A0A061AKX1_CAEEL Loading...

Exostosin-1 homolog

AlphaFold DB , UniProt , Accession A0A061AKX1, Species CAEEL (Caenorhabditis elegans), Gene rib-1, Length 51 aa.

						>A0A061AKX1_CAEEL|A0A061AKX1|rib-1
MSTSRRRVKELRESARNVYDAYLRSIQVISDHVLRIIFKRIDNKIELEDHQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.4	Low	82.5	Confident	244 Å²	244	137 Å²	137	100%	1.202	66%	0.657	S	S	*	*				0	125.8	0	-86.7	-167	165.4	0	0	108.9
2	S	63.2	Low	83.6	Confident	70 Å²	70	139.8 Å²	139.8	49%	0.49	66%	0.656	S	S	.	*			trans	-68.9	130.5	-178.8	156.6	0	0	0	0	111.3	S4 R5	S2-S4 PolarHBondContact O-N 3.03Å; S2-S4 PolarHBondContact OG-N 3.18Å; S2-R5 PolarHBondContact O-N 2.96Å
3	T	65.2	Low	84.7	Confident	124 Å²	124	137.4 Å²	137.4	76%	0.761	65%	0.645	S	S	*	*	H	α-helix	trans	-47.5	-28.3	175.5	33.7	0	0	0	0	113.8	R7	T3-R7 PolarHBondContact O-N 3.37Å
4	S	80.3	Confident	85.6	Confident	75 Å²	75	132.4 Å²	132.4	52%	0.524	63%	0.633	S	S	.	*	H	α-helix	trans	-64	-43.9	175.9	175.5	0	0	0	0	113.2	S2 R6 R7 V8	S2-S4 PolarHBondContact O-N 3.03Å; S2-S4 PolarHBondContact OG-N 3.18Å; S4-R6 VanDerWaalsContact C-N 3.33Å; S4-R6 PolarHBondContact O-N 2.9Å; S4-R7 PolarHBondContact O-N 2.97Å; S4-V8 WeakPolarHBondContact O-CG2 3.36Å; S4-V8 PolarHBondContact O-N 3.4Å
5	R	85.3	Confident	86.4	Confident	206 Å²	206	127.7 Å²	127.7	78%	0.777	63%	0.625	S	S	*	*	H	α-helix	trans	-66.8	-35.6	179.9	-71.5	-173.1	-172.4	175.7	2.7	112.3	S2 K9	S2-R5 PolarHBondContact O-N 2.96Å; R5-K9 PolarHBondContact O-N 3.02Å; R5-K9 VanDerWaalsContact O-N 3.14Å
6	R	89.9	Confident	87.1	Confident	181 Å²	181	129.7 Å²	129.7	68%	0.683	62%	0.623	S	S	*	*	H	α-helix	trans	-64.1	-47.3	176.2	-177.4	178	174.5	160.1	2.4	110.8	S4 V8 K9 E10	S4-R6 VanDerWaalsContact C-N 3.33Å; S4-R6 PolarHBondContact O-N 2.9Å; R6-V8 PolarHBondContact O-N 2.99Å; R6-K9 WeakPolarHBondContact O-CB 3.33Å; R6-K9 PolarHBondContact O-N 3.34Å; R6-K9 VanDerWaalsContact O-N 3.12Å; R6-E10 WeakPolarHBondContact CG-OE1 3.49Å; R6-E10 IonicContact CZ-OE1 3.86Å; R6-E10 IonicContact NE-OE1 2.96Å; R6-E10 PolarHBondContact NE-OE1 3.33Å; R6-E10 IonicContact NH2-OE1 3.89Å; R6-E10 WeakPolarHBondContact O-CG 3.38Å; R6-E10 PolarHBondContact O-N 3.43Å
7	R	91.8	Very high	87.7	Confident	180 Å²	180	127.4 Å²	127.4	68%	0.679	62%	0.615	S	S	*	*	H	α-helix	trans	-63.9	-38.1	179.3	-165.2	166.2	179.9	177.5	-1.5	112.9	T3 S4 K9 E10 L11	T3-R7 PolarHBondContact O-N 3.37Å; S4-R7 PolarHBondContact O-N 2.97Å; R7-K9 VanDerWaalsContact C-N 3.33Å; R7-K9 PolarHBondContact O-N 3.46Å; R7-E10 PolarHBondContact O-N 3.06Å; R7-L11 WeakPolarHBondContact O-CB 3.46Å; R7-L11 WeakPolarHBondContact O-CG 3.46Å; R7-L11 PolarHBondContact O-N 3.41Å
8	V	93.3	Very high	88.3	Confident	75 Å²	75	125.8 Å²	125.8	46%	0.455	61%	0.614	S	S	.	*	H	α-helix	trans	-63.4	-39.2	173.4	171.8	0	0	0	0	111.6	S4 R6 R12	S4-V8 WeakPolarHBondContact O-CG2 3.36Å; S4-V8 PolarHBondContact O-N 3.4Å; R6-V8 PolarHBondContact O-N 2.99Å; V8-R12 WeakPolarHBondContact O-CB 3.4Å; V8-R12 PolarHBondContact O-N 3.42Å
