A0A061AL65_CAEEL Loading...

Choline/carnitine acyltransferase domain-containing protein

AlphaFold DB , UniProt , Accession A0A061AL65, Species CAEEL (Caenorhabditis elegans), Gene cpt-2, Length 109 aa.

						>A0A061AL65_CAEEL|A0A061AL65|cpt-2
MGQGYDRHLLGLKITAQRLSQPTPDFFQDPGYTRMGHFVLSTSTLSTDTIVFGGFGPVVQDGFGIGYNVVPNKLGAVISSNKSKRDAAAFSNALYKSLDILRGHLLDPK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	91.4	Very high	97	Very high	211 Å²	211	106.7 Å²	106.7	100%	1.039	57%	0.57	S	S	*	*				0	-7.5	0	-63.5	-51.8	-75.7	0	0	115.3	Q3	M1-Q3 HydrophobicContact CB-CG 4.3Å; M1-Q3 WeakPolarHBondContact O-CG 3.43Å; M1-Q3 PolarHBondContact O-N 2.9Å; M1-Q3 VanDerWaalsContact O-N 3.1Å; M1-Q3 PolarHBondContact O-NE2 3.12Å
2	G	96.2	Very high	97.1	Very high	80 Å²	80	105 Å²	105	83%	0.825	56%	0.56	S	S	*	*			trans	67.6	12.4	168.8	0	0	0	0	0	116.7	G4	G2-G4 PolarHBondContact O-N 3.13Å
3	Q	98.1	Very high	97.1	Very high	177 Å²	177	101.5 Å²	101.5	83%	0.827	54%	0.537	S	S	*	.			trans	-86.1	15.5	-176.4	-57.7	-58.8	-50.5	0	0	113.7	M1	M1-Q3 HydrophobicContact CB-CG 4.3Å; M1-Q3 WeakPolarHBondContact O-CG 3.43Å; M1-Q3 PolarHBondContact O-N 2.9Å; M1-Q3 VanDerWaalsContact O-N 3.1Å; M1-Q3 PolarHBondContact O-NE2 3.12Å
4	G	97.3	Very high	97.1	Very high	50 Å²	50	98.3 Å²	98.3	52%	0.515	52%	0.519	S	S	.	.			trans	-77.4	153.9	175.1	0	0	0	0	0	111.3	G2	G2-G4 PolarHBondContact O-N 3.13Å
5	Y	97.3	Very high	97.2	Very high	131 Å²	131	96.6 Å²	96.6	51%	0.514	51%	0.514	S	S	.	.	H	α-helix	trans	-88.5	-30.1	-174	60	-100.7	0	0	0	113.6	R7 H8 L9 M35	Y5-R7 VanDerWaalsContact C-N 3.34Å; Y5-R7 PolarHBondContact O-N 3.27Å; Y5-H8 WeakPolarHBondContact O-CB 3.4Å; Y5-H8 PolarHBondContact O-N 2.93Å; Y5-L9 HydrophobicContact CD2-CD1 3.95Å; Y5-L9 WeakPolarHBondContact O-CG 3.45Å; Y5-L9 PolarHBondContact O-N 2.9Å; Y5-M35 HydrophobicContact CD2-SD 4.2Å; Y5-M35 HydrophobicContact CE2-CE 4.2Å; Y5-M35 HydrophobicContact CE2-CG 4.35Å; Y5-M35 HydrophobicContact CE2-SD 3.41Å; Y5-M35 WeakPolarHBondContact CE2-SD 3.48Å
6	D	97.6	Very high	97.2	Very high	70 Å²	70	91.1 Å²	91.1	37%	0.374	49%	0.486	S	S	.	.	H	α-helix	trans	-55.8	-46.4	-171	-62.1	-103.7	0	0	0	112.9	L10	D6-L10 VanDerWaalsContact O-CB 3.26Å; D6-L10 WeakPolarHBondContact O-CB 3.49Å; D6-L10 PolarHBondContact O-N 3.32Å
7	R	98	Very high	97.2	Very high	202 Å²	202	91.9 Å²	91.9	76%	0.762	49%	0.487	S	S	*	.	H	α-helix	trans	-72.4	-33.6	180	-61.2	-57.4	-178.7	-171.1	-2.2	112.3	Y5 G11	Y5-R7 VanDerWaalsContact C-N 3.34Å; Y5-R7 PolarHBondContact O-N 3.27Å; R7-G11 PolarHBondContact O-N 2.86Å
8	H	98.1	Very high	97.2	Very high	125 Å²	125	98.2 Å²	98.2	58%	0.579	50%	0.503	S	S	*	.	H	α-helix	trans	-65.8	-50.2	175.3	-175.3	-171.9	0	0	0	110.5	Y5 L10 G11 L12	Y5-H8 WeakPolarHBondContact O-CB 3.4Å; Y5-H8 PolarHBondContact O-N 2.93Å; H8-L10 PolarHBondContact O-N 3.42Å; H8-G11 WeakPolarHBondContact O-CA 3.23Å; H8-G11 PolarHBondContact O-N 3.05Å; H8-G11 VanDerWaalsContact O-N 3.1Å; H8-L12 WeakPolarHBondContact O-CG 3.49Å; H8-L12 PolarHBondContact O-N 3.37Å
9	L	98.1	Very high	97.3	Very high	32 Å²	32	98.8 Å²	98.8	17%	0.168	51%	0.506	C	S	.	.	H	α-helix	trans	-60.7	-43.4	177	-67.2	-178.9	0	0	0	112	Y5 G11 L12 K13 F26 F27 Y32 M35	Y5-L9 HydrophobicContact CD2-CD1 3.95Å; Y5-L9 WeakPolarHBondContact O-CG 3.45Å; Y5-L9 PolarHBondContact O-N 2.9Å; L9-G11 VanDerWaalsContact C-N 3.31Å; L9-G11 PolarHBondContact O-N 3.26Å; L9-L12 PolarHBondContact O-N 3.43Å; L9-K13 PolarHBondContact O-N 3.02Å; L9-F26 HydrophobicContact CD1-CE1 4.16Å; L9-F26 HydrophobicContact CD1-CZ 4.27Å; L9-F26 HydrophobicContact CD2-CE1 3.91Å; L9-F26 HydrophobicContact CD2-CZ 4.33Å; L9-F27 HydrophobicContact CB-CE1 4.28Å; L9-F27 WeakPolarHBondContact O-CE1 3.4Å; L9-F27 WeakPolarHBondContact O-CZ 3.41Å; L9-Y32 HydrophobicContact CB-CE2 4.32Å; L9-Y32 HydrophobicContact CD1-CE2 4.29Å; L9-M35 HydrophobicContact CD1-CE 3.79Å
10	L	97.4	Very high	97.3	Very high	64 Å²	64	99.6 Å²	99.6	34%	0.335	52%	0.521	S	S	.	.	H	α-helix	trans	-58.8	-43.1	173.3	179.1	63	0	0	0	111.6	D6 H8 K13 I14	D6-L10 VanDerWaalsContact O-CB 3.26Å; D6-L10 WeakPolarHBondContact O-CB 3.49Å; D6-L10 PolarHBondContact O-N 3.32Å; H8-L10 PolarHBondContact O-N 3.42Å; L10-K13 PolarHBondContact O-N 2.97Å; L10-I14 HydrophobicContact CD1-CD1 3.8Å; L10-I14 HydrophobicContact CD1-CG1 4.15Å; L10-I14 HydrophobicContact CD2-CD1 4.46Å; L10-I14 HydrophobicContact CG-CD1 3.78Å; L10-I14 HydrophobicContact CG-CG1 4.47Å; L10-I14 WeakPolarHBondContact O-CB 3.45Å; L10-I14 VanDerWaalsContact O-CG1 3.31Å; L10-I14 WeakPolarHBondContact O-CG1 3.41Å; L10-I14 PolarHBondContact O-N 3.26Å
11	G	97.9	Very high	97.3	Very high	32 Å²	32	100.3 Å²	100.3	33%	0.33	52%	0.522	S	S	.	.	H	α-helix	trans	-61.6	-42.3	177.5	0	0	0	0	0	113	R7 H8 L9 T15	R7-G11 PolarHBondContact O-N 2.86Å; H8-G11 WeakPolarHBondContact O-CA 3.23Å; H8-G11 PolarHBondContact O-N 3.05Å; H8-G11 VanDerWaalsContact O-N 3.1Å; L9-G11 VanDerWaalsContact C-N 3.31Å; L9-G11 PolarHBondContact O-N 3.26Å; G11-T15 VanDerWaalsContact O-CB 3.31Å; G11-T15 WeakPolarHBondContact O-CB 3.32Å; G11-T15 PolarHBondContact O-N 3.01Å; G11-T15 PolarHBondContact O-OG1 3.35Å
12	L	97.8	Very high	97.5	Very high	86 Å²	86	96 Å²	96	45%	0.45	51%	0.51	S	S	.	.	H	α-helix	trans	-63.9	-45.6	175.4	-68	174.3	0	0	0	111.6	H8 L9 T15 A16 F27	H8-L12 WeakPolarHBondContact O-CG 3.49Å; H8-L12 PolarHBondContact O-N 3.37Å; L9-L12 PolarHBondContact O-N 3.43Å; L12-T15 PolarHBondContact O-N 3.44Å; L12-A16 PolarHBondContact O-N 3.1Å; L12-F27 HydrophobicContact CB-CZ 4.07Å
13	K	97.3	Very high	97.4	Very high	59 Å²	59	94.3 Å²	94.3	26%	0.257	48%	0.484	S	S	.	.	H	α-helix	trans	-60.1	-48.7	177.2	-174.7	172.8	-178.8	170.4	0	112	L9 L10 T15 A16 Q17 T23 F27	L9-K13 PolarHBondContact O-N 3.02Å; L10-K13 PolarHBondContact O-N 2.97Å; K13-T15 VanDerWaalsContact C-N 3.3Å; K13-T15 PolarHBondContact O-N 3.36Å; K13-A16 PolarHBondContact O-N 3.38Å; K13-Q17 VanDerWaalsContact O-CG 3.32Å; K13-Q17 WeakPolarHBondContact O-CG 3.44Å; K13-Q17 PolarHBondContact O-N 3.41Å; K13-Q17 VanDerWaalsContact O-N 3.16Å; K13-T23 HydrophobicContact CG-CG2 4.29Å; K13-F27 HydrophobicContact CB-CD1 4.12Å; K13-F27 HydrophobicContact CB-CD2 4.33Å; K13-F27 HydrophobicContact CB-CE1 3.83Å; K13-F27 HydrophobicContact CB-CE2 4.05Å; K13-F27 HydrophobicContact CB-CG 4.35Å; K13-F27 HydrophobicContact CB-CZ 3.79Å; K13-F27 HydrophobicContact CD-CB 4.35Å; K13-F27 HydrophobicContact CD-CD1 4.04Å; K13-F27 HydrophobicContact CD-CG 4.15Å; K13-F27 HydrophobicContact CG-CD1 4.38Å; K13-F27 HydrophobicContact CG-CD2 4.42Å; K13-F27 HydrophobicContact CG-CG 4.29Å
