A0A061HW90_CRIGR Loading...

Gem-associated protein 7

The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A forming an intermediate. Binding of snRNA inside 5Sm triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP.

AlphaFold DB , UniProt , Accession A0A061HW90, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Gemin7, Length 131 aa.

						>A0A061HW90_CRIGR|A0A061HW90|Gemin7
MQTPRTIPVPVPVLRLPRGPDGFSRGFAPDGRRALLRPKATEVGEGTQDPPEFQEQRARAALRERYLRSLLAMVGHPVSFTLHEGVHVTAQFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYSFKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.8	Very low	58.5	Low	241 Å²	241	151.8 Å²	151.8	100%	1.187	82%	0.823	S	S	*	*				0	93.2	0	-67.6	-67	-127	0	0	108.1
2	Q	44.7	Very low	58.4	Low	200 Å²	200	149.6 Å²	149.6	94%	0.935	82%	0.822	S	S	*	*	P	Polyproline II helix	trans	-93.9	121.2	-176.8	-136.2	170.4	18.3	0	0	108.5
3	T	47.2	Very low	58.9	Low	126 Å²	126	146.7 Å²	146.7	77%	0.773	81%	0.811	S	S	*	*	P	Polyproline II helix	trans	-75.5	132	179.3	47.4	0	0	0	0	110.6
4	P	53.9	Low	59.1	Low	123 Å²	123	147.6 Å²	147.6	80%	0.799	81%	0.813	S	S	*	*	P	Polyproline II helix	trans	-70.5	135.1	179.8	27.6	-31.5	0	0	0	110.9
5	R	62.7	Low	59.3	Low	246 Å²	246	151.8 Å²	151.8	93%	0.928	81%	0.812	S	S	*	*	P	Polyproline II helix	trans	-73	125.9	178.1	-71.9	-176.8	169.3	-173.7	-3.5	110.5
6	T	62.5	Low	59.4	Low	136 Å²	136	150.7 Å²	150.7	83%	0.834	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-72.4	122.4	177.6	-43.7	0	0	0	0	110.5
7	I	65.9	Low	59.6	Low	139 Å²	139	148.6 Å²	148.6	71%	0.713	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-80.5	122.2	174.7	-60.4	170.9	0	0	0	108	V9	I7-V9 VanDerWaalsContact C-N 3.32Å; I7-V9 PolarHBondContact O-N 3.33Å
8	P	62.7	Low	59.8	Low	126 Å²	126	150.7 Å²	150.7	82%	0.818	80%	0.796	S	S	*	*	S	Bend	trans	-78.3	-6.1	-168.1	27.7	-33.5	0	0	0	115.5
9	V	67.5	Low	60.1	Low	101 Å²	101	143.3 Å²	143.3	61%	0.612	76%	0.759	S	S	*	*	S	Bend	trans	-135.5	119.6	178.7	-174.7	0	0	0	0	109.5	I7 V11	I7-V9 VanDerWaalsContact C-N 3.32Å; I7-V9 PolarHBondContact O-N 3.33Å; V9-V11 PolarHBondContact O-N 2.91Å; V9-V11 VanDerWaalsContact O-N 3.14Å
10	P	65.6	Low	60.5	Low	119 Å²	119	143.2 Å²	143.2	77%	0.773	77%	0.767	S	S	*	*			trans	-68.1	113	176.3	25.5	-30	0	0	0	109.6
11	V	67.9	Low	60.7	Low	113 Å²	113	141 Å²	141	69%	0.685	76%	0.756	S	S	*	*			trans	-72.4	123.4	171.3	-179.1	0	0	0	0	107.7	V9 V13	V9-V11 PolarHBondContact O-N 2.91Å; V9-V11 VanDerWaalsContact O-N 3.14Å; V11-V13 PolarHBondContact O-N 3.11Å