9	K	94.9	Very high	88.8	Confident	145 Å²	145	126.9 Å²	126.9	63%	0.63	61%	0.612	S	S	*	*	H	α-helix	trans	-64.2	-47	176.1	-171.1	-175.4	175.8	-172	0	111.3	R5 R6 R7 L11 R12 E13	R5-K9 PolarHBondContact O-N 3.02Å; R5-K9 VanDerWaalsContact O-N 3.14Å; R6-K9 WeakPolarHBondContact O-CB 3.33Å; R6-K9 PolarHBondContact O-N 3.34Å; R6-K9 VanDerWaalsContact O-N 3.12Å; R7-K9 VanDerWaalsContact C-N 3.33Å; R7-K9 PolarHBondContact O-N 3.46Å; K9-L11 VanDerWaalsContact C-N 3.35Å; K9-L11 PolarHBondContact O-N 3.14Å; K9-R12 PolarHBondContact O-N 3.06Å; K9-E13 WeakPolarHBondContact O-CB 3.41Å; K9-E13 PolarHBondContact O-N 3.45Å
10	E	95.8	Very high	89.2	Confident	94 Å²	94	123.4 Å²	123.4	44%	0.439	60%	0.597	S	S	.	*	H	α-helix	trans	-60.9	-42.1	178.3	-71	166.6	-176.6	0	0	111.6	R6 R7 E13 S14	R6-E10 WeakPolarHBondContact CG-OE1 3.49Å; R6-E10 IonicContact CZ-OE1 3.86Å; R6-E10 IonicContact NE-OE1 2.96Å; R6-E10 PolarHBondContact NE-OE1 3.33Å; R6-E10 IonicContact NH2-OE1 3.89Å; R6-E10 WeakPolarHBondContact O-CG 3.38Å; R6-E10 PolarHBondContact O-N 3.43Å; R7-E10 PolarHBondContact O-N 3.06Å; E10-E13 PolarHBondContact O-N 3.49Å; E10-S14 WeakPolarHBondContact O-CB 3.5Å; E10-S14 PolarHBondContact O-N 3.12Å
11	L	96.2	Very high	89.6	Confident	113 Å²	113	119.8 Å²	119.8	59%	0.592	59%	0.587	S	S	*	*	H	α-helix	trans	-63.2	-42.4	175	-74.7	170.4	0	0	0	112.5	R7 K9 E13 S14 A15	R7-L11 WeakPolarHBondContact O-CB 3.46Å; R7-L11 WeakPolarHBondContact O-CG 3.46Å; R7-L11 PolarHBondContact O-N 3.41Å; K9-L11 VanDerWaalsContact C-N 3.35Å; K9-L11 PolarHBondContact O-N 3.14Å; L11-E13 VanDerWaalsContact C-N 3.32Å; L11-E13 PolarHBondContact O-N 3.27Å; L11-S14 PolarHBondContact O-N 3.49Å; L11-A15 WeakPolarHBondContact O-CB 3.4Å; L11-A15 PolarHBondContact O-N 3.3Å
12	R	96.2	Very high	91.8	Very high	170 Å²	170	115 Å²	115	64%	0.642	56%	0.556	S	S	*	*	H	α-helix	trans	-63.6	-40.1	177.3	-176.1	178.9	-69.2	162.1	-3.1	111.7	V8 K9 A15 R16	V8-R12 WeakPolarHBondContact O-CB 3.4Å; V8-R12 PolarHBondContact O-N 3.42Å; K9-R12 PolarHBondContact O-N 3.06Å; R12-A15 PolarHBondContact O-N 2.93Å; R12-R16 WeakPolarHBondContact O-CB 3.47Å; R12-R16 PolarHBondContact O-N 3.37Å
13	E	97.3	Very high	93.5	Very high	109 Å²	109	115.4 Å²	115.4	51%	0.509	55%	0.553	S	S	.	*	H	α-helix	trans	-68.2	-43.2	178	-169.6	160.7	-166.9	0	0	111.4	K9 E10 L11 A15 R16 N17	K9-E13 WeakPolarHBondContact O-CB 3.41Å; K9-E13 PolarHBondContact O-N 3.45Å; E10-E13 PolarHBondContact O-N 3.49Å; L11-E13 VanDerWaalsContact C-N 3.32Å; L11-E13 PolarHBondContact O-N 3.27Å; E13-A15 PolarHBondContact O-N 3.48Å; E13-R16 PolarHBondContact O-N 3.46Å; E13-N17 PolarHBondContact O-N 3.45Å; E13-N17 PolarHBondContact O-ND2 2.97Å
14	S	97.5	Very high	95	Very high	68 Å²	68	116.2 Å²	116.2	48%	0.476	54%	0.542	S	S	.	.	H	α-helix	trans	-59.3	-46	172.9	-171.8	0	0	0	0	112.1	E10 L11 R16 N17 V18	E10-S14 WeakPolarHBondContact O-CB 3.5Å; E10-S14 PolarHBondContact O-N 3.12Å; L11-S14 PolarHBondContact O-N 3.49Å; S14-R16 VanDerWaalsContact C-N 3.34Å; S14-R16 PolarHBondContact O-N 2.92Å; S14-N17 PolarHBondContact O-N 3.41Å; S14-V18 WeakPolarHBondContact O-CG2 3.47Å; S14-V18 PolarHBondContact O-N 3.02Å