14	I	97.8	Very high	97.3	Very high	57 Å²	57	89 Å²	89	29%	0.292	46%	0.464	S	S	.	.	H	α-helix	trans	-63.3	-38	178	-68.9	171.1	0	0	0	110.8	L10 Q17 R18	L10-I14 HydrophobicContact CD1-CD1 3.8Å; L10-I14 HydrophobicContact CD1-CG1 4.15Å; L10-I14 HydrophobicContact CD2-CD1 4.46Å; L10-I14 HydrophobicContact CG-CD1 3.78Å; L10-I14 HydrophobicContact CG-CG1 4.47Å; L10-I14 WeakPolarHBondContact O-CB 3.45Å; L10-I14 VanDerWaalsContact O-CG1 3.31Å; L10-I14 WeakPolarHBondContact O-CG1 3.41Å; L10-I14 PolarHBondContact O-N 3.26Å; I14-Q17 PolarHBondContact O-N 3.44Å; I14-R18 HydrophobicContact CG2-CG 4.21Å; I14-R18 WeakPolarHBondContact O-CB 3.48Å; I14-R18 VanDerWaalsContact O-CG 3.31Å; I14-R18 WeakPolarHBondContact O-CG 3.49Å; I14-R18 PolarHBondContact O-N 3.32Å
15	T	98.2	Very high	97.3	Very high	73 Å²	73	92.7 Å²	92.7	45%	0.448	47%	0.472	S	S	.	.	H	α-helix	trans	-63.2	-48.1	177.9	-61.8	0	0	0	0	111.6	G11 L12 K13 Q17 R18 L19	G11-T15 VanDerWaalsContact O-CB 3.31Å; G11-T15 WeakPolarHBondContact O-CB 3.32Å; G11-T15 PolarHBondContact O-N 3.01Å; G11-T15 PolarHBondContact O-OG1 3.35Å; L12-T15 PolarHBondContact O-N 3.44Å; K13-T15 VanDerWaalsContact C-N 3.3Å; K13-T15 PolarHBondContact O-N 3.36Å; T15-Q17 VanDerWaalsContact C-N 3.29Å; T15-Q17 PolarHBondContact O-N 3.1Å; T15-R18 PolarHBondContact O-N 2.72Å; T15-R18 VanDerWaalsContact O-N 3.17Å; T15-L19 HydrophobicContact CG2-CD1 3.84Å; T15-L19 HydrophobicContact CG2-CG 4.36Å; T15-L19 WeakPolarHBondContact O-CG 3.31Å; T15-L19 PolarHBondContact O-N 3.16Å
16	A	97.6	Very high	97.3	Very high	8 Å²	8	91.8 Å²	91.8	7%	0.066	47%	0.471	C	S	.	.	H	α-helix	trans	-56.9	-44.4	176.2	0	0	0	0	0	111.5	L12 K13 L19 S20 Q21	L12-A16 PolarHBondContact O-N 3.1Å; K13-A16 PolarHBondContact O-N 3.38Å; A16-L19 PolarHBondContact O-N 3.25Å; A16-S20 PolarHBondContact O-N 3.38Å; A16-Q21 PolarHBondContact O-N 2.9Å
17	Q	96.6	Very high	97.2	Very high	105 Å²	105	89.1 Å²	89.1	49%	0.491	46%	0.456	S	S	.	.	H	α-helix	trans	-61.6	-44.1	176.4	-69	172.4	-21.7	0	0	112.6	K13 I14 T15 L19 S20	K13-Q17 VanDerWaalsContact O-CG 3.32Å; K13-Q17 WeakPolarHBondContact O-CG 3.44Å; K13-Q17 PolarHBondContact O-N 3.41Å; K13-Q17 VanDerWaalsContact O-N 3.16Å; I14-Q17 PolarHBondContact O-N 3.44Å; T15-Q17 VanDerWaalsContact C-N 3.29Å; T15-Q17 PolarHBondContact O-N 3.1Å; Q17-L19 VanDerWaalsContact C-N 3.33Å; Q17-L19 PolarHBondContact O-N 2.92Å; Q17-S20 PolarHBondContact O-N 3.17Å
18	R	97.9	Very high	97.1	Very high	206 Å²	206	86.3 Å²	86.3	78%	0.777	45%	0.452	S	S	*	.	H	α-helix	trans	-67.6	-32	179.9	-77	178.6	176.6	-173.2	-1.1	113.3	I14 T15	I14-R18 HydrophobicContact CG2-CG 4.21Å; I14-R18 WeakPolarHBondContact O-CB 3.48Å; I14-R18 VanDerWaalsContact O-CG 3.31Å; I14-R18 WeakPolarHBondContact O-CG 3.49Å; I14-R18 PolarHBondContact O-N 3.32Å; T15-R18 PolarHBondContact O-N 2.72Å; T15-R18 VanDerWaalsContact O-N 3.17Å
19	L	97.9	Very high	97.1	Very high	109 Å²	109	84.1 Å²	84.1	57%	0.571	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.5	5	176.5	-63.5	177.7	0	0	0	112.7	T15 A16 Q17 Q21	T15-L19 HydrophobicContact CG2-CD1 3.84Å; T15-L19 HydrophobicContact CG2-CG 4.36Å; T15-L19 WeakPolarHBondContact O-CG 3.31Å; T15-L19 PolarHBondContact O-N 3.16Å; A16-L19 PolarHBondContact O-N 3.25Å; Q17-L19 VanDerWaalsContact C-N 3.33Å; Q17-L19 PolarHBondContact O-N 2.92Å; L19-Q21 HydrophobicContact CB-CG 3.99Å; L19-Q21 PolarHBondContact O-N 2.97Å; L19-Q21 VanDerWaalsContact O-N 3.13Å
20	S	97.1	Very high	97	Very high	115 Å²	115	87.5 Å²	87.5	80%	0.804	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.3	29.7	-173.9	-58.1	0	0	0	0	113.1	A16 Q17	A16-S20 PolarHBondContact O-N 3.38Å; Q17-S20 PolarHBondContact O-N 3.17Å
21	Q	96.9	Very high	97	Very high	114 Å²	114	86.3 Å²	86.3	53%	0.533	47%	0.471	S	S	.	.	P	Polyproline II helix	trans	-87	152.2	175.3	-70.7	-176.8	-31	0	0	110.1	A16 L19 T23	A16-Q21 PolarHBondContact O-N 2.9Å; L19-Q21 HydrophobicContact CB-CG 3.99Å; L19-Q21 PolarHBondContact O-N 2.97Å; L19-Q21 VanDerWaalsContact O-N 3.13Å; Q21-T23 PolarHBondContact O-N 3.19Å
22	P	96.4	Very high	97	Very high	121 Å²	121	86.8 Å²	86.8	79%	0.786	46%	0.463	S	S	*	.	P	Polyproline II helix	trans	-52.9	129.8	169.6	-24.4	34.2	0	0	0	110.3	P24	P22-P24 WeakPolarHBondContact O-CD 3.44Å
23	T	95.1	Very high	96.9	Very high	45 Å²	45	87 Å²	87	28%	0.276	47%	0.469	S	S	.	.	P	Polyproline II helix	trans	-67.1	126.8	172.8	-63.1	0	0	0	0	108	K13 Q21 F27	K13-T23 HydrophobicContact CG-CG2 4.29Å; Q21-T23 PolarHBondContact O-N 3.19Å; T23-F27 HydrophobicContact CG2-CB 3.81Å; T23-F27 HydrophobicContact CG2-CD2 3.64Å; T23-F27 HydrophobicContact CG2-CG 4.07Å
24	P	96	Very high	96.9	Very high	65 Å²	65	94.1 Å²	94.1	42%	0.422	49%	0.494	S	S	.	.	P	Polyproline II helix	trans	-54.4	141.7	-179.6	-28.5	34.1	0	0	0	113	P22 F26 F27	P22-P24 WeakPolarHBondContact O-CD 3.44Å; P24-F26 PolarHBondContact O-N 2.72Å; P24-F27 HydrophobicContact CB-CD2 4.02Å; P24-F27 HydrophobicContact CB-CE2 4.19Å; P24-F27 HydrophobicContact CG-CD2 4.16Å; P24-F27 HydrophobicContact CG-CE2 3.99Å; P24-F27 PolarHBondContact O-N 3.45Å
25	D	96.9	Very high	96.8	Very high	127 Å²	127	94.3 Å²	94.3	68%	0.679	49%	0.494	S	S	*	.	G	3₁₀ helix	trans	-57.4	-26	-178.6	-66.9	-25.6	0	0	0	113.2	F27 Q28 D29	D25-F27 PolarHBondContact O-N 3.06Å; D25-F27 VanDerWaalsContact O-N 3.12Å; D25-Q28 WeakPolarHBondContact O-CA 3.31Å; D25-Q28 WeakPolarHBondContact O-CB 3.13Å; D25-Q28 PolarHBondContact O-N 3.48Å; D25-D29 PolarHBondContact O-N 3.2Å
26	F	96.5	Very high	96.6	Very high	112 Å²	112	93.1 Å²	93.1	49%	0.491	50%	0.497	S	S	.	.	G	3₁₀ helix	trans	-47.1	-39	169.9	174.8	-95.1	0	0	0	113.2	L9 P24 Q28 D29 Y32	L9-F26 HydrophobicContact CD1-CE1 4.16Å; L9-F26 HydrophobicContact CD1-CZ 4.27Å; L9-F26 HydrophobicContact CD2-CE1 3.91Å; L9-F26 HydrophobicContact CD2-CZ 4.33Å; P24-F26 PolarHBondContact O-N 2.72Å; F26-Q28 VanDerWaalsContact C-N 3.28Å; F26-Q28 PolarHBondContact O-N 3.2Å; F26-D29 VanDerWaalsContact O-CB 3.23Å; F26-D29 WeakPolarHBondContact O-CB 3.47Å; F26-D29 PolarHBondContact O-N 3.41Å; F26-Y32 HydrophobicContact CD1-CD2 4.45Å; F26-Y32 AromaticContact CE1-CD2 3.76Å; F26-Y32 HydrophobicContact CE1-CD2 3.76Å; F26-Y32 HydrophobicContact CE1-CE2 4.31Å; F26-Y32 HydrophobicContact CZ-CD2 4.34Å