12	P	57	Low	61.6	Low	125 Å²	125	130.9 Å²	130.9	81%	0.812	71%	0.713	S	S	*	*			trans	-66.3	102.9	174.8	26.3	-31.6	0	0	0	108.6	L14	P12-L14 PolarHBondContact O-N 2.93Å
13	V	65	Low	62.3	Low	112 Å²	112	130.7 Å²	130.7	68%	0.679	71%	0.709	S	S	*	*			trans	-78.3	102.8	172.1	-175.1	0	0	0	0	106.9	V11 R15	V11-V13 PolarHBondContact O-N 3.11Å; V13-R15 VanDerWaalsContact C-N 3.33Å; V13-R15 HydrophobicContact CG1-CG 4.35Å; V13-R15 PolarHBondContact O-N 2.85Å
14	L	61.5	Low	62.9	Low	159 Å²	159	126.6 Å²	126.6	83%	0.832	69%	0.686	S	S	*	*			trans	-63.2	98.9	167.4	-172.3	72.4	0	0	0	107.5	P12 L16	P12-L14 PolarHBondContact O-N 2.93Å; L14-L16 PolarHBondContact O-N 3.14Å
15	R	62.2	Low	63.2	Low	211 Å²	211	131.7 Å²	131.7	80%	0.796	69%	0.689	S	S	*	*			trans	-73.2	113.4	179.7	-68.8	-173	176.7	179.8	-1.3	107.9	V13	V13-R15 VanDerWaalsContact C-N 3.33Å; V13-R15 HydrophobicContact CG1-CG 4.35Å; V13-R15 PolarHBondContact O-N 2.85Å
16	L	62	Low	62.9	Low	134 Å²	134	122.2 Å²	122.2	70%	0.702	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-53.7	144.6	172.5	-65.1	175.5	0	0	0	110	L14 R18	L14-L16 PolarHBondContact O-N 3.14Å; L16-R18 PolarHBondContact O-N 2.81Å
17	P	61.7	Low	62.5	Low	116 Å²	116	123.8 Å²	123.8	75%	0.753	66%	0.664	S	S	*	*	P	Polyproline II helix	trans	-55.7	137	178.7	21	-30.8	0	0	0	110.4
18	R	63.7	Low	62.1	Low	186 Å²	186	120.1 Å²	120.1	70%	0.702	65%	0.654	S	S	*	*	P	Polyproline II helix	trans	-68.3	148.1	178.3	-62.5	-169.3	-178.2	173	0.1	109.7	L16 G22	L16-R18 PolarHBondContact O-N 2.81Å; R18-G22 VanDerWaalsContact CD-O 3.27Å; R18-G22 WeakPolarHBondContact CD-O 3.48Å
19	G	66.2	Low	61.6	Low	9 Å²	9	120.3 Å²	120.3	9%	0.093	66%	0.656	C	S	.	*	P	Polyproline II helix	trans	-62.8	168.1	173	0	0	0	0	0	112.3	D21 G22 S24	G19-D21 PolarHBondContact O-N 2.88Å; G19-G22 PolarHBondContact O-N 3.27Å; G19-S24 PolarHBondContact N-O 3.29Å
20	P	66.4	Low	61	Low	142 Å²	142	123 Å²	123	92%	0.922	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.8	-19.4	-170.9	22	-32.7	0	0	0	115.1
21	D	65.1	Low	60.5	Low	97 Å²	97	119.1 Å²	119.1	52%	0.519	65%	0.648	S	S	.	*	T	Hydrogen-bonded Turn	trans	-91.6	0.4	176.8	60.6	-3.7	0	0	0	113.6	G19 F23 S24	G19-D21 PolarHBondContact O-N 2.88Å; D21-F23 VanDerWaalsContact O-CD2 3.26Å; D21-F23 WeakPolarHBondContact O-CD2 3.43Å; D21-F23 PolarHBondContact O-N 2.86Å; D21-F23 VanDerWaalsContact O-N 3.14Å; D21-F23 PolarHBondContact OD1-N 3.19Å; D21-S24 VanDerWaalsContact CG-OG 3.28Å; D21-S24 WeakPolarHBondContact OD1-CB 3.36Å; D21-S24 PolarHBondContact OD1-N 3.29Å; D21-S24 PolarHBondContact OD1-OG 3.46Å; D21-S24 WeakPolarHBondContact OD2-CB 3.44Å; D21-S24 PolarHBondContact OD2-OG 2.75Å