15	A	97.4	Very high	95.8	Very high	62 Å²	62	115 Å²	115	51%	0.512	53%	0.534	S	S	.	.	H	α-helix	trans	-62.2	-41.9	178.8	0	0	0	0	0	111.8	L11 R12 E13 V18 Y19	L11-A15 WeakPolarHBondContact O-CB 3.4Å; L11-A15 PolarHBondContact O-N 3.3Å; R12-A15 PolarHBondContact O-N 2.93Å; E13-A15 PolarHBondContact O-N 3.48Å; A15-V18 PolarHBondContact O-N 3.22Å; A15-Y19 WeakPolarHBondContact O-CB 3.47Å; A15-Y19 PolarHBondContact O-N 2.99Å
16	R	97.9	Very high	96.4	Very high	159 Å²	159	108.6 Å²	108.6	60%	0.6	51%	0.514	S	S	*	.	H	α-helix	trans	-60.2	-47.4	174.5	-176.9	-178.8	-67.6	179.9	-5.9	111.3	R12 E13 S14 V18 Y19 D20	R12-R16 WeakPolarHBondContact O-CB 3.47Å; R12-R16 PolarHBondContact O-N 3.37Å; E13-R16 PolarHBondContact O-N 3.46Å; S14-R16 VanDerWaalsContact C-N 3.34Å; S14-R16 PolarHBondContact O-N 2.92Å; R16-V18 VanDerWaalsContact C-N 3.32Å; R16-V18 PolarHBondContact O-N 3.04Å; R16-Y19 PolarHBondContact O-N 3.37Å; R16-D20 WeakPolarHBondContact O-CB 3.49Å; R16-D20 VanDerWaalsContact O-CG 3.29Å; R16-D20 PolarHBondContact O-N 2.95Å
17	N	97.9	Very high	96.7	Very high	91 Å²	91	105.7 Å²	105.7	49%	0.487	51%	0.508	S	S	.	.	H	α-helix	trans	-61.3	-40.5	-178.6	-70	-16.4	0	0	0	112.5	E13 S14 A21	E13-N17 PolarHBondContact O-N 3.45Å; E13-N17 PolarHBondContact O-ND2 2.97Å; S14-N17 PolarHBondContact O-N 3.41Å; N17-A21 VanDerWaalsContact O-CB 3.31Å; N17-A21 WeakPolarHBondContact O-CB 3.39Å; N17-A21 PolarHBondContact O-N 3.21Å
18	V	97.8	Very high	97	Very high	99 Å²	99	102 Å²	102	60%	0.6	51%	0.505	S	S	*	.	H	α-helix	trans	-64.4	-45.7	175.6	173.2	0	0	0	0	110.7	S14 A15 R16 A21 Y22	S14-V18 WeakPolarHBondContact O-CG2 3.47Å; S14-V18 PolarHBondContact O-N 3.02Å; A15-V18 PolarHBondContact O-N 3.22Å; R16-V18 VanDerWaalsContact C-N 3.32Å; R16-V18 PolarHBondContact O-N 3.04Å; V18-A21 PolarHBondContact O-N 3.36Å; V18-Y22 WeakPolarHBondContact O-CB 3.31Å; V18-Y22 PolarHBondContact O-N 3.17Å
19	Y	97.7	Very high	97.2	Very high	147 Å²	147	103.5 Å²	103.5	58%	0.576	51%	0.51	S	S	*	.	H	α-helix	trans	-64.1	-43.7	179.5	-166.7	-100.9	0	0	0	112.1	A15 R16 A21 Y22 L23	A15-Y19 WeakPolarHBondContact O-CB 3.47Å; A15-Y19 PolarHBondContact O-N 2.99Å; R16-Y19 PolarHBondContact O-N 3.37Å; Y19-A21 VanDerWaalsContact C-N 3.34Å; Y19-A21 PolarHBondContact O-N 2.98Å; Y19-Y22 WeakPolarHBondContact O-CB 3.45Å; Y19-Y22 PolarHBondContact O-N 3.04Å; Y19-L23 HydrophobicContact CD1-CD1 3.8Å; Y19-L23 HydrophobicContact CD1-CG 4.2Å; Y19-L23 HydrophobicContact CE1-CD1 3.51Å; Y19-L23 HydrophobicContact CE1-CD2 4.37Å; Y19-L23 HydrophobicContact CE1-CG 3.96Å; Y19-L23 WeakPolarHBondContact O-CG 3.39Å; Y19-L23 PolarHBondContact O-N 2.64Å
20	D	97.9	Very high	97.3	Very high	56 Å²	56	99.3 Å²	99.3	30%	0.299	50%	0.499	S	S	.	.	H	α-helix	trans	-64.2	-39.5	177.2	-70.6	-10.5	0	0	0	111.6	R16 Y22 L23 R24	R16-D20 WeakPolarHBondContact O-CB 3.49Å; R16-D20 VanDerWaalsContact O-CG 3.29Å; R16-D20 PolarHBondContact O-N 2.95Å; D20-Y22 VanDerWaalsContact C-N 3.35Å; D20-L23 PolarHBondContact O-N 3.04Å; D20-R24 WeakPolarHBondContact O-CG 3.48Å; D20-R24 PolarHBondContact O-N 3.02Å