27	F	96.5	Very high	96.7	Very high	14 Å²	14	96.6 Å²	96.6	6%	0.061	51%	0.511	C	S	.	.	G	3₁₀ helix	trans	-79.9	-8.1	-178.8	-63.2	-67.9	0	0	0	114.1	L9 L12 K13 T23 P24 D25 Y32	L9-F27 HydrophobicContact CB-CE1 4.28Å; L9-F27 WeakPolarHBondContact O-CE1 3.4Å; L9-F27 WeakPolarHBondContact O-CZ 3.41Å; L12-F27 HydrophobicContact CB-CZ 4.07Å; K13-F27 HydrophobicContact CB-CD1 4.12Å; K13-F27 HydrophobicContact CB-CD2 4.33Å; K13-F27 HydrophobicContact CB-CE1 3.83Å; K13-F27 HydrophobicContact CB-CE2 4.05Å; K13-F27 HydrophobicContact CB-CG 4.35Å; K13-F27 HydrophobicContact CB-CZ 3.79Å; K13-F27 HydrophobicContact CD-CB 4.35Å; K13-F27 HydrophobicContact CD-CD1 4.04Å; K13-F27 HydrophobicContact CD-CG 4.15Å; K13-F27 HydrophobicContact CG-CD1 4.38Å; K13-F27 HydrophobicContact CG-CD2 4.42Å; K13-F27 HydrophobicContact CG-CG 4.29Å; T23-F27 HydrophobicContact CG2-CB 3.81Å; T23-F27 HydrophobicContact CG2-CD2 3.64Å; T23-F27 HydrophobicContact CG2-CG 4.07Å; P24-F27 HydrophobicContact CB-CD2 4.02Å; P24-F27 HydrophobicContact CB-CE2 4.19Å; P24-F27 HydrophobicContact CG-CD2 4.16Å; P24-F27 HydrophobicContact CG-CE2 3.99Å; P24-F27 PolarHBondContact O-N 3.45Å; D25-F27 PolarHBondContact O-N 3.06Å; D25-F27 VanDerWaalsContact O-N 3.12Å; F27-Y32 HydrophobicContact CB-CD1 4.41Å; F27-Y32 HydrophobicContact CB-CE1 4.44Å; F27-Y32 HydrophobicContact CD1-CD1 4.25Å; F27-Y32 AromaticContact CD1-CD2 3.98Å; F27-Y32 HydrophobicContact CD1-CD2 3.98Å; F27-Y32 AromaticContact CD1-CE1 3.87Å; F27-Y32 HydrophobicContact CD1-CE1 3.87Å; F27-Y32 AromaticContact CD1-CE2 3.56Å; F27-Y32 HydrophobicContact CD1-CE2 3.56Å; F27-Y32 HydrophobicContact CD1-CG 4.32Å; F27-Y32 AromaticContact CD1-CZ 3.5Å; F27-Y32 HydrophobicContact CE1-CD2 4.48Å; F27-Y32 AromaticContact CE1-CE2 3.83Å; F27-Y32 HydrophobicContact CE1-CE2 3.83Å; F27-Y32 WeakPolarHBondContact O-CD1 3.33Å
28	Q	94.8	Very high	96.7	Very high	143 Å²	143	96.3 Å²	96.3	67%	0.668	51%	0.508	S	S	*	.	G	3₁₀ helix	trans	-93.9	-8.6	171.3	-57.2	-164.5	70.8	0	0	111.9	D25 F26	D25-Q28 WeakPolarHBondContact O-CA 3.31Å; D25-Q28 WeakPolarHBondContact O-CB 3.13Å; D25-Q28 PolarHBondContact O-N 3.48Å; F26-Q28 VanDerWaalsContact C-N 3.28Å; F26-Q28 PolarHBondContact O-N 3.2Å
29	D	97.4	Very high	96.8	Very high	80 Å²	80	88.7 Å²	88.7	43%	0.428	49%	0.485	S	S	.	.	S	Bend	trans	-58.9	134.8	179.6	-175	-95.8	0	0	0	111.1	D25 F26 G31 Y32 T33	D25-D29 PolarHBondContact O-N 3.2Å; F26-D29 VanDerWaalsContact O-CB 3.23Å; F26-D29 WeakPolarHBondContact O-CB 3.47Å; F26-D29 PolarHBondContact O-N 3.41Å; D29-G31 PolarHBondContact O-N 3.24Å; D29-G31 WeakPolarHBondContact OD1-CA 3.26Å; D29-G31 PolarHBondContact OD1-N 3.05Å; D29-Y32 PolarHBondContact O-N 2.92Å; D29-Y32 VanDerWaalsContact O-N 3.08Å; D29-Y32 PolarHBondContact OD1-N 3.34Å; D29-T33 PolarHBondContact O-N 3.44Å; D29-T33 PolarHBondContact O-OG1 3.08Å
30	P	97.6	Very high	96.8	Very high	103 Å²	103	88.1 Å²	88.1	67%	0.669	48%	0.482	S	S	*	.	H	α-helix	trans	-57.8	-31	177	-26.2	35	0	0	0	113.2	T33 R34	P30-T33 PolarHBondContact O-N 2.89Å; P30-R34 WeakPolarHBondContact O-CB 3.48Å; P30-R34 PolarHBondContact O-N 3.39Å
31	G	97.3	Very high	96.8	Very high	39 Å²	39	83.9 Å²	83.9	40%	0.402	45%	0.452	S	S	.	.	H	α-helix	trans	-65.9	-44.2	174	0	0	0	0	0	112.4	D29 T33 R34 M35	D29-G31 PolarHBondContact O-N 3.24Å; D29-G31 WeakPolarHBondContact OD1-CA 3.26Å; D29-G31 PolarHBondContact OD1-N 3.05Å; G31-T33 VanDerWaalsContact C-N 3.32Å; G31-T33 PolarHBondContact O-N 3.45Å; G31-R34 PolarHBondContact O-N 2.96Å; G31-M35 WeakPolarHBondContact O-CB 3.31Å; G31-M35 PolarHBondContact O-N 2.94Å
32	Y	96.9	Very high	96.9	Very high	41 Å²	41	82.3 Å²	82.3	16%	0.161	45%	0.451	C	S	.	.	H	α-helix	trans	-60.4	-43.1	173	179.8	-92.9	0	0	0	111.4	L9 F26 F27 D29 M35 G36	L9-Y32 HydrophobicContact CB-CE2 4.32Å; L9-Y32 HydrophobicContact CD1-CE2 4.29Å; F26-Y32 HydrophobicContact CD1-CD2 4.45Å; F26-Y32 AromaticContact CE1-CD2 3.76Å; F26-Y32 HydrophobicContact CE1-CD2 3.76Å; F26-Y32 HydrophobicContact CE1-CE2 4.31Å; F26-Y32 HydrophobicContact CZ-CD2 4.34Å; F27-Y32 HydrophobicContact CB-CD1 4.41Å; F27-Y32 HydrophobicContact CB-CE1 4.44Å; F27-Y32 HydrophobicContact CD1-CD1 4.25Å; F27-Y32 AromaticContact CD1-CD2 3.98Å; F27-Y32 HydrophobicContact CD1-CD2 3.98Å; F27-Y32 AromaticContact CD1-CE1 3.87Å; F27-Y32 HydrophobicContact CD1-CE1 3.87Å; F27-Y32 AromaticContact CD1-CE2 3.56Å; F27-Y32 HydrophobicContact CD1-CE2 3.56Å; F27-Y32 HydrophobicContact CD1-CG 4.32Å; F27-Y32 AromaticContact CD1-CZ 3.5Å; F27-Y32 HydrophobicContact CE1-CD2 4.48Å; F27-Y32 AromaticContact CE1-CE2 3.83Å; F27-Y32 HydrophobicContact CE1-CE2 3.83Å; F27-Y32 WeakPolarHBondContact O-CD1 3.33Å; D29-Y32 PolarHBondContact O-N 2.92Å; D29-Y32 VanDerWaalsContact O-N 3.08Å; D29-Y32 PolarHBondContact OD1-N 3.34Å; Y32-M35 HydrophobicContact CD2-CE 3.58Å; Y32-M35 HydrophobicContact CE2-CE 3.9Å; Y32-M35 HydrophobicContact CG-CE 4.49Å; Y32-M35 WeakPolarHBondContact O-CB 3.49Å; Y32-M35 PolarHBondContact O-N 3.24Å; Y32-G36 PolarHBondContact O-N 2.89Å
33	T	95.5	Very high	96.9	Very high	91 Å²	91	79.5 Å²	79.5	56%	0.558	43%	0.433	S	S	*	.	H	α-helix	trans	-62.9	-45.7	177.9	-61	0	0	0	0	111.4	D29 P30 G31 M35 G36 H37	D29-T33 PolarHBondContact O-N 3.44Å; D29-T33 PolarHBondContact O-OG1 3.08Å; P30-T33 PolarHBondContact O-N 2.89Å; G31-T33 VanDerWaalsContact C-N 3.32Å; G31-T33 PolarHBondContact O-N 3.45Å; T33-M35 VanDerWaalsContact C-N 3.33Å; T33-M35 PolarHBondContact O-N 3.24Å; T33-G36 PolarHBondContact O-N 3.32Å; T33-H37 PolarHBondContact O-N 3.05Å
34	R	97.1	Very high	96.9	Very high	209 Å²	209	80.1 Å²	80.1	79%	0.789	44%	0.438	S	S	*	.	H	α-helix	trans	-63.4	-37.4	176.9	-176.7	174.6	-178.6	176.8	0.1	112.4	P30 G31 G36 H37	P30-R34 WeakPolarHBondContact O-CB 3.48Å; P30-R34 PolarHBondContact O-N 3.39Å; G31-R34 PolarHBondContact O-N 2.96Å; R34-G36 VanDerWaalsContact C-N 3.25Å; R34-G36 PolarHBondContact O-N 3.39Å; R34-H37 WeakPolarHBondContact O-CB 3.33Å; R34-H37 PolarHBondContact O-N 3.47Å
35	M	95.9	Very high	96.5	Very high	61 Å²	61	80 Å²	80	30%	0.3	43%	0.433	S	S	.	.	H	α-helix	trans	-62.7	-32.8	177.4	-177.1	174.9	66.3	0	0	112.2	Y5 L9 G31 Y32 T33 H37 F38	Y5-M35 HydrophobicContact CD2-SD 4.2Å; Y5-M35 HydrophobicContact CE2-CE 4.2Å; Y5-M35 HydrophobicContact CE2-CG 4.35Å; Y5-M35 HydrophobicContact CE2-SD 3.41Å; Y5-M35 WeakPolarHBondContact CE2-SD 3.48Å; L9-M35 HydrophobicContact CD1-CE 3.79Å; G31-M35 WeakPolarHBondContact O-CB 3.31Å; G31-M35 PolarHBondContact O-N 2.94Å; Y32-M35 HydrophobicContact CD2-CE 3.58Å; Y32-M35 HydrophobicContact CE2-CE 3.9Å; Y32-M35 HydrophobicContact CG-CE 4.49Å; Y32-M35 WeakPolarHBondContact O-CB 3.49Å; Y32-M35 PolarHBondContact O-N 3.24Å; T33-M35 VanDerWaalsContact C-N 3.33Å; T33-M35 PolarHBondContact O-N 3.24Å; M35-H37 VanDerWaalsContact C-N 3.3Å; M35-F38 WeakPolarHBondContact O-CE1 3.21Å