22	G	61.6	Low	59.8	Low	28 Å²	28	125.2 Å²	125.2	29%	0.289	66%	0.659	S	S	.	*	S	Bend	trans	75.9	-7.2	176.4	0	0	0	0	0	115.6	R18 G19	R18-G22 VanDerWaalsContact CD-O 3.27Å; R18-G22 WeakPolarHBondContact CD-O 3.48Å; G19-G22 PolarHBondContact O-N 3.27Å
23	F	59.8	Low	59.7	Low	196 Å²	196	129.9 Å²	129.9	86%	0.86	66%	0.66	S	S	*	*	S	Bend	trans	-123.3	-22.5	-179.5	-61.5	-77.4	0	0	0	113.6	D21	D21-F23 VanDerWaalsContact O-CD2 3.26Å; D21-F23 WeakPolarHBondContact O-CD2 3.43Å; D21-F23 PolarHBondContact O-N 2.86Å; D21-F23 VanDerWaalsContact O-N 3.14Å; D21-F23 PolarHBondContact OD1-N 3.19Å
24	S	59.7	Low	59.1	Low	41 Å²	41	128.8 Å²	128.8	29%	0.287	66%	0.663	S	S	.	*	S	Bend	trans	-83.1	154.4	178.5	70.3	0	0	0	0	112.6	G19 D21 G26	G19-S24 PolarHBondContact N-O 3.29Å; D21-S24 VanDerWaalsContact CG-OG 3.28Å; D21-S24 WeakPolarHBondContact OD1-CB 3.36Å; D21-S24 PolarHBondContact OD1-N 3.29Å; D21-S24 PolarHBondContact OD1-OG 3.46Å; D21-S24 WeakPolarHBondContact OD2-CB 3.44Å; D21-S24 PolarHBondContact OD2-OG 2.75Å; S24-G26 VanDerWaalsContact C-N 3.25Å; S24-G26 PolarHBondContact O-N 3.47Å
25	R	60.9	Low	58.6	Low	229 Å²	229	128.4 Å²	128.4	86%	0.864	66%	0.661	S	S	*	*			trans	-87.2	27.5	175.9	-67.9	-173	176.4	-167.5	0.2	113.3	F27	R25-F27 WeakPolarHBondContact O-CD2 3.49Å; R25-F27 PolarHBondContact O-N 3.33Å
26	G	55.7	Low	58	Low	48 Å²	48	126.2 Å²	126.2	50%	0.495	66%	0.664	S	S	.	*	S	Bend	trans	65.9	2.4	175.7	0	0	0	0	0	116.4	S24	S24-G26 VanDerWaalsContact C-N 3.25Å; S24-G26 PolarHBondContact O-N 3.47Å
27	F	55.2	Low	57.4	Low	169 Å²	169	130.1 Å²	130.1	74%	0.741	67%	0.669	S	S	*	*			trans	-120.5	77.9	177.8	-69	-81.9	0	0	0	109.6	R25	R25-F27 WeakPolarHBondContact O-CD2 3.49Å; R25-F27 PolarHBondContact O-N 3.33Å
28	A	56.2	Low	56.7	Low	61 Å²	61	130.1 Å²	130.1	50%	0.504	67%	0.669	S	S	.	*			trans	-87.9	128.2	162.4	0	0	0	0	0	107.9	D30 G31	A28-D30 PolarHBondContact O-N 3.21Å; A28-G31 PolarHBondContact O-N 2.83Å; A28-G31 VanDerWaalsContact O-N 3.08Å
29	P	53	Low	55.6	Low	131 Å²	131	130.9 Å²	130.9	85%	0.851	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.7	-32.2	-179.8	23.8	-31.3	0	0	0	112
30	D	53.7	Low	54.6	Low	157 Å²	157	135 Å²	135	84%	0.84	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98	-0.3	175.5	-57.5	-34.9	0	0	0	113.1	A28 R32	A28-D30 PolarHBondContact O-N 3.21Å; D30-R32 PolarHBondContact O-N 3.36Å; D30-R32 VanDerWaalsContact O-N 3.07Å
