1 Å²	97.1	65%	0.652	54%	0.539	S	S	*	.	H	α-helix	trans	-74.7	-36.2	-174.3	-171	173.3	-178	178.8	0	113.2	Q50 L51	Q50-K54 WeakPolarHBondContact O-CB 3.31Å; Q50-K54 PolarHBondContact O-N 3.35Å; L51-K54 PolarHBondContact O-N 3.41Å
55	F	63.4	Low	61.9	Low	101 Å²	101	102.1 Å²	102.1	44%	0.443	56%	0.558	S	S	.	*	H	α-helix	trans	-114.1	-27.4	-174.7	-62.4	-75.3	0	0	0	113.5	L51 N57 Q58	L51-F55 HydrophobicContact CB-CD2 4.32Å; L51-F55 HydrophobicContact CD2-CD2 3.83Å; L51-F55 HydrophobicContact CD2-CE2 3.53Å; L51-F55 WeakPolarHBondContact O-CB 3.35Å; L51-F55 WeakPolarHBondContact O-CD2 3.31Å; L51-F55 PolarHBondContact O-N 2.89Å; F55-N57 PolarHBondContact O-N 2.82Å; F55-Q58 WeakPolarHBondContact O-CB 3.42Å; F55-Q58 PolarHBondContact O-N 2.99Å
56	G	56.9	Low	60.2	Low	41 Å²	41	106.3 Å²	106.3	42%	0.423	58%	0.581	S	S	.	*	T	Hydrogen-bonded Turn	trans	-69.1	-14.1	176.5	0	0	0	0	0	114.4	A52	A52-G56 WeakPolarHBondContact O-CA 3.08Å; A52-G56 PolarHBondContact O-N 3.23Å
57	N	54.3	Low	58.4	Low	122 Å²	122	115.7 Å²	115.7	65%	0.652	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.4	-3.2	169.4	-80.8	-18.2	0	0	0	113.8	F55	F55-N57 PolarHBondContact O-N 2.82Å
58	Q	51.8	Low	57.3	Low	144 Å²	144	119.9 Å²	119.9	67%	0.673	64%	0.636	S	S	*	*	S	Bend	trans	-86.4	-15.6	176.8	-66.3	-168.3	-40.6	0	0	113.5	F55	F55-Q58 WeakPolarHBondContact O-CB 3.42Å; F55-Q58 PolarHBondContact O-N 2.99Å
59	D	49.6	Very low	55.8	Low	143 Å²	143	129.7 Å²	129.7	77%	0.765	67%	0.671	S	S	*	*	S	Bend	trans	-91.3	-1.7	-179.9	-85.2	-21.5	0	0	0	114.7
60	K	46.5	Very low	55	Low	173 Å²	173	129.9 Å²	129.9	75%	0.752	68%	0.675	S	S	*	*			trans	-104.3	90.5	173.6	-69.5	-174.9	-176.9	175.4	0	109.7
61	S	47.3	Very low	54.3	Low	62 Å²	62	133.1 Å²	133.1	43%	0.434	69%	0.693	S	S	.	*			trans	-49.5	136	151.4	-173.1	0	0	0	0	107.9	D63 G64	S61-D63 PolarHBondContact O-N 3.48Å; S61-G64 PolarHBondContact O-N 3.09Å
62	P	53.1	Low	53.6	Low	128 Å²	128	135.7 Å²	135.7	83%	0.831	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.4	-22.3	178.9	-24.9	32	0	0	0	113.6
63	D	59.1	Low	52.8	Low	139 Å²	139	140.1 Å²	140.1	74%	0.743	72%	0.719	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.7	7.4	-175.3	-56.2	-31.9	0	0	0	114.1	S61 K65	S61-D63 PolarHBondContact O-N 3.48Å; D63-K65 PolarHBondContact O-N 2.98Å
64	G	48.6	Very low	51.8	Low	70 Å²	70	141.4 Å²	141.4	72%	0.722	73%	0.726	S	S	*	*			trans	62.6	13	169.4	0	0	0	0	0	116.4	S61	S61-G64 PolarHBondContact O-N 3.09Å
65	K	48.1	Very low	51	Low	175 Å²	175	140.8 Å²	140.8	76%	0.761	73%	0.731	S	S	*	*			trans	-93.9	120.8	173.4	-73.3	-172.8	174.8	-177	0	110.2	D63 R67	D63-K65 PolarHBondContact O-N 2.98Å; K65-R67 PolarHBondContact O-N 2.89Å
66	L	46.9	Very low	50.1	Low	145 Å²	145	143.6 Å²	143.6	76%	0.759	75%	0.751	S	S	*	*			trans	-58.1	133.6	161.4	-69.1	168	0	0	0	107.5	D68	L66-D68 PolarHBondContact O-N 2.98Å; L66-D68 VanDerWaalsContact O-N 3.09Å
67	R	44.9	Very low	49.5	Very low	251 Å²	251	151.5 Å²	151.5	95%	0.947	78%	0.776	S	S	*	*			trans	-79.4	92.7	178.6	-159.2	178.1	179.5	-171.8	-2.1	106.2	K65	K65-R67 PolarHBondContact O-N 2.89Å
68	D	52.5	Low	49.1	Very low	148 Å²	148	154 Å²	154	79%	0.791	79%	0.787	S	S	*	*			trans	-61.7	141	171.9	-65.7	-40.2	0	0	0	109.4	L66	L66-D68 PolarHBondContact O-N 2.98Å; L66-D68 VanDerWaalsContact O-N 3.09Å
69	E	41.5	Very low	48.9	Very low	270 Å²	270	154.9 Å²	154.9	100%	1.262	80%	0.797	S	S	*	*			trans	-51	0	178.1	-69.5	172.5	104.9	0	0	114.4

Retrieved 69 of 69 residues in 53.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).