36	G	95.6	Very high	96	Very high	48 Å²	48	77.8 Å²	77.8	50%	0.495	43%	0.427	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79	-5.3	173.4	0	0	0	0	0	115.1	Y32 T33 R34 F38	Y32-G36 PolarHBondContact O-N 2.89Å; T33-G36 PolarHBondContact O-N 3.32Å; R34-G36 VanDerWaalsContact C-N 3.25Å; R34-G36 PolarHBondContact O-N 3.39Å; G36-F38 WeakPolarHBondContact O-CD2 3.41Å; G36-F38 PolarHBondContact O-N 2.98Å
37	H	97.9	Very high	95.6	Very high	81 Å²	81	74.5 Å²	74.5	38%	0.375	42%	0.417	S	S	.	.			trans	-98.2	82.7	-178.3	-168.6	90	0	0	0	111.2	T33 R34 M35 V39 D61	T33-H37 PolarHBondContact O-N 3.05Å; R34-H37 WeakPolarHBondContact O-CB 3.33Å; R34-H37 PolarHBondContact O-N 3.47Å; M35-H37 VanDerWaalsContact C-N 3.3Å; H37-V39 PolarHBondContact O-N 3.29Å; H37-D61 IonicContact CD2-OD1 3.97Å; H37-D61 IonicContact CE1-OD1 3.29Å; H37-D61 PolarHBondContact CE1-OD1 3.12Å; H37-D61 VanDerWaalsContact CE1-OD1 3.29Å; H37-D61 IonicContact NE2-OD1 2.74Å; H37-D61 PolarHBondContact NE2-OD1 3.36Å; H37-D61 IonicContact NE2-OD2 3.61Å
38	F	98.2	Very high	95.1	Very high	98 Å²	98	79.3 Å²	79.3	43%	0.43	44%	0.443	S	S	.	.			trans	-76.9	86.2	-173.5	-56.5	-72.2	0	0	0	113	M35 G36 L40 V58 V59	M35-F38 WeakPolarHBondContact O-CE1 3.21Å; G36-F38 WeakPolarHBondContact O-CD2 3.41Å; G36-F38 PolarHBondContact O-N 2.98Å; F38-L40 VanDerWaalsContact C-N 3.26Å; F38-L40 PolarHBondContact O-N 3.42Å; F38-V58 HydrophobicContact CB-CG2 3.84Å; F38-V59 WeakPolarHBondContact O-CG2 3.46Å
39	V	98.3	Very high	94.8	Very high	46 Å²	46	78.3 Å²	78.3	28%	0.279	45%	0.447	S	S	.	.	S	Bend	trans	-60.5	-35.8	174.4	178.1	0	0	0	0	111.8	H37 G62 F63	H37-V39 PolarHBondContact O-N 3.29Å; V39-G62 CarbonylContact O-C 3.43Å; V39-G62 WeakPolarHBondContact O-CA 3.45Å; V39-F63 PolarHBondContact O-N 3.48Å
40	L	98.3	Very high	94.3	Very high	97 Å²	97	77.8 Å²	77.8	51%	0.508	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	99.4	173.4	-62.2	177.8	0	0	0	108.5	F38 F63 I65 F90	F38-L40 VanDerWaalsContact C-N 3.26Å; F38-L40 PolarHBondContact O-N 3.42Å; L40-F63 HydrophobicContact CD2-CB 4.18Å; L40-F63 HydrophobicContact CD2-CD2 3.7Å; L40-F63 HydrophobicContact CD2-CG 4.33Å; L40-I65 HydrophobicContact CD2-CD1 4.1Å; L40-F90 HydrophobicContact CD2-CE2 3.85Å; L40-F90 HydrophobicContact CD2-CZ 4.11Å
41	S	98.4	Very high	93.4	Very high	26 Å²	26	78.3 Å²	78.3	18%	0.182	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.3	123.8	172.5	-173.8	0	0	0	0	108.9	F55 F63 I65	S41-F55 VanDerWaalsContact O-CZ 3.25Å; S41-F55 WeakPolarHBondContact O-CZ 3.26Å; S41-F55 WeakPolarHBondContact OG-CE2 3.39Å; S41-F63 PolarHBondContact N-O 3.41Å; S41-F63 VanDerWaalsContact N-O 3.09Å; S41-I65 PolarHBondContact O-N 3.31Å
42	T	98.2	Very high	92.7	Very high	82 Å²	82	84.1 Å²	84.1	50%	0.503	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	147.9	-172.5	78.2	0	0	0	0	111.9	I65	T42-I65 CarbonylContact C-O 3.57Å; T42-I65 VanDerWaalsContact CA-O 3.26Å; T42-I65 WeakPolarHBondContact CA-O 3.26Å; T42-I65 HydrophobicContact CG2-CB 4.21Å; T42-I65 HydrophobicContact CG2-CD1 4.32Å
43	S	96.8	Very high	92.4	Very high	61 Å²	61	83 Å²	83	43%	0.427	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.2	140.3	171.8	-170.7	0	0	0	0	110.4	I65 G66 Y67	S43-I65 PolarHBondContact N-O 2.77Å; S43-G66 CarbonylContact O-C 3.6Å; S43-G66 WeakPolarHBondContact O-CA 3.45Å; S43-Y67 VanDerWaalsContact O-CD1 3.26Å; S43-Y67 WeakPolarHBondContact O-CD1 3.32Å; S43-Y67 PolarHBondContact O-N 2.95Å
44	T	94.7	Very high	92.3	Very high	59 Å²	59	81.1 Å²	81.1	36%	0.362	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	146.5	176.8	-169.9	0	0	0	0	111.5	S46 Y67	T44-S46 PolarHBondContact OG1-OG 3.47Å; T44-Y67 CarbonylContact C-O 3.49Å; T44-Y67 VanDerWaalsContact CA-O 3.32Å; T44-Y67 WeakPolarHBondContact CA-O 3.49Å
45	L	88.8	Confident	92.4	Very high	63 Å²	63	74.4 Å²	74.4	33%	0.33	44%	0.435	S	S	.	.			trans	-127.6	60.7	172.1	-68.5	165.7	0	0	0	109.2	T47 I50 Y67 N68	L45-T47 VanDerWaalsContact C-N 3.31Å; L45-T47 PolarHBondContact O-N 3.04Å; L45-I50 HydrophobicContact CD1-CG2 4.37Å; L45-Y67 PolarHBondContact N-O 3.08Å; L45-N68 PolarHBondContact O-ND2 3.21Å; L45-N68 PolarHBondContact O-OD1 3.09Å
46	S	86.4	Confident	92.5	Very high	80 Å²	80	73.7 Å²	73.7	56%	0.559	44%	0.444	S	S	*	.			trans	-66	83.4	-177.9	-63.6	0	0	0	0	112.3	T44 N68	T44-S46 PolarHBondContact OG1-OG 3.47Å; S46-N68 WeakPolarHBondContact CA-OD1 3.32Å
47	T	86.9	Confident	92.6	Very high	43 Å²	43	73.4 Å²	73.4	26%	0.264	43%	0.433	S	S	.	.			trans	-154.4	149.2	177.2	178	0	0	0	0	110.9	L45 T49 I50 N68	L45-T47 VanDerWaalsContact C-N 3.31Å; L45-T47 PolarHBondContact O-N 3.04Å; T47-T49 VanDerWaalsContact C-N 3.3Å; T47-T49 PolarHBondContact OG1-N 2.92Å; T47-T49 PolarHBondContact OG1-OG1 3.23Å; T47-I50 HydrophobicContact CG2-CB 3.6Å; T47-I50 HydrophobicContact CG2-CD1 3.88Å; T47-I50 HydrophobicContact CG2-CG1 3.68Å; T47-N68 PolarHBondContact N-OD1 2.88Å; T47-N68 PolarHBondContact O-ND2 3.03Å
48	D	86.1	Confident	92.6	Very high	114 Å²	114	73.5 Å²	73.5	61%	0.61	44%	0.439	S	S	*	.	S	Bend	trans	-78.3	-15.8	173.3	-71.3	-45.4	0	0	0	113.1	V70	D48-V70 WeakPolarHBondContact OD1-CG1 3.36Å
49	T	89.5	Confident	92.6	Very high	122 Å²	122	70 Å²	70	75%	0.748	43%	0.426	S	S	*	.	S	Bend	trans	-84.8	-22.8	-175.9	59.6	0	0	0	0	113.9	T47	T47-T49 VanDerWaalsContact C-N 3.3Å; T47-T49 PolarHBondContact OG1-N 2.92Å; T47-T49 PolarHBondContact OG1-OG1 3.23Å
50	I	86	Confident	92.6	Very high	70 Å²	70	74 Å²	74	36%	0.359	44%	0.441	S	S	.	.			trans	-108	117.9	179.8	-59.4	175.9	0	0	0	108.6	L45 T47 F52 N68	L45-I50 HydrophobicContact CD1-CG2 4.37Å; T47-I50 HydrophobicContact CG2-CB 3.6Å; T47-I50 HydrophobicContact CG2-CD1 3.88Å; T47-I50 HydrophobicContact CG2-CG1 3.68Å; I50-F52 WeakPolarHBondContact CG2-O 3.34Å; I50-N68 PolarHBondContact O-ND2 2.87Å; I50-N68 VanDerWaalsContact O-ND2 3.15Å
51	V	78.9	Confident	92.6	Very high	113 Å²	113	71.8 Å²	71.8	69%	0.685	43%	0.43	S	S	*	.	S	Bend	trans	-76.4	-41.9	-177.6	-175.2	0	0	0	0	111.3
52	F	82.8	Confident	92.5	Very high	161 Å²	161	70.5 Å²	70.5	71%	0.706	42%	0.421	S	S	*	.			trans	-153.9	154.1	176.8	61.2	-93.3	0	0	0	111.2	I50 V77	I50-F52 WeakPolarHBondContact CG2-O 3.34Å; F52-V77 HydrophobicContact CB-CG2 3.85Å
53	G	90.6	Very high	92.6	Very high	19 Å²	19	67.4 Å²	67.4	20%	0.196	40%	0.401	C	S	.	.			trans	-153.2	148.8	169.1	0	0	0	0	0	109
54	G	94.2	Very high	92.7	Very high	51 Å²	51	64.5 Å²	64.5	53%	0.526	38%	0.38	S	S	.	.			trans	-156.3	163.6	-175.5	0	0	0	0	0	111.4
55	F	97.9	Very high	92.8	Very high	68 Å²	68	62.3 Å²	62.3	30%	0.298	37%	0.366	S	S	.	.			trans	-146.9	158.6	179.2	57.6	-81.8	0	0	0	108.5	S41 S79	S41-F55 VanDerWaalsContact O-CZ 3.25Å; S41-F55 WeakPolarHBondContact O-CZ 3.26Å; S41-F55 WeakPolarHBondContact OG-CE2 3.39Å; F55-S79 WeakPolarHBondContact O-CB 3.31Å; F55-S79 PolarHBondContact O-OG 2.99Å