31	G	55.2	Low	53.7	Low	38 Å²	38	134.7 Å²	134.7	39%	0.392	71%	0.707	S	S	.	*			trans	-71.4	106.1	178.4	0	0	0	0	0	109	A28 R33	A28-G31 PolarHBondContact O-N 2.83Å; A28-G31 VanDerWaalsContact O-N 3.08Å; G31-R33 PolarHBondContact O-N 3.28Å
32	R	54.5	Low	52.7	Low	241 Å²	241	138.6 Å²	138.6	91%	0.909	72%	0.722	S	S	*	*			trans	-47.4	109.3	164.4	-72.4	-176.2	175.6	-175.3	-1.1	107	D30 A34	D30-R32 PolarHBondContact O-N 3.36Å; D30-R32 VanDerWaalsContact O-N 3.07Å; R32-A34 VanDerWaalsContact C-N 3.33Å; R32-A34 PolarHBondContact O-N 3.29Å
33	R	53.7	Low	52.1	Low	223 Å²	223	144.2 Å²	144.2	84%	0.842	75%	0.75	S	S	*	*			trans	-52.6	106.7	169.5	-72.8	-179.6	174.9	175.2	-1.2	105	G31 L35	G31-R33 PolarHBondContact O-N 3.28Å; R33-L35 PolarHBondContact O-N 2.84Å
34	A	52.4	Low	51.3	Low	88 Å²	88	137.7 Å²	137.7	73%	0.727	74%	0.739	S	S	*	*			trans	-64.4	96.7	173.8	0	0	0	0	0	105.1	R32 L36	R32-A34 VanDerWaalsContact C-N 3.33Å; R32-A34 PolarHBondContact O-N 3.29Å; A34-L36 PolarHBondContact O-N 2.91Å
35	L	51.7	Low	50.8	Low	152 Å²	152	145.4 Å²	145.4	80%	0.796	77%	0.77	S	S	*	*			trans	-52.2	105.9	154.3	-106.2	133	0	0	0	103.5	R33 R37	R33-L35 PolarHBondContact O-N 2.84Å; L35-R37 PolarHBondContact O-N 3.2Å
36	L	48.9	Very low	50.4	Low	165 Å²	165	137.7 Å²	137.7	86%	0.864	76%	0.762	S	S	*	*			trans	-61.1	81.5	162.3	-74.8	166.6	0	0	0	105.3	A34 P38	A34-L36 PolarHBondContact O-N 2.91Å; L36-P38 VanDerWaalsContact O-CD 3.27Å; L36-P38 WeakPolarHBondContact O-CD 3.25Å
37	R	49.6	Very low	50.5	Low	215 Å²	215	141.8 Å²	141.8	81%	0.811	78%	0.777	S	S	*	*			trans	-64.2	115.7	160.4	-90.3	-174.6	172.5	169.7	-2.6	104.2	L35 K39	L35-R37 PolarHBondContact O-N 3.2Å; R37-K39 PolarHBondContact O-N 2.82Å
38	P	46.6	Very low	51.2	Low	116 Å²	116	141.6 Å²	141.6	75%	0.753	78%	0.779	S	S	*	*			trans	-55.7	136.7	164.9	23.5	-26.7	0	0	0	106.5	L36 A40	L36-P38 VanDerWaalsContact O-CD 3.27Å; L36-P38 WeakPolarHBondContact O-CD 3.25Å; P38-A40 PolarHBondContact O-N 2.87Å
39	K	40.8	Very low	52	Low	202 Å²	202	142.4 Å²	142.4	88%	0.878	77%	0.774	S	S	*	*			trans	-37.6	114.6	-178.5	-93.4	-175	169	-177	0	109.9	R37 T41	R37-K39 PolarHBondContact O-N 2.82Å; K39-T41 PolarHBondContact O-N 3.37Å
40	A	46.6	Very low	53.5	Low	95 Å²	95	140 Å²	140	79%	0.785	76%	0.759	S	S	*	*			trans	-60.4	105.1	172	0	0	0	0	0	107.7	P38	P38-A40 PolarHBondContact O-N 2.87Å
41	T	45.8	Very low	55	Low	137 Å²	137	137.3 Å²	137.3	84%	0.84	75%	0.75	S	S	*	*			trans	-83.6	138.8	151.2	-49.5	0	0	0	0	105.7	K39	K39-T41 PolarHBondContact O-N 3.37Å