21	A	97.5	Very high	97.4	Very high	48 Å²	48	98.6 Å²	98.6	40%	0.397	50%	0.498	S	S	.	.	H	α-helix	trans	-64.3	-41.3	174.8	0	0	0	0	0	111.7	N17 V18 Y19 R24 S25	N17-A21 VanDerWaalsContact O-CB 3.31Å; N17-A21 WeakPolarHBondContact O-CB 3.39Å; N17-A21 PolarHBondContact O-N 3.21Å; V18-A21 PolarHBondContact O-N 3.36Å; Y19-A21 VanDerWaalsContact C-N 3.34Å; Y19-A21 PolarHBondContact O-N 2.98Å; A21-R24 PolarHBondContact O-N 3.45Å; A21-S25 PolarHBondContact O-N 2.84Å
22	Y	97.7	Very high	97.4	Very high	142 Å²	142	98.8 Å²	98.8	56%	0.557	50%	0.496	S	S	*	.	H	α-helix	trans	-62.5	-47.1	176.1	-177.4	-106.7	0	0	0	111.8	V18 Y19 D20 R24 S25 I26	V18-Y22 WeakPolarHBondContact O-CB 3.31Å; V18-Y22 PolarHBondContact O-N 3.17Å; Y19-Y22 WeakPolarHBondContact O-CB 3.45Å; Y19-Y22 PolarHBondContact O-N 3.04Å; D20-Y22 VanDerWaalsContact C-N 3.35Å; Y22-R24 VanDerWaalsContact C-N 3.33Å; Y22-R24 PolarHBondContact O-N 3.37Å; Y22-S25 PolarHBondContact O-N 3.04Å; Y22-S25 VanDerWaalsContact O-N 3.09Å; Y22-S25 PolarHBondContact O-OG 3.09Å; Y22-I26 HydrophobicContact CD1-CD1 3.79Å; Y22-I26 HydrophobicContact CE1-CD1 3.31Å; Y22-I26 HydrophobicContact CE1-CG1 4.29Å; Y22-I26 HydrophobicContact CE2-CD1 4.5Å; Y22-I26 PolarHBondContact O-N 3.3Å
23	L	97.4	Very high	97.5	Very high	79 Å²	79	94 Å²	94	41%	0.414	49%	0.485	S	S	.	.	H	α-helix	trans	-58.9	-43.1	175.8	-72.8	178.3	0	0	0	112.4	Y19 D20 S25 I26 Q27	Y19-L23 HydrophobicContact CD1-CD1 3.8Å; Y19-L23 HydrophobicContact CD1-CG 4.2Å; Y19-L23 HydrophobicContact CE1-CD1 3.51Å; Y19-L23 HydrophobicContact CE1-CD2 4.37Å; Y19-L23 HydrophobicContact CE1-CG 3.96Å; Y19-L23 WeakPolarHBondContact O-CG 3.39Å; Y19-L23 PolarHBondContact O-N 2.64Å; D20-L23 PolarHBondContact O-N 3.04Å; L23-S25 VanDerWaalsContact C-N 3.3Å; L23-S25 PolarHBondContact O-N 3.46Å; L23-I26 PolarHBondContact O-N 3.45Å; L23-Q27 PolarHBondContact O-N 3.3Å
24	R	97.4	Very high	97.5	Very high	142 Å²	142	92.7 Å²	92.7	54%	0.536	48%	0.481	S	S	.	.	H	α-helix	trans	-60.5	-40.2	174.8	-76.4	-174.1	-70.6	-98.8	-0.7	112	D20 A21 Y22 Q27 V28	D20-R24 WeakPolarHBondContact O-CG 3.48Å; D20-R24 PolarHBondContact O-N 3.02Å; A21-R24 PolarHBondContact O-N 3.45Å; Y22-R24 VanDerWaalsContact C-N 3.33Å; Y22-R24 PolarHBondContact O-N 3.37Å; R24-Q27 PolarHBondContact O-N 3.45Å; R24-V28 WeakPolarHBondContact O-CG2 3.49Å; R24-V28 PolarHBondContact O-N 3.3Å
25	S	96.8	Very high	97.5	Very high	50 Å²	50	98.5 Å²	98.5	35%	0.35	49%	0.493	S	S	.	.	H	α-helix	trans	-64.3	-41.5	178.3	74.2	0	0	0	0	112.4	A21 Y22 L23 Q27 V28 I29	A21-S25 PolarHBondContact O-N 2.84Å; Y22-S25 PolarHBondContact O-N 3.04Å; Y22-S25 VanDerWaalsContact O-N 3.09Å; Y22-S25 PolarHBondContact O-OG 3.09Å; L23-S25 VanDerWaalsContact C-N 3.3Å; L23-S25 PolarHBondContact O-N 3.46Å; S25-Q27 VanDerWaalsContact C-N 3.33Å; S25-Q27 PolarHBondContact O-N 3.41Å; S25-V28 PolarHBondContact O-N 3.03Å; S25-I29 VanDerWaalsContact O-CG1 3.29Å; S25-I29 WeakPolarHBondContact O-CG1 3.42Å; S25-I29 PolarHBondContact O-N 2.93Å