56	G	98	Very high	93.3	Very high	46 Å²	46	59.5 Å²	59.5	47%	0.474	35%	0.352	S	S	.	.			trans	-70.9	164.7	176.3	0	0	0	0	0	112.6	S79	G56-S79 WeakPolarHBondContact CA-OG 3.28Å
57	P	98.2	Very high	93.7	Very high	41 Å²	41	59.7 Å²	59.7	27%	0.266	34%	0.341	S	S	.	.			trans	-58.9	146.1	171.1	-22.1	34.6	0	0	0	111.9	V59 G62 S79	P57-V59 VanDerWaalsContact CB-O 3.31Å; P57-V59 WeakPolarHBondContact CB-O 3.15Å; P57-G62 WeakPolarHBondContact CG-O 3.49Å; P57-S79 WeakPolarHBondContact CD-OG 3.47Å
58	V	98.2	Very high	94.1	Very high	84 Å²	84	58.3 Å²	58.3	51%	0.509	33%	0.332	S	S	.	.	S	Bend	trans	-88.1	-8.5	176.8	-58.8	0	0	0	0	113.2	F38	F38-V58 HydrophobicContact CB-CG2 3.84Å
59	V	98.2	Very high	94.4	Very high	25 Å²	25	56.1 Å²	56.1	15%	0.152	32%	0.323	C	S	.	.	S	Bend	trans	-136.9	153.3	173.1	-62.5	0	0	0	0	109.2	F38 P57 D61 G62	F38-V59 WeakPolarHBondContact O-CG2 3.46Å; P57-V59 VanDerWaalsContact CB-O 3.31Å; P57-V59 WeakPolarHBondContact CB-O 3.15Å; V59-D61 VanDerWaalsContact C-N 3.26Å; V59-D61 PolarHBondContact O-N 3.14Å; V59-G62 PolarHBondContact O-N 3.04Å; V59-G62 VanDerWaalsContact O-N 3.1Å
60	Q	97.3	Very high	94.4	Very high	128 Å²	128	51.3 Å²	51.3	60%	0.598	29%	0.293	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.4	-34	-170.5	-162	-178.3	21.6	0	0	113.3	K84	Q60-K84 HydrophobicContact CG-CG 4.24Å; Q60-K84 WeakPolarHBondContact O-CB 3.46Å; Q60-K84 WeakPolarHBondContact O-CG 3.39Å
61	D	97.8	Very high	94.6	Very high	51 Å²	51	53.6 Å²	53.6	27%	0.273	31%	0.313	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.6	18.6	-179.8	71.4	-45.2	0	0	0	113.5	H37 V59 K84 R85	H37-D61 IonicContact CD2-OD1 3.97Å; H37-D61 IonicContact CE1-OD1 3.29Å; H37-D61 PolarHBondContact CE1-OD1 3.12Å; H37-D61 VanDerWaalsContact CE1-OD1 3.29Å; H37-D61 IonicContact NE2-OD1 2.74Å; H37-D61 PolarHBondContact NE2-OD1 3.36Å; H37-D61 IonicContact NE2-OD2 3.61Å; V59-D61 VanDerWaalsContact C-N 3.26Å; V59-D61 PolarHBondContact O-N 3.14Å; D61-K84 HydrophobicContact CB-CB 4.48Å; D61-R85 VanDerWaalsContact O-CG 3.29Å; D61-R85 WeakPolarHBondContact O-CG 3.35Å; D61-R85 PolarHBondContact O-NE 2.94Å; D61-R85 IonicContact OD2-NH2 3.82Å
62	G	98.3	Very high	95	Very high	0 Å²	0	56 Å²	56	0%	0	32%	0.322	C	S	.	.			trans	-104.3	-175.9	-176.6	0	0	0	0	0	115.3	V39 P57 V59	V39-G62 CarbonylContact O-C 3.43Å; V39-G62 WeakPolarHBondContact O-CA 3.45Å; P57-G62 WeakPolarHBondContact CG-O 3.49Å; V59-G62 PolarHBondContact O-N 3.04Å; V59-G62 VanDerWaalsContact O-N 3.1Å
63	F	98.8	Very high	95.2	Very high	17 Å²	17	53.6 Å²	53.6	8%	0.075	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	141.6	170.9	-63.8	-82.6	0	0	0	110.4	V39 L40 S41 I65 I78 S79 R85 F90	V39-F63 PolarHBondContact O-N 3.48Å; L40-F63 HydrophobicContact CD2-CB 4.18Å; L40-F63 HydrophobicContact CD2-CD2 3.7Å; L40-F63 HydrophobicContact CD2-CG 4.33Å; S41-F63 PolarHBondContact N-O 3.41Å; S41-F63 VanDerWaalsContact N-O 3.09Å; F63-I65 HydrophobicContact CB-CD1 4.17Å; F63-I65 HydrophobicContact CB-CG1 4.05Å; F63-I78 HydrophobicContact CD1-CG2 3.95Å; F63-S79 VanDerWaalsContact CA-O 3.28Å; F63-S79 WeakPolarHBondContact CA-O 3.38Å; F63-R85 HydrophobicContact CD1-CB 4.49Å; F63-R85 HydrophobicContact CE1-CB 3.78Å; F63-R85 HydrophobicContact CE1-CG 4.5Å; F63-R85 HydrophobicContact CE2-CB 4.2Å; F63-R85 HydrophobicContact CE2-CG 4.07Å; F63-R85 HydrophobicContact CZ-CB 3.63Å; F63-R85 HydrophobicContact CZ-CG 4.01Å; F63-F90 HydrophobicContact CD1-CB 4.43Å; F63-F90 HydrophobicContact CD1-CG 4.44Å; F63-F90 HydrophobicContact CD2-CD2 4.21Å; F63-F90 HydrophobicContact CD2-CE2 4.46Å; F63-F90 HydrophobicContact CE1-CB 3.81Å; F63-F90 HydrophobicContact CE1-CD2 4.34Å; F63-F90 HydrophobicContact CE1-CG 4.19Å; F63-F90 AromaticContact CE2-CD2 3.88Å; F63-F90 HydrophobicContact CE2-CD2 3.88Å; F63-F90 HydrophobicContact CE2-CE2 4.45Å; F63-F90 HydrophobicContact CZ-CB 3.95Å; F63-F90 AromaticContact CZ-CD2 3.93Å; F63-F90 HydrophobicContact CZ-CD2 3.93Å; F63-F90 HydrophobicContact CZ-CG 4.21Å
64	G	98.6	Very high	95.2	Very high	0 Å²	0	57 Å²	57	0%	0	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	123.1	163.2	0	0	0	0	0	109.3	I78 S79	G64-I78 WeakPolarHBondContact O-CA 3.26Å; G64-S79 WeakPolarHBondContact CA-OG 3.25Å; G64-S79 PolarHBondContact N-O 3.33Å; G64-S79 PolarHBondContact N-OG 3.47Å; G64-S79 PolarHBondContact O-N 2.73Å; G64-S79 PolarHBondContact O-OG 3.38Å
65	I	98.3	Very high	95.1	Very high	13 Å²	13	56.4 Å²	56.4	7%	0.067	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.1	99.2	-172.3	-51.8	170.3	0	0	0	109.3	L40 S41 T42 S43 F63 A76 V77 I78 F90	L40-I65 HydrophobicContact CD2-CD1 4.1Å; S41-I65 PolarHBondContact O-N 3.31Å; T42-I65 CarbonylContact C-O 3.57Å; T42-I65 VanDerWaalsContact CA-O 3.26Å; T42-I65 WeakPolarHBondContact CA-O 3.26Å; T42-I65 HydrophobicContact CG2-CB 4.21Å; T42-I65 HydrophobicContact CG2-CD1 4.32Å; S43-I65 PolarHBondContact N-O 2.77Å; F63-I65 HydrophobicContact CB-CD1 4.17Å; F63-I65 HydrophobicContact CB-CG1 4.05Å; I65-A76 HydrophobicContact CG2-CB 4.43Å; I65-V77 WeakPolarHBondContact CA-O 3.38Å; I65-I78 HydrophobicContact CG1-CG1 4.46Å; I65-I78 HydrophobicContact CG2-CG1 4.27Å; I65-F90 HydrophobicContact CD1-CE1 3.6Å; I65-F90 HydrophobicContact CD1-CZ 3.63Å; I65-F90 HydrophobicContact CG1-CE1 4.49Å
66	G	97.5	Very high	95	Very high	3 Å²	3	55 Å²	55	3%	0.031	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88	132.6	166.7	0	0	0	0	0	109.5	S43 A76 V77	S43-G66 CarbonylContact O-C 3.6Å; S43-G66 WeakPolarHBondContact O-CA 3.45Å; G66-A76 CarbonylContact O-C 3.54Å; G66-A76 VanDerWaalsContact O-CA 3.29Å; G66-A76 WeakPolarHBondContact O-CA 3.45Å; G66-V77 PolarHBondContact N-O 3.3Å; G66-V77 PolarHBondContact O-N 2.74Å
67	Y	96	Very high	94.9	Very high	85 Å²	85	55.4 Å²	55.4	33%	0.333	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.6	156.5	178.8	67.1	-84.1	0	0	0	112.8	S43 T44 L45 V69 G75	S43-Y67 VanDerWaalsContact O-CD1 3.26Å; S43-Y67 WeakPolarHBondContact O-CD1 3.32Å; S43-Y67 PolarHBondContact O-N 2.95Å; T44-Y67 CarbonylContact C-O 3.49Å; T44-Y67 VanDerWaalsContact CA-O 3.32Å; T44-Y67 WeakPolarHBondContact CA-O 3.49Å; L45-Y67 PolarHBondContact N-O 3.08Å; Y67-V69 HydrophobicContact CD2-CG2 3.92Å; Y67-V69 HydrophobicContact CE2-CG2 4.21Å; Y67-G75 CarbonylContact C-O 3.55Å; Y67-G75 WeakPolarHBondContact CA-O 3.48Å; Y67-G75 WeakPolarHBondContact CB-O 3.35Å