42	E	46	Very low	56.7	Low	179 Å²	179	141.9 Å²	141.9	84%	0.836	76%	0.761	S	S	*	*	S	Bend	trans	-63.2	138	-158.8	-56.7	177.1	175.6	0	0	113.2
43	V	48.7	Very low	58.6	Low	146 Å²	146	135.5 Å²	135.5	89%	0.885	74%	0.74	S	S	*	*			trans	21.2	99.2	161	-167.2	0	0	0	0	117.1
44	G	41.7	Very low	60.4	Low	59 Å²	59	129.5 Å²	129.5	61%	0.608	72%	0.722	S	S	*	*			trans	-131.9	121.7	148.1	0	0	0	0	0	108.2	G46	G44-G46 PolarHBondContact O-N 2.88Å
45	E	49.4	Very low	62.4	Low	202 Å²	202	129.9 Å²	129.9	94%	0.944	71%	0.709	S	S	*	*	S	Bend	trans	-52.1	130.1	170.4	-66.5	178	146.9	0	0	109.7
46	G	53.1	Low	64.6	Low	67 Å²	67	127.1 Å²	127.1	69%	0.691	69%	0.692	S	S	*	*			trans	105.4	42.6	174.2	0	0	0	0	0	116.3	G44 Q48	G44-G46 PolarHBondContact O-N 2.88Å; G46-Q48 PolarHBondContact O-N 2.81Å
47	T	57.8	Low	66.8	Low	134 Å²	134	127.6 Å²	127.6	82%	0.822	68%	0.682	S	S	*	*			trans	-67.1	88.9	162.6	-45.5	0	0	0	0	108.5	D49	T47-D49 PolarHBondContact O-N 2.98Å
48	Q	68.9	Low	69.1	Low	165 Å²	165	119.8 Å²	119.8	77%	0.771	66%	0.664	S	S	*	*	P	Polyproline II helix	trans	-58.2	129.6	171.2	-67.5	-177.8	-27.2	0	0	107.8	G46	G46-Q48 PolarHBondContact O-N 2.81Å
49	D	73.4	Confident	71.5	Confident	78 Å²	78	120.2 Å²	120.2	42%	0.417	65%	0.65	S	S	.	*	P	Polyproline II helix	trans	-50.4	142.3	171.7	-75.4	-36.6	0	0	0	109	T47 F53 Q54	T47-D49 PolarHBondContact O-N 2.98Å; D49-F53 HydrophobicContact CB-CB 4.29Å; D49-F53 HydrophobicContact CB-CD1 3.58Å; D49-F53 HydrophobicContact CB-CE1 4.33Å; D49-F53 HydrophobicContact CB-CG 4.31Å; D49-F53 VanDerWaalsContact CG-CD1 3.43Å; D49-F53 WeakPolarHBondContact OD2-CD1 3.47Å; D49-F53 WeakPolarHBondContact OD2-CE1 3.43Å; D49-Q54 HydrophobicContact CB-CG 3.82Å; D49-Q54 PolarHBondContact O-NE2 2.87Å
50	P	83.9	Confident	74.2	Confident	81 Å²	81	113.4 Å²	113.4	53%	0.526	63%	0.631	S	S	.	*	P	Polyproline II helix	trans	-49.5	144.1	176.3	-22.4	29.8	0	0	0	110.4	E52 F53 Q54	P50-E52 PolarHBondContact O-N 2.83Å; P50-E52 VanDerWaalsContact O-N 3.12Å; P50-F53 WeakPolarHBondContact O-CA 3.46Å; P50-F53 WeakPolarHBondContact O-CB 3.47Å; P50-F53 PolarHBondContact O-N 2.86Å; P50-Q54 PolarHBondContact O-N 3.44Å
51	P	86.4	Confident	76.6	Confident	101 Å²	101	111.1 Å²	111.1	66%	0.656	61%	0.612	S	S	*	*	H	α-helix	trans	-54.8	-38.1	-175.8	20.8	-32.3	0	0	0	112.1	F53 Q54 E55	P51-F53 VanDerWaalsContact C-N 3.34Å; P51-F53 PolarHBondContact O-N 3.2Å; P51-Q54 PolarHBondContact O-N 2.93Å; P51-E55 WeakPolarHBondContact O-CG 3.48Å; P51-E55 PolarHBondContact O-N 3.09Å