26	I	97.4	Very high	97.5	Very high	70 Å²	70	98.9 Å²	98.9	36%	0.359	49%	0.485	S	S	.	.	H	α-helix	trans	-59.7	-46.4	174.5	-69.6	166.9	0	0	0	110.2	Y22 L23 V28 I29 S30	Y22-I26 HydrophobicContact CD1-CD1 3.79Å; Y22-I26 HydrophobicContact CE1-CD1 3.31Å; Y22-I26 HydrophobicContact CE1-CG1 4.29Å; Y22-I26 HydrophobicContact CE2-CD1 4.5Å; Y22-I26 PolarHBondContact O-N 3.3Å; L23-I26 PolarHBondContact O-N 3.45Å; I26-V28 PolarHBondContact O-N 3.39Å; I26-I29 PolarHBondContact O-N 3.06Å; I26-S30 WeakPolarHBondContact O-CB 3.46Å; I26-S30 PolarHBondContact O-N 3.29Å; I26-S30 PolarHBondContact O-OG 3.07Å; I26-S30 VanDerWaalsContact O-OG 3.08Å
27	Q	97.3	Very high	97.4	Very high	121 Å²	121	95 Å²	95	57%	0.565	48%	0.476	S	S	*	.	H	α-helix	trans	-60	-46.3	-179.7	-172.8	173.9	1.4	0	0	111.9	L23 R24 S25 I29 S30 D31	L23-Q27 PolarHBondContact O-N 3.3Å; R24-Q27 PolarHBondContact O-N 3.45Å; S25-Q27 VanDerWaalsContact C-N 3.33Å; S25-Q27 PolarHBondContact O-N 3.41Å; Q27-I29 PolarHBondContact O-N 2.95Å; Q27-S30 PolarHBondContact O-N 3.37Å; Q27-D31 WeakPolarHBondContact O-CB 3.3Å; Q27-D31 PolarHBondContact O-N 3.22Å
28	V	97.7	Very high	97.3	Very high	102 Å²	102	96.2 Å²	96.2	62%	0.618	48%	0.477	S	S	*	.	H	α-helix	trans	-61.9	-42.8	178.3	172	0	0	0	0	111.8	R24 S25 I26 H32	R24-V28 WeakPolarHBondContact O-CG2 3.49Å; R24-V28 PolarHBondContact O-N 3.3Å; S25-V28 PolarHBondContact O-N 3.03Å; I26-V28 PolarHBondContact O-N 3.39Å; V28-H32 WeakPolarHBondContact O-CB 3.29Å; V28-H32 PolarHBondContact O-N 3.49Å
29	I	96.8	Very high	97.3	Very high	107 Å²	107	98 Å²	98	55%	0.549	48%	0.477	S	S	.	.	H	α-helix	trans	-65.3	-47.1	178.4	-67.6	166.3	0	0	0	110.3	S25 I26 Q27 D31 H32 V33	S25-I29 VanDerWaalsContact O-CG1 3.29Å; S25-I29 WeakPolarHBondContact O-CG1 3.42Å; S25-I29 PolarHBondContact O-N 2.93Å; I26-I29 PolarHBondContact O-N 3.06Å; Q27-I29 PolarHBondContact O-N 2.95Å; I29-D31 PolarHBondContact O-N 3.39Å; I29-H32 PolarHBondContact O-N 2.9Å; I29-V33 HydrophobicContact CG2-CG2 4.43Å; I29-V33 WeakPolarHBondContact O-CG2 3.37Å; I29-V33 PolarHBondContact O-N 2.87Å
30	S	96.8	Very high	97.1	Very high	57 Å²	57	99.4 Å²	99.4	40%	0.399	48%	0.481	S	S	.	.	H	α-helix	trans	-58.2	-47.2	177.6	-68.4	0	0	0	0	111.6	I26 Q27 H32 V33 L34	I26-S30 WeakPolarHBondContact O-CB 3.46Å; I26-S30 PolarHBondContact O-N 3.29Å; I26-S30 PolarHBondContact O-OG 3.07Å; I26-S30 VanDerWaalsContact O-OG 3.08Å; Q27-S30 PolarHBondContact O-N 3.37Å; S30-H32 VanDerWaalsContact C-N 3.31Å; S30-H32 PolarHBondContact O-N 3.46Å; S30-V33 PolarHBondContact O-N 3.08Å; S30-L34 WeakPolarHBondContact O-CB 3.47Å; S30-L34 VanDerWaalsContact O-CG 3.3Å; S30-L34 WeakPolarHBondContact O-CG 3.44Å; S30-L34 PolarHBondContact O-N 3.17Å
31	D	98	Very high	97	Very high	79 Å²	79	100.5 Å²	100.5	42%	0.422	49%	0.486	S	S	.	.	H	α-helix	trans	-60.7	-41.2	177.5	-77.9	-0.6	0	0	0	111.8	Q27 I29 R35	Q27-D31 WeakPolarHBondContact O-CB 3.3Å; Q27-D31 PolarHBondContact O-N 3.22Å; I29-D31 PolarHBondContact O-N 3.39Å; D31-R35 VanDerWaalsContact O-CG 3.31Å; D31-R35 WeakPolarHBondContact O-CG 3.41Å; D31-R35 PolarHBondContact O-N 3.03Å
32	H	97.6	Very high	96.8	Very high	117 Å²	117	102.4 Å²	102.4	54%	0.542	49%	0.489	S	S	.	.	H	α-helix	trans	-63.8	-46.6	177.7	-175.9	67.4	0	0	0	112	V28 I29 S30 R35 I36	V28-H32 WeakPolarHBondContact O-CB 3.29Å; V28-H32 PolarHBondContact O-N 3.49Å; I29-H32 PolarHBondContact O-N 2.9Å; S30-H32 VanDerWaalsContact C-N 3.31Å; S30-H32 PolarHBondContact O-N 3.46Å; H32-R35 PolarHBondContact O-N 2.9Å; H32-I36 WeakPolarHBondContact NE2-CD1 3.43Å; H32-I36 WeakPolarHBondContact O-CG1 3.15Å; H32-I36 PolarHBondContact O-N 3.35Å