68	N	94.5	Very high	95	Very high	14 Å²	14	54.8 Å²	54.8	8%	0.075	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	134.5	174.7	-171.5	6.1	0	0	0	108.9	L45 S46 T47 I50 V70 L74 G75	L45-N68 PolarHBondContact O-ND2 3.21Å; L45-N68 PolarHBondContact O-OD1 3.09Å; S46-N68 WeakPolarHBondContact CA-OD1 3.32Å; T47-N68 PolarHBondContact N-OD1 2.88Å; T47-N68 PolarHBondContact O-ND2 3.03Å; I50-N68 PolarHBondContact O-ND2 2.87Å; I50-N68 VanDerWaalsContact O-ND2 3.15Å; N68-V70 WeakPolarHBondContact OD1-CG1 3.29Å; N68-L74 WeakPolarHBondContact O-CA 3.47Å; N68-G75 PolarHBondContact N-O 3.02Å; N68-G75 PolarHBondContact O-N 2.8Å
69	V	92.4	Very high	95	Very high	67 Å²	67	52.2 Å²	52.2	41%	0.406	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	117.7	175.5	-169.9	0	0	0	0	107.2	Y67 L74	Y67-V69 HydrophobicContact CD2-CG2 3.92Å; Y67-V69 HydrophobicContact CE2-CG2 4.21Å; V69-L74 HydrophobicContact CB-CD1 4.46Å; V69-L74 HydrophobicContact CG1-CD1 4.21Å; V69-L74 HydrophobicContact CG2-CD1 3.6Å; V69-L74 HydrophobicContact CG2-CG 4Å
70	V	90.6	Very high	95	Very high	21 Å²	21	52.4 Å²	52.4	13%	0.127	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	168.7	173.6	-53.5	0	0	0	0	108.3	D48 N68 N72 K73	D48-V70 WeakPolarHBondContact OD1-CG1 3.36Å; N68-V70 WeakPolarHBondContact OD1-CG1 3.29Å; V70-N72 PolarHBondContact O-N 2.96Å; V70-K73 HydrophobicContact CG2-CB 4.46Å; V70-K73 HydrophobicContact CG2-CD 3.92Å; V70-K73 HydrophobicContact CG2-CG 3.22Å; V70-K73 PolarHBondContact N-O 2.89Å; V70-K73 PolarHBondContact O-N 3.03Å
71	P	89.8	Confident	95	Very high	119 Å²	119	49.2 Å²	49.2	77%	0.773	28%	0.282	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.3	-36.6	-165.3	-32.2	37.3	0	0	0	116.1
72	N	87	Confident	94.8	Very high	163 Å²	163	56.4 Å²	56.4	87%	0.872	31%	0.31	S	S	*	.	T	Hydrogen-bonded Turn	trans	-114.3	3.3	-173.1	-60	-30.1	0	0	0	114.3	V70	V70-N72 PolarHBondContact O-N 2.96Å
73	K	86.4	Confident	94.7	Very high	110 Å²	110	60.8 Å²	60.8	48%	0.478	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.1	148.3	-178.4	62.4	180	177.8	179.1	0	112.4	V70	V70-K73 HydrophobicContact CG2-CB 4.46Å; V70-K73 HydrophobicContact CG2-CD 3.92Å; V70-K73 HydrophobicContact CG2-CG 3.22Å; V70-K73 PolarHBondContact N-O 2.89Å; V70-K73 PolarHBondContact O-N 3.03Å
74	L	91	Very high	94.6	Very high	91 Å²	91	65.1 Å²	65.1	48%	0.476	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	139.3	168.1	-177.4	148.5	0	0	0	108.7	N68 V69 L98	N68-L74 WeakPolarHBondContact O-CA 3.47Å; V69-L74 HydrophobicContact CB-CD1 4.46Å; V69-L74 HydrophobicContact CG1-CD1 4.21Å; V69-L74 HydrophobicContact CG2-CD1 3.6Å; V69-L74 HydrophobicContact CG2-CG 4Å; L74-L98 HydrophobicContact CD2-CD1 3.65Å
75	G	92.1	Very high	94.5	Very high	38 Å²	38	70 Å²	70	39%	0.392	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.9	150.7	176.7	0	0	0	0	0	111.7	Y67 N68	Y67-G75 CarbonylContact C-O 3.55Å; Y67-G75 WeakPolarHBondContact CA-O 3.48Å; Y67-G75 WeakPolarHBondContact CB-O 3.35Å; N68-G75 PolarHBondContact N-O 3.02Å; N68-G75 PolarHBondContact O-N 2.8Å
76	A	95.8	Very high	94.5	Very high	39 Å²	39	74 Å²	74	32%	0.322	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	136.2	176.5	0	0	0	0	0	111.2	I65 G66 I78 L94	I65-A76 HydrophobicContact CG2-CB 4.43Å; G66-A76 CarbonylContact O-C 3.54Å; G66-A76 VanDerWaalsContact O-CA 3.29Å; G66-A76 WeakPolarHBondContact O-CA 3.45Å; A76-I78 HydrophobicContact CB-CG1 4.39Å; A76-L94 HydrophobicContact CB-CD2 3.86Å
77	V	97.3	Very high	94.5	Very high	55 Å²	55	74.9 Å²	74.9	33%	0.333	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	114.6	167.3	-179.3	0	0	0	0	107.3	F52 I65 G66	F52-V77 HydrophobicContact CB-CG2 3.85Å; I65-V77 WeakPolarHBondContact CA-O 3.38Å; G66-V77 PolarHBondContact N-O 3.3Å; G66-V77 PolarHBondContact O-N 2.74Å
78	I	98.3	Very high	94.6	Very high	28 Å²	28	73.7 Å²	73.7	14%	0.144	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	123.8	-177	-59.8	150.2	0	0	0	108.8	F63 G64 I65 A76 A87 F90 L94	F63-I78 HydrophobicContact CD1-CG2 3.95Å; G64-I78 WeakPolarHBondContact O-CA 3.26Å; I65-I78 HydrophobicContact CG1-CG1 4.46Å; I65-I78 HydrophobicContact CG2-CG1 4.27Å; A76-I78 HydrophobicContact CB-CG1 4.39Å; I78-A87 HydrophobicContact CG2-CB 3.87Å; I78-F90 HydrophobicContact CD1-CD1 3.78Å; I78-F90 HydrophobicContact CD1-CE1 4.33Å; I78-F90 HydrophobicContact CG1-CD1 4.16Å; I78-F90 HydrophobicContact CG2-CB 4.48Å; I78-F90 HydrophobicContact CG2-CD1 4Å; I78-F90 HydrophobicContact CG2-CG 4.5Å; I78-L94 HydrophobicContact CD1-CD2 4.15Å
79	S	98.4	Very high	94.8	Very high	30 Å²	30	75.4 Å²	75.4	21%	0.21	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	149.7	174.8	74.9	0	0	0	0	110.5	F55 G56 P57 F63 G64	F55-S79 WeakPolarHBondContact O-CB 3.31Å; F55-S79 PolarHBondContact O-OG 2.99Å; G56-S79 WeakPolarHBondContact CA-OG 3.28Å; P57-S79 WeakPolarHBondContact CD-OG 3.47Å; F63-S79 VanDerWaalsContact CA-O 3.28Å; F63-S79 WeakPolarHBondContact CA-O 3.38Å; G64-S79 WeakPolarHBondContact CA-OG 3.25Å; G64-S79 PolarHBondContact N-O 3.33Å; G64-S79 PolarHBondContact N-OG 3.47Å; G64-S79 PolarHBondContact O-N 2.73Å; G64-S79 PolarHBondContact O-OG 3.38Å
80	S	98.5	Very high	95.1	Very high	28 Å²	28	74.8 Å²	74.8	20%	0.196	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.2	162.1	173.6	71.4	0	0	0	0	110.7	K82 R85 A87	S80-K82 PolarHBondContact O-N 3.25Å; S80-R85 WeakPolarHBondContact CB-O 3.36Å; S80-R85 PolarHBondContact OG-O 3.47Å; S80-A87 PolarHBondContact OG-N 3.43Å
81	N	97.1	Very high	95.4	Very high	62 Å²	62	76.3 Å²	76.3	33%	0.332	43%	0.434	S	S	.	.			trans	-77.8	115.7	160	-173.5	-30.6	0	0	0	108.6	S83 K84 R85	N81-S83 PolarHBondContact O-N 2.98Å; N81-S83 VanDerWaalsContact O-N 3.08Å; N81-S83 PolarHBondContact OD1-N 3.37Å; N81-S83 PolarHBondContact OD1-OG 3.23Å; N81-K84 HydrophobicContact CB-CB 4.4Å; N81-K84 HydrophobicContact CB-CG 4.4Å; N81-K84 PolarHBondContact O-N 2.94Å; N81-R85 PolarHBondContact O-N 3.48Å
82	K	93.6	Very high	95.9	Very high	202 Å²	202	75.3 Å²	75.3	88%	0.878	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.2	-30.7	-177.5	-68.6	-174.6	179	-178.8	0	113.8	S80 K84	S80-K82 PolarHBondContact O-N 3.25Å; K82-K84 VanDerWaalsContact C-N 3.25Å; K82-K84 PolarHBondContact O-N 3.08Å
83	S	96.6	Very high	96.4	Very high	91 Å²	91	69.9 Å²	69.9	64%	0.636	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.6	-13.4	178.5	66.2	0	0	0	0	113.9	N81	N81-S83 PolarHBondContact O-N 2.98Å; N81-S83 VanDerWaalsContact O-N 3.08Å; N81-S83 PolarHBondContact OD1-N 3.37Å; N81-S83 PolarHBondContact OD1-OG 3.23Å