52	E	91.4	Very high	79.1	Confident	134 Å²	134	110 Å²	110	63%	0.626	60%	0.601	S	S	*	*	H	α-helix	trans	-59.9	-40.3	174.8	-173.6	-178.5	-178.4	0	0	112.9	P50 E55 Q56	P50-E52 PolarHBondContact O-N 2.83Å; P50-E52 VanDerWaalsContact O-N 3.12Å; E52-E55 PolarHBondContact O-N 3.48Å; E52-Q56 VanDerWaalsContact O-CG 3.3Å; E52-Q56 WeakPolarHBondContact O-CG 3.25Å; E52-Q56 PolarHBondContact O-N 2.8Å
53	F	92.6	Very high	81.5	Confident	107 Å²	107	105.6 Å²	105.6	47%	0.469	58%	0.577	S	S	.	*	H	α-helix	trans	-66.6	-41.1	178.5	-177.3	-93.7	0	0	0	111.3	D49 P50 P51 Q56 R57	D49-F53 HydrophobicContact CB-CB 4.29Å; D49-F53 HydrophobicContact CB-CD1 3.58Å; D49-F53 HydrophobicContact CB-CE1 4.33Å; D49-F53 HydrophobicContact CB-CG 4.31Å; D49-F53 VanDerWaalsContact CG-CD1 3.43Å; D49-F53 WeakPolarHBondContact OD2-CD1 3.47Å; D49-F53 WeakPolarHBondContact OD2-CE1 3.43Å; P50-F53 WeakPolarHBondContact O-CA 3.46Å; P50-F53 WeakPolarHBondContact O-CB 3.47Å; P50-F53 PolarHBondContact O-N 2.86Å; P51-F53 VanDerWaalsContact C-N 3.34Å; P51-F53 PolarHBondContact O-N 3.2Å; F53-Q56 PolarHBondContact O-N 3.47Å; F53-R57 WeakPolarHBondContact O-CB 3.33Å; F53-R57 PolarHBondContact O-N 2.73Å
54	Q	92.3	Very high	83.8	Confident	96 Å²	96	103.1 Å²	103.1	45%	0.449	56%	0.555	S	S	.	*	H	α-helix	trans	-64	-42.1	175.5	-60.5	-173.4	23.1	0	0	111.3	D49 P50 P51 R57 A58	D49-Q54 HydrophobicContact CB-CG 3.82Å; D49-Q54 PolarHBondContact O-NE2 2.87Å; P50-Q54 PolarHBondContact O-N 3.44Å; P51-Q54 PolarHBondContact O-N 2.93Å; Q54-R57 PolarHBondContact O-N 3Å; Q54-A58 WeakPolarHBondContact O-CB 3.11Å; Q54-A58 PolarHBondContact O-N 2.89Å
55	E	95.1	Very high	86.5	Confident	97 Å²	97	108.9 Å²	108.9	45%	0.453	56%	0.558	S	S	.	*	H	α-helix	trans	-60.5	-45.6	174.6	-75	179.4	-164.1	0	0	112.2	P51 E52 R57 A58 R59	P51-E55 WeakPolarHBondContact O-CG 3.48Å; P51-E55 PolarHBondContact O-N 3.09Å; E52-E55 PolarHBondContact O-N 3.48Å; E55-R57 VanDerWaalsContact C-N 3.31Å; E55-R57 PolarHBondContact O-N 2.82Å; E55-A58 PolarHBondContact O-N 2.89Å; E55-R59 WeakPolarHBondContact O-CG 3.47Å; E55-R59 PolarHBondContact O-N 3.2Å; E55-R59 IonicContact OE2-CZ 3.91Å; E55-R59 IonicContact OE2-NH1 2.81Å; E55-R59 IonicContact OE2-NH2 3.67Å; E55-R59 PolarHBondContact OE2-NH2 2.74Å
56	Q	96.9	Very high	88.7	Confident	94 Å²	94	102.7 Å²	102.7	44%	0.439	53%	0.527	S	S	.	.	H	α-helix	trans	-64.2	-38.8	178.3	-67.5	-62.2	-3.3	0	0	111.6	E52 F53 R59 A60	E52-Q56 VanDerWaalsContact O-CG 3.3Å; E52-Q56 WeakPolarHBondContact O-CG 3.25Å; E52-Q56 PolarHBondContact O-N 2.8Å; F53-Q56 PolarHBondContact O-N 3.47Å; Q56-R59 VanDerWaalsContact CD-NH1 3.31Å; Q56-R59 PolarHBondContact O-N 3.3Å; Q56-A60 WeakPolarHBondContact O-CB 3.47Å; Q56-A60 PolarHBondContact O-N 2.8Å