33	V	97.3	Very high	96.5	Very high	70 Å²	70	99.2 Å²	99.2	42%	0.424	48%	0.482	S	S	.	.	H	α-helix	trans	-63.1	-44.7	178.2	171.7	0	0	0	0	110.8	I29 S30 R35 I36 I37	I29-V33 HydrophobicContact CG2-CG2 4.43Å; I29-V33 WeakPolarHBondContact O-CG2 3.37Å; I29-V33 PolarHBondContact O-N 2.87Å; S30-V33 PolarHBondContact O-N 3.08Å; V33-R35 VanDerWaalsContact C-N 3.34Å; V33-R35 PolarHBondContact O-N 3.18Å; V33-I36 PolarHBondContact O-N 3.1Å; V33-I36 VanDerWaalsContact O-N 3.16Å; V33-I37 HydrophobicContact CG1-CD1 3.84Å; V33-I37 HydrophobicContact CG1-CG1 4.46Å; V33-I37 WeakPolarHBondContact O-CG1 3.44Å; V33-I37 PolarHBondContact O-N 3.05Å
34	L	97.7	Very high	96.1	Very high	81 Å²	81	102.4 Å²	102.4	42%	0.424	49%	0.492	S	S	.	.	H	α-helix	trans	-60.6	-42.6	178.2	-74	174.6	0	0	0	111.8	S30 I36 I37 F38	S30-L34 WeakPolarHBondContact O-CB 3.47Å; S30-L34 VanDerWaalsContact O-CG 3.3Å; S30-L34 WeakPolarHBondContact O-CG 3.44Å; S30-L34 PolarHBondContact O-N 3.17Å; L34-I36 VanDerWaalsContact C-N 3.31Å; L34-I36 PolarHBondContact O-N 3.08Å; L34-I37 PolarHBondContact O-N 3.22Å; L34-F38 HydrophobicContact CB-CD2 4.42Å; L34-F38 HydrophobicContact CB-CE2 4.12Å; L34-F38 WeakPolarHBondContact O-CD2 3.31Å; L34-F38 WeakPolarHBondContact O-CG 3.38Å; L34-F38 PolarHBondContact O-N 3.45Å
35	R	97.3	Very high	95.6	Very high	190 Å²	190	99.5 Å²	99.5	72%	0.717	49%	0.487	S	S	*	.	H	α-helix	trans	-59.4	-40.6	175.1	-75.8	176.3	-179.9	-150.1	1	112.7	D31 H32 V33 K39	D31-R35 VanDerWaalsContact O-CG 3.31Å; D31-R35 WeakPolarHBondContact O-CG 3.41Å; D31-R35 PolarHBondContact O-N 3.03Å; H32-R35 PolarHBondContact O-N 2.9Å; V33-R35 VanDerWaalsContact C-N 3.34Å; V33-R35 PolarHBondContact O-N 3.18Å; R35-K39 WeakPolarHBondContact O-CB 3.45Å; R35-K39 PolarHBondContact O-N 2.88Å
36	I	97.3	Very high	94.9	Very high	69 Å²	69	102.5 Å²	102.5	35%	0.354	50%	0.495	S	S	.	.	H	α-helix	trans	-64.5	-44.1	176.5	-68	166.5	0	0	0	110.5	H32 V33 L34 R40	H32-I36 WeakPolarHBondContact NE2-CD1 3.43Å; H32-I36 WeakPolarHBondContact O-CG1 3.15Å; H32-I36 PolarHBondContact O-N 3.35Å; V33-I36 PolarHBondContact O-N 3.1Å; V33-I36 VanDerWaalsContact O-N 3.16Å; L34-I36 VanDerWaalsContact C-N 3.31Å; L34-I36 PolarHBondContact O-N 3.08Å; I36-R40 WeakPolarHBondContact O-CG 3.37Å; I36-R40 PolarHBondContact O-N 3.38Å; I36-R40 VanDerWaalsContact O-N 3.08Å
37	I	96.6	Very high	94.1	Very high	78 Å²	78	105 Å²	105	40%	0.4	51%	0.508	S	S	.	.	H	α-helix	trans	-62.6	-49.3	179.6	-68.4	169.6	0	0	0	110.3	V33 L34 K39 R40 I41	V33-I37 HydrophobicContact CG1-CD1 3.84Å; V33-I37 HydrophobicContact CG1-CG1 4.46Å; V33-I37 WeakPolarHBondContact O-CG1 3.44Å; V33-I37 PolarHBondContact O-N 3.05Å; L34-I37 PolarHBondContact O-N 3.22Å; I37-K39 PolarHBondContact O-N 3.16Å; I37-R40 WeakPolarHBondContact O-CB 3.4Å; I37-R40 PolarHBondContact O-N 3.42Å; I37-R40 VanDerWaalsContact O-N 3.1Å; I37-I41 HydrophobicContact CG2-CD1 3.85Å; I37-I41 HydrophobicContact CG2-CG1 4.5Å; I37-I41 WeakPolarHBondContact O-CG1 3.43Å; I37-I41 PolarHBondContact O-N 2.99Å