84	K	96.9	Very high	96.9	Very high	109 Å²	109	67.2 Å²	67.2	47%	0.474	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	-119.1	-35.2	-174.1	-61.1	-61.1	-172.3	176.1	0	113.5	Q60 D61 N81 K82	Q60-K84 HydrophobicContact CG-CG 4.24Å; Q60-K84 WeakPolarHBondContact O-CB 3.46Å; Q60-K84 WeakPolarHBondContact O-CG 3.39Å; D61-K84 HydrophobicContact CB-CB 4.48Å; N81-K84 HydrophobicContact CB-CB 4.4Å; N81-K84 HydrophobicContact CB-CG 4.4Å; N81-K84 PolarHBondContact O-N 2.94Å; K82-K84 VanDerWaalsContact C-N 3.25Å; K82-K84 PolarHBondContact O-N 3.08Å
85	R	96.8	Very high	97.2	Very high	102 Å²	102	70.8 Å²	70.8	39%	0.385	40%	0.399	S	S	.	.			trans	-149.7	147	-171.7	-67	-64.7	-175.3	-176.8	-3.5	111.1	D61 F63 S80 N81	D61-R85 VanDerWaalsContact O-CG 3.29Å; D61-R85 WeakPolarHBondContact O-CG 3.35Å; D61-R85 PolarHBondContact O-NE 2.94Å; D61-R85 IonicContact OD2-NH2 3.82Å; F63-R85 HydrophobicContact CD1-CB 4.49Å; F63-R85 HydrophobicContact CE1-CB 3.78Å; F63-R85 HydrophobicContact CE1-CG 4.5Å; F63-R85 HydrophobicContact CE2-CB 4.2Å; F63-R85 HydrophobicContact CE2-CG 4.07Å; F63-R85 HydrophobicContact CZ-CB 3.63Å; F63-R85 HydrophobicContact CZ-CG 4.01Å; S80-R85 WeakPolarHBondContact CB-O 3.36Å; S80-R85 PolarHBondContact OG-O 3.47Å; N81-R85 PolarHBondContact O-N 3.48Å
86	D	97.9	Very high	97.5	Very high	96 Å²	96	75.7 Å²	75.7	51%	0.513	41%	0.409	S	S	.	.			trans	-101.1	105.6	177.9	-174.8	-12.9	0	0	0	111.2	A88 A89 F90	D86-A88 VanDerWaalsContact C-N 3.31Å; D86-A88 PolarHBondContact O-N 3.19Å; D86-A88 WeakPolarHBondContact OD1-CA 3.37Å; D86-A88 WeakPolarHBondContact OD1-CB 3.21Å; D86-A88 PolarHBondContact OD1-N 3.29Å; D86-A89 HydrophobicContact CB-CB 3.85Å; D86-A89 PolarHBondContact OD1-N 2.84Å; D86-F90 PolarHBondContact O-N 3.22Å; D86-F90 VanDerWaalsContact O-N 3.13Å
87	A	98.1	Very high	97.6	Very high	22 Å²	22	76.8 Å²	76.8	18%	0.182	42%	0.415	C	S	.	.	H	α-helix	trans	-65.2	-31.7	176.2	0	0	0	0	0	113	I78 S80 F90 S91	I78-A87 HydrophobicContact CG2-CB 3.87Å; S80-A87 PolarHBondContact OG-N 3.43Å; A87-F90 PolarHBondContact O-N 3.03Å; A87-S91 WeakPolarHBondContact O-CB 3.29Å; A87-S91 PolarHBondContact O-N 3.44Å
88	A	98.1	Very high	97.5	Very high	61 Å²	61	77.3 Å²	77.3	50%	0.504	42%	0.415	S	S	.	.	H	α-helix	trans	-72.4	-43.1	179.5	0	0	0	0	0	110.8	D86 F90 S91 N92	D86-A88 VanDerWaalsContact C-N 3.31Å; D86-A88 PolarHBondContact O-N 3.19Å; D86-A88 WeakPolarHBondContact OD1-CA 3.37Å; D86-A88 WeakPolarHBondContact OD1-CB 3.21Å; D86-A88 PolarHBondContact OD1-N 3.29Å; A88-F90 VanDerWaalsContact C-N 3.33Å; A88-F90 PolarHBondContact O-N 2.84Å; A88-S91 WeakPolarHBondContact O-CB 3.43Å; A88-S91 PolarHBondContact O-N 2.59Å; A88-N92 PolarHBondContact O-N 2.88Å; A88-N92 PolarHBondContact O-ND2 2.96Å
89	A	98.3	Very high	97.3	Very high	50 Å²	50	80.1 Å²	80.1	41%	0.413	43%	0.431	S	S	.	.	H	α-helix	trans	-59.8	-43.3	172.6	0	0	0	0	0	111.7	D86 N92 A93	D86-A89 HydrophobicContact CB-CB 3.85Å; D86-A89 PolarHBondContact OD1-N 2.84Å; A89-N92 PolarHBondContact O-N 3.44Å; A89-A93 PolarHBondContact O-N 3.1Å
90	F	98.4	Very high	97.2	Very high	54 Å²	54	83.5 Å²	83.5	24%	0.237	45%	0.445	C	S	.	.	H	α-helix	trans	-62.7	-43.4	175.2	-171.5	-82.8	0	0	0	111.9	L40 F63 I65 I78 D86 A87 A88 N92 A93 L94	L40-F90 HydrophobicContact CD2-CE2 3.85Å; L40-F90 HydrophobicContact CD2-CZ 4.11Å; F63-F90 HydrophobicContact CD1-CB 4.43Å; F63-F90 HydrophobicContact CD1-CG 4.44Å; F63-F90 HydrophobicContact CD2-CD2 4.21Å; F63-F90 HydrophobicContact CD2-CE2 4.46Å; F63-F90 HydrophobicContact CE1-CB 3.81Å; F63-F90 HydrophobicContact CE1-CD2 4.34Å; F63-F90 HydrophobicContact CE1-CG 4.19Å; F63-F90 AromaticContact CE2-CD2 3.88Å; F63-F90 HydrophobicContact CE2-CD2 3.88Å; F63-F90 HydrophobicContact CE2-CE2 4.45Å; F63-F90 HydrophobicContact CZ-CB 3.95Å; F63-F90 AromaticContact CZ-CD2 3.93Å; F63-F90 HydrophobicContact CZ-CD2 3.93Å; F63-F90 HydrophobicContact CZ-CG 4.21Å; I65-F90 HydrophobicContact CD1-CE1 3.6Å; I65-F90 HydrophobicContact CD1-CZ 3.63Å; I65-F90 HydrophobicContact CG1-CE1 4.49Å; I78-F90 HydrophobicContact CD1-CD1 3.78Å; I78-F90 HydrophobicContact CD1-CE1 4.33Å; I78-F90 HydrophobicContact CG1-CD1 4.16Å; I78-F90 HydrophobicContact CG2-CB 4.48Å; I78-F90 HydrophobicContact CG2-CD1 4Å; I78-F90 HydrophobicContact CG2-CG 4.5Å; D86-F90 PolarHBondContact O-N 3.22Å; D86-F90 VanDerWaalsContact O-N 3.13Å; A87-F90 PolarHBondContact O-N 3.03Å; A88-F90 VanDerWaalsContact C-N 3.33Å; A88-F90 PolarHBondContact O-N 2.84Å; F90-N92 VanDerWaalsContact C-N 3.35Å; F90-N92 PolarHBondContact O-N 3.29Å; F90-A93 PolarHBondContact O-N 2.94Å; F90-L94 HydrophobicContact CE1-CB 4.47Å; F90-L94 WeakPolarHBondContact O-CB 3.39Å; F90-L94 PolarHBondContact O-N 3Å
91	S	98.1	Very high	97	Very high	52 Å²	52	86.9 Å²	86.9	36%	0.364	46%	0.461	S	S	.	.	H	α-helix	trans	-58.2	-45.9	176.6	-174.3	0	0	0	0	112	A87 A88 A93 L94 Y95	A87-S91 WeakPolarHBondContact O-CB 3.29Å; A87-S91 PolarHBondContact O-N 3.44Å; A88-S91 WeakPolarHBondContact O-CB 3.43Å; A88-S91 PolarHBondContact O-N 2.59Å; S91-A93 VanDerWaalsContact C-N 3.34Å; S91-A93 PolarHBondContact O-N 2.74Å; S91-L94 PolarHBondContact O-N 2.94Å; S91-Y95 PolarHBondContact O-N 3.01Å
92	N	98.4	Very high	96.8	Very high	99 Å²	99	91.4 Å²	91.4	53%	0.529	47%	0.473	S	S	.	.	H	α-helix	trans	-62.8	-40.2	176.4	-71.5	-29.3	0	0	0	112.1	A88 A89 F90 K96	A88-N92 PolarHBondContact O-N 2.88Å; A88-N92 PolarHBondContact O-ND2 2.96Å; A89-N92 PolarHBondContact O-N 3.44Å; F90-N92 VanDerWaalsContact C-N 3.35Å; F90-N92 PolarHBondContact O-N 3.29Å; N92-K96 WeakPolarHBondContact O-CG 3.39Å; N92-K96 PolarHBondContact O-N 3.18Å; N92-K96 VanDerWaalsContact O-N 3.08Å
93	A	98.4	Very high	96.8	Very high	49 Å²	49	83.4 Å²	83.4	41%	0.405	45%	0.448	S	S	.	.	H	α-helix	trans	-67	-41	176.6	0	0	0	0	0	112.1	A89 F90 S91 K96 S97	A89-A93 PolarHBondContact O-N 3.1Å; F90-A93 PolarHBondContact O-N 2.94Å; S91-A93 VanDerWaalsContact C-N 3.34Å; S91-A93 PolarHBondContact O-N 2.74Å; A93-K96 PolarHBondContact O-N 3.47Å; A93-S97 WeakPolarHBondContact O-CB 3.48Å; A93-S97 PolarHBondContact O-N 2.88Å; A93-S97 PolarHBondContact O-OG 3.18Å
94	L	97.8	Very high	96.7	Very high	53 Å²	53	85.8 Å²	85.8	28%	0.277	45%	0.449	S	S	.	.	H	α-helix	trans	-60.3	-48.5	175.1	177	61.8	0	0	0	110.7	A76 I78 F90 S91 K96 S97 L98	A76-L94 HydrophobicContact CB-CD2 3.86Å; I78-L94 HydrophobicContact CD1-CD2 4.15Å; F90-L94 HydrophobicContact CE1-CB 4.47Å; F90-L94 WeakPolarHBondContact O-CB 3.39Å; F90-L94 PolarHBondContact O-N 3Å; S91-L94 PolarHBondContact O-N 2.94Å; L94-K96 PolarHBondContact O-N 2.97Å; L94-S97 PolarHBondContact O-N 3.15Å; L94-L98 HydrophobicContact CD1-CD1 4.13Å; L94-L98 HydrophobicContact CD1-CG 4.26Å; L94-L98 HydrophobicContact CG-CD1 4.1Å; L94-L98 WeakPolarHBondContact O-CG 3.41Å; L94-L98 PolarHBondContact O-N 2.85Å