38	F	96.6	Very high	93.2	Very high	116 Å²	116	105.7 Å²	105.7	51%	0.509	51%	0.512	S	S	.	.	H	α-helix	trans	-59.4	-47.1	179	-69.6	-47.4	0	0	0	111.8	L34 R40 I41 D42	L34-F38 HydrophobicContact CB-CD2 4.42Å; L34-F38 HydrophobicContact CB-CE2 4.12Å; L34-F38 WeakPolarHBondContact O-CD2 3.31Å; L34-F38 WeakPolarHBondContact O-CG 3.38Å; L34-F38 PolarHBondContact O-N 3.45Å; F38-R40 PolarHBondContact O-N 3.18Å; F38-I41 WeakPolarHBondContact O-CA 3.28Å; F38-I41 WeakPolarHBondContact O-CB 3.46Å; F38-I41 PolarHBondContact O-N 3.27Å; F38-D42 VanDerWaalsContact O-CG 3.29Å; F38-D42 PolarHBondContact O-N 3Å
39	K	96	Very high	92	Very high	138 Å²	138	107 Å²	107	60%	0.6	52%	0.515	S	S	*	.	H	α-helix	trans	-57.3	-36.9	176	-172.5	174.9	-176.2	177.6	0	112.8	R35 I37 N43	R35-K39 WeakPolarHBondContact O-CB 3.45Å; R35-K39 PolarHBondContact O-N 2.88Å; I37-K39 PolarHBondContact O-N 3.16Å; K39-N43 WeakPolarHBondContact O-CB 3.45Å; K39-N43 PolarHBondContact O-N 3.07Å; K39-N43 VanDerWaalsContact O-N 3.07Å; K39-N43 PolarHBondContact O-OD1 2.87Å
40	R	94.4	Very high	90.6	Very high	176 Å²	176	109.7 Å²	109.7	66%	0.664	53%	0.525	S	S	*	.	H	α-helix	trans	-70.2	-34	176.6	-74.9	178.2	177.2	-172.7	0.3	112.7	I36 I37 F38 K44	I36-R40 WeakPolarHBondContact O-CG 3.37Å; I36-R40 PolarHBondContact O-N 3.38Å; I36-R40 VanDerWaalsContact O-N 3.08Å; I37-R40 WeakPolarHBondContact O-CB 3.4Å; I37-R40 PolarHBondContact O-N 3.42Å; I37-R40 VanDerWaalsContact O-N 3.1Å; F38-R40 PolarHBondContact O-N 3.18Å; R40-K44 WeakPolarHBondContact O-CG 3.45Å; R40-K44 PolarHBondContact O-N 3.02Å
41	I	94.8	Very high	88.7	Confident	79 Å²	79	117.9 Å²	117.9	41%	0.405	56%	0.557	S	S	.	*	H	α-helix	trans	-68.8	-50.6	175.4	-68.1	167.5	0	0	0	109.3	I37 F38 N43 K44 I45	I37-I41 HydrophobicContact CG2-CD1 3.85Å; I37-I41 HydrophobicContact CG2-CG1 4.5Å; I37-I41 WeakPolarHBondContact O-CG1 3.43Å; I37-I41 PolarHBondContact O-N 2.99Å; F38-I41 WeakPolarHBondContact O-CA 3.28Å; F38-I41 WeakPolarHBondContact O-CB 3.46Å; F38-I41 PolarHBondContact O-N 3.27Å; I41-N43 VanDerWaalsContact C-N 3.35Å; I41-N43 PolarHBondContact O-N 3.15Å; I41-K44 WeakPolarHBondContact O-CB 3.37Å; I41-K44 PolarHBondContact O-N 3Å; I41-I45 HydrophobicContact CG2-CD1 3.78Å; I41-I45 HydrophobicContact CG2-CG1 4.45Å; I41-I45 WeakPolarHBondContact O-CG1 3.45Å; I41-I45 PolarHBondContact O-N 3.22Å
42	D	93.9	Very high	88.2	Confident	87 Å²	87	119.8 Å²	119.8	47%	0.465	56%	0.564	S	S	.	*	H	α-helix	trans	-56.1	-49.3	179.8	-61.6	-21.6	0	0	0	110.9	F38 K44 I45 E46	F38-D42 VanDerWaalsContact O-CG 3.29Å; F38-D42 PolarHBondContact O-N 3Å; D42-K44 PolarHBondContact O-N 2.97Å; D42-I45 PolarHBondContact O-N 3.29Å; D42-I45 VanDerWaalsContact O-N 3.15Å; D42-E46 WeakPolarHBondContact O-CG 3.44Å; D42-E46 PolarHBondContact O-N 3.38Å
43	N	90.9	Very high	87.7	Confident	75 Å²	75	119.9 Å²	119.9	40%	0.401	57%	0.565	S	S	.	*	H	α-helix	trans	-59.6	-32.6	177	-74	8.2	0	0	0	113.5	K39 I41 L47	K39-N43 WeakPolarHBondContact O-CB 3.45Å; K39-N43 PolarHBondContact O-N 3.07Å; K39-N43 VanDerWaalsContact O-N 3.07Å; K39-N43 PolarHBondContact O-OD1 2.87Å; I41-N43 VanDerWaalsContact C-N 3.35Å; I41-N43 PolarHBondContact O-N 3.15Å; N43-L47 WeakPolarHBondContact O-CD1 3.48Å; N43-L47 VanDerWaalsContact O-CG 3.28Å; N43-L47 WeakPolarHBondContact O-CG 3.47Å; N43-L47 PolarHBondContact O-N 2.95Å
44	K	89.7	Confident	87.2	Confident	146 Å²	146	122.7 Å²	122.7	64%	0.635	57%	0.573	S	S	*	*	H	α-helix	trans	-72.4	-42.2	177.5	-85.5	-169.1	171.2	-160.9	0	111.2	R40 I41 D42 L47 E48	R40-K44 WeakPolarHBondContact O-CG 3.45Å; R40-K44 PolarHBondContact O-N 3.02Å; I41-K44 WeakPolarHBondContact O-CB 3.37Å; I41-K44 PolarHBondContact O-N 3Å; D42-K44 PolarHBondContact O-N 2.97Å; K44-L47 PolarHBondContact O-N 3.11Å; K44-E48 PolarHBondContact O-N 3.28Å; K44-E48 VanDerWaalsContact O-N 3.11Å
45	I	87.9	Confident	86.6	Confident	82 Å²	82	125.2 Å²	125.2	42%	0.421	58%	0.582	S	S	.	*	H	α-helix	trans	-61.8	-46.6	177.1	-65.4	169.3	0	0	0	109.7	I41 D42 L47 E48 D49	I41-I45 HydrophobicContact CG2-CD1 3.78Å; I41-I45 HydrophobicContact CG2-CG1 4.45Å; I41-I45 WeakPolarHBondContact O-CG1 3.45Å; I41-I45 PolarHBondContact O-N 3.22Å; D42-I45 PolarHBondContact O-N 3.29Å; D42-I45 VanDerWaalsContact O-N 3.15Å; I45-L47 VanDerWaalsContact C-N 3.28Å; I45-L47 PolarHBondContact O-N 3.28Å; I45-E48 PolarHBondContact O-N 3.41Å; I45-E48 VanDerWaalsContact O-N 3.1Å; I45-D49 PolarHBondContact O-N 2.94Å
46	E	82.1	Confident	85.9	Confident	112 Å²	112	121.1 Å²	121.1	52%	0.523	57%	0.573	S	S	.	*	H	α-helix	trans	-58	-38.3	176.6	-71.7	178.5	173.9	0	0	112.7	D42 H50	D42-E46 WeakPolarHBondContact O-CG 3.44Å; D42-E46 PolarHBondContact O-N 3.38Å; E46-H50 PolarHBondContact O-CD2 3.36Å; E46-H50 PolarHBondContact O-N 3.1Å
47	L	80.7	Confident	85.2	Confident	122 Å²	122	124.6 Å²	124.6	64%	0.639	59%	0.588	S	S	*	*	H	α-helix	trans	-69.8	-33.8	177.2	-74.8	168	0	0	0	113.1	N43 K44 I45	N43-L47 WeakPolarHBondContact O-CD1 3.48Å; N43-L47 VanDerWaalsContact O-CG 3.28Å; N43-L47 WeakPolarHBondContact O-CG 3.47Å; N43-L47 PolarHBondContact O-N 2.95Å; K44-L47 PolarHBondContact O-N 3.11Å; I45-L47 VanDerWaalsContact C-N 3.28Å; I45-L47 PolarHBondContact O-N 3.28Å
48	E	78.4	Confident	84.3	Confident	137 Å²	137	127.9 Å²	127.9	64%	0.64	60%	0.601	S	S	*	*	H	α-helix	trans	-73.3	-35.2	176.8	-72.4	176.5	-177.4	0	0	111.7	K44 I45 H50	K44-E48 PolarHBondContact O-N 3.28Å; K44-E48 VanDerWaalsContact O-N 3.11Å; I45-E48 PolarHBondContact O-N 3.41Å; I45-E48 VanDerWaalsContact O-N 3.1Å; E48-H50 PolarHBondContact O-N 3Å
49	D	71.9	Confident	83.4	Confident	129 Å²	129	128.8 Å²	128.8	69%	0.69	61%	0.608	S	S	*	*	H	α-helix	trans	-71.4	-16.4	176.7	-76	-17.3	0	0	0	113.7	I45	I45-D49 PolarHBondContact O-N 2.94Å
50	H	66.1	Low	82.3	Confident	164 Å²	164	128.1 Å²	128.1	76%	0.759	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.2	4.1	-179.1	-70.7	-42.5	0	0	0	114.6	E46 E48	E46-H50 PolarHBondContact O-CD2 3.36Å; E46-H50 PolarHBondContact O-N 3.1Å; E48-H50 PolarHBondContact O-N 3Å
51	Q	57.4	Low	81.2	Confident	228 Å²	228	123.7 Å²	123.7	100%	1.065	60%	0.604	S	S	*	*			trans	-103	0	174.5	-77	-171.8	-26.2	0	0	112.1

Retrieved 51 of 51 residues in 80.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).