95	Y	96.9	Very high	96.5	Very high	167 Å²	167	87.2 Å²	87.2	66%	0.655	46%	0.461	S	S	*	.	H	α-helix	trans	-58	-49.9	178.1	-177.1	-94.9	0	0	0	112	S91 S97 L98 D99	S91-Y95 PolarHBondContact O-N 3.01Å; Y95-S97 VanDerWaalsContact C-N 3.31Å; Y95-S97 PolarHBondContact O-N 3.49Å; Y95-L98 PolarHBondContact O-N 3.4Å; Y95-D99 PolarHBondContact O-N 3.02Å
96	K	97.9	Very high	96.1	Very high	140 Å²	140	87.7 Å²	87.7	61%	0.609	47%	0.471	S	S	*	.	H	α-helix	trans	-59.1	-41.5	176.8	-72.4	176	-179.3	-176.9	0	112.5	N92 A93 L94 D99 I100	N92-K96 WeakPolarHBondContact O-CG 3.39Å; N92-K96 PolarHBondContact O-N 3.18Å; N92-K96 VanDerWaalsContact O-N 3.08Å; A93-K96 PolarHBondContact O-N 3.47Å; L94-K96 PolarHBondContact O-N 2.97Å; K96-D99 PolarHBondContact O-N 3.03Å; K96-I100 VanDerWaalsContact O-CG1 3.32Å; K96-I100 WeakPolarHBondContact O-CG1 3.35Å; K96-I100 PolarHBondContact O-N 2.94Å
97	S	97.5	Very high	95.1	Very high	63 Å²	63	89.3 Å²	89.3	44%	0.441	48%	0.479	S	S	.	.	H	α-helix	trans	-64.5	-41.5	179.7	-56.8	0	0	0	0	111.5	A93 L94 Y95 I100 L101	A93-S97 WeakPolarHBondContact O-CB 3.48Å; A93-S97 PolarHBondContact O-N 2.88Å; A93-S97 PolarHBondContact O-OG 3.18Å; L94-S97 PolarHBondContact O-N 3.15Å; Y95-S97 VanDerWaalsContact C-N 3.31Å; Y95-S97 PolarHBondContact O-N 3.49Å; S97-I100 PolarHBondContact O-N 2.81Å; S97-L101 WeakPolarHBondContact O-CG 3.42Å; S97-L101 PolarHBondContact O-N 2.88Å
98	L	95.4	Very high	93.5	Very high	65 Å²	65	93.1 Å²	93.1	34%	0.34	50%	0.502	S	S	.	.	H	α-helix	trans	-66.8	-37.2	176.2	-69.3	170.5	0	0	0	112.2	L74 L94 Y95 L101 R102	L74-L98 HydrophobicContact CD2-CD1 3.65Å; L94-L98 HydrophobicContact CD1-CD1 4.13Å; L94-L98 HydrophobicContact CD1-CG 4.26Å; L94-L98 HydrophobicContact CG-CD1 4.1Å; L94-L98 WeakPolarHBondContact O-CG 3.41Å; L94-L98 PolarHBondContact O-N 2.85Å; Y95-L98 PolarHBondContact O-N 3.4Å; L98-L101 PolarHBondContact O-N 2.71Å; L98-R102 WeakPolarHBondContact O-CB 3.48Å; L98-R102 PolarHBondContact O-N 3.07Å
99	D	94.8	Very high	91.5	Very high	87 Å²	87	103.5 Å²	103.5	47%	0.465	54%	0.536	S	S	.	.	H	α-helix	trans	-67	-40.1	177.2	-160.2	46.6	0	0	0	111.9	Y95 K96 R102 G103	Y95-D99 PolarHBondContact O-N 3.02Å; K96-D99 PolarHBondContact O-N 3.03Å; D99-R102 WeakPolarHBondContact O-CB 3.33Å; D99-R102 PolarHBondContact O-N 2.81Å; D99-G103 PolarHBondContact O-N 3.08Å
100	I	96.4	Very high	91.2	Very high	101 Å²	101	106.2 Å²	106.2	52%	0.518	54%	0.542	S	S	.	.	H	α-helix	trans	-60	-48.6	171.7	-69.1	164.1	0	0	0	110.7	K96 S97 R102 G103 H104	K96-I100 VanDerWaalsContact O-CG1 3.32Å; K96-I100 WeakPolarHBondContact O-CG1 3.35Å; K96-I100 PolarHBondContact O-N 2.94Å; S97-I100 PolarHBondContact O-N 2.81Å; I100-R102 VanDerWaalsContact C-N 3.3Å; I100-R102 PolarHBondContact O-N 3.41Å; I100-G103 PolarHBondContact O-N 2.97Å; I100-H104 PolarHBondContact O-CD2 3.5Å; I100-H104 PolarHBondContact O-N 3.46Å; I100-H104 VanDerWaalsContact O-N 3.08Å
101	L	94.6	Very high	90.8	Very high	99 Å²	99	108.9 Å²	108.9	52%	0.518	56%	0.558	S	S	.	*	H	α-helix	trans	-59.9	-42.3	177.6	-71.9	172.4	0	0	0	111.5	S97 L98 H104 L105	S97-L101 WeakPolarHBondContact O-CG 3.42Å; S97-L101 PolarHBondContact O-N 2.88Å; L98-L101 PolarHBondContact O-N 2.71Å; L101-H104 PolarHBondContact O-N 3.49Å; L101-L105 WeakPolarHBondContact O-CB 3.36Å; L101-L105 VanDerWaalsContact O-CG 3.26Å; L101-L105 WeakPolarHBondContact O-CG 3.47Å; L101-L105 PolarHBondContact O-N 3.34Å
102	R	92.4	Very high	90.4	Very high	157 Å²	157	112.1 Å²	112.1	59%	0.592	57%	0.569	S	S	*	*	H	α-helix	trans	-60.1	-46	175.9	-178.2	-175.9	-179.7	-161.1	0	111.5	L98 D99 I100 H104 L105 L106	L98-R102 WeakPolarHBondContact O-CB 3.48Å; L98-R102 PolarHBondContact O-N 3.07Å; D99-R102 WeakPolarHBondContact O-CB 3.33Å; D99-R102 PolarHBondContact O-N 2.81Å; I100-R102 VanDerWaalsContact C-N 3.3Å; I100-R102 PolarHBondContact O-N 3.41Å; R102-H104 VanDerWaalsContact C-N 3.31Å; R102-H104 PolarHBondContact O-N 3.13Å; R102-L105 PolarHBondContact O-N 2.72Å; R102-L106 HydrophobicContact CG-CD1 3.57Å; R102-L106 HydrophobicContact CG-CG 4.18Å; R102-L106 WeakPolarHBondContact O-CB 3.44Å; R102-L106 PolarHBondContact O-N 3.46Å
103	G	94.1	Very high	89.9	Confident	34 Å²	34	112.9 Å²	112.9	35%	0.351	57%	0.571	S	S	.	*	H	α-helix	trans	-57.3	-44.2	176.8	0	0	0	0	0	112.2	D99 I100 L105 D107	D99-G103 PolarHBondContact O-N 3.08Å; I100-G103 PolarHBondContact O-N 2.97Å; G103-L105 PolarHBondContact O-N 3.26Å; G103-D107 PolarHBondContact O-N 2.89Å
104	H	93.9	Very high	89.4	Confident	141 Å²	141	116.9 Å²	116.9	65%	0.653	58%	0.582	S	S	*	*	H	α-helix	trans	-69.1	-30	177.6	-69.9	-54.5	0	0	0	114.6	I100 L101 R102	I100-H104 PolarHBondContact O-CD2 3.5Å; I100-H104 PolarHBondContact O-N 3.46Å; I100-H104 VanDerWaalsContact O-N 3.08Å; L101-H104 PolarHBondContact O-N 3.49Å; R102-H104 VanDerWaalsContact C-N 3.31Å; R102-H104 PolarHBondContact O-N 3.13Å
105	L	92.1	Very high	88.8	Confident	140 Å²	140	121.1 Å²	121.1	73%	0.733	60%	0.602	S	S	*	*	H	α-helix	trans	-84.3	-32.1	-178.6	-70.6	171.5	0	0	0	113.2	L101 R102 G103	L101-L105 WeakPolarHBondContact O-CB 3.36Å; L101-L105 VanDerWaalsContact O-CG 3.26Å; L101-L105 WeakPolarHBondContact O-CG 3.47Å; L101-L105 PolarHBondContact O-N 3.34Å; R102-L105 PolarHBondContact O-N 2.72Å; G103-L105 PolarHBondContact O-N 3.26Å
106	L	87.9	Confident	88.3	Confident	111 Å²	111	117.9 Å²	117.9	58%	0.581	60%	0.598	S	S	*	*	H	α-helix	trans	-101.5	-26.5	-173.6	-60.9	-177	0	0	0	113.9	R102 P108	R102-L106 HydrophobicContact CG-CD1 3.57Å; R102-L106 HydrophobicContact CG-CG 4.18Å; R102-L106 WeakPolarHBondContact O-CB 3.44Å; R102-L106 PolarHBondContact O-N 3.46Å; L106-P108 WeakPolarHBondContact O-CD 3.44Å
107	D	78.6	Confident	87.5	Confident	130 Å²	130	116.2 Å²	116.2	70%	0.695	60%	0.598	S	S	*	*	S	Bend	trans	-114.7	70.9	171.9	-70	-38.2	0	0	0	109.8	G103 K109	G103-D107 PolarHBondContact O-N 2.89Å; D107-K109 PolarHBondContact O-N 3.33Å; D107-K109 VanDerWaalsContact O-N 3.12Å
108	P	63.2	Low	86.7	Confident	103 Å²	103	120.6 Å²	120.6	67%	0.669	61%	0.611	S	S	*	*			trans	-63.3	118.4	173.1	27.1	-31.3	0	0	0	108.3	L106	L106-P108 WeakPolarHBondContact O-CD 3.44Å
109	K	57	Low	85.9	Confident	279 Å²	279	125.6 Å²	125.6	100%	1.213	64%	0.635	S	S	*	*			trans	-64.3	0	163.4	-72.8	-172.7	178.7	-177.7	0	110.5	D107	D107-K109 PolarHBondContact O-N 3.33Å; D107-K109 VanDerWaalsContact O-N 3.12Å

Retrieved 109 of 109 residues in 21.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).