57	R	96.5	Very high	90.6	Very high	174 Å²	174	103.1 Å²	103.1	66%	0.657	51%	0.513	S	S	*	.	H	α-helix	trans	-62.9	-42.7	173.9	-170.9	176.6	-173.5	137.5	2.7	111.7	F53 Q54 E55 A60 A61	F53-R57 WeakPolarHBondContact O-CB 3.33Å; F53-R57 PolarHBondContact O-N 2.73Å; Q54-R57 PolarHBondContact O-N 3Å; E55-R57 VanDerWaalsContact C-N 3.31Å; E55-R57 PolarHBondContact O-N 2.82Å; R57-A60 PolarHBondContact O-N 3.35Å; R57-A61 WeakPolarHBondContact O-CB 3.44Å; R57-A61 PolarHBondContact O-N 3.46Å
58	A	96.6	Very high	92.4	Very high	52 Å²	52	104.1 Å²	104.1	43%	0.43	50%	0.502	S	S	.	.	H	α-helix	trans	-63.8	-45.2	176	0	0	0	0	0	111.7	Q54 E55 A60 A61 L62	Q54-A58 WeakPolarHBondContact O-CB 3.11Å; Q54-A58 PolarHBondContact O-N 2.89Å; E55-A58 PolarHBondContact O-N 2.89Å; A58-A60 PolarHBondContact O-N 3.45Å; A58-A61 PolarHBondContact O-N 3.28Å; A58-L62 WeakPolarHBondContact O-CG 3.45Å; A58-L62 PolarHBondContact O-N 3.42Å
59	R	97.3	Very high	93.6	Very high	125 Å²	125	98.4 Å²	98.4	47%	0.472	48%	0.48	S	S	.	.	H	α-helix	trans	-58.4	-46	174.8	-72.2	176.4	-167.8	131.2	12.2	111.4	E55 Q56 L62 R63	E55-R59 WeakPolarHBondContact O-CG 3.47Å; E55-R59 PolarHBondContact O-N 3.2Å; E55-R59 IonicContact OE2-CZ 3.91Å; E55-R59 IonicContact OE2-NH1 2.81Å; E55-R59 IonicContact OE2-NH2 3.67Å; E55-R59 PolarHBondContact OE2-NH2 2.74Å; Q56-R59 VanDerWaalsContact CD-NH1 3.31Å; Q56-R59 PolarHBondContact O-N 3.3Å; R59-L62 PolarHBondContact O-N 3.35Å; R59-R63 VanDerWaalsContact O-CB 3.24Å; R59-R63 WeakPolarHBondContact O-CB 3.42Å; R59-R63 PolarHBondContact O-N 2.71Å
60	A	97.3	Very high	94.6	Very high	58 Å²	58	95.2 Å²	95.2	48%	0.479	46%	0.463	S	S	.	.	H	α-helix	trans	-61.6	-46.1	178.1	0	0	0	0	0	111.8	Q56 R57 A58 L62 R63 E64	Q56-A60 WeakPolarHBondContact O-CB 3.47Å; Q56-A60 PolarHBondContact O-N 2.8Å; R57-A60 PolarHBondContact O-N 3.35Å; A58-A60 PolarHBondContact O-N 3.45Å; A60-L62 PolarHBondContact O-N 3.12Å; A60-R63 PolarHBondContact O-N 2.8Å; A60-E64 WeakPolarHBondContact O-CB 3.5Å; A60-E64 PolarHBondContact O-N 3.01Å
61	A	97.9	Very high	95.1	Very high	47 Å²	47	97.7 Å²	97.7	39%	0.388	47%	0.471	S	S	.	.	H	α-helix	trans	-63.8	-41.7	178.8	0	0	0	0	0	112.7	R57 A58 R65	R57-A61 WeakPolarHBondContact O-CB 3.44Å; R57-A61 PolarHBondContact O-N 3.46Å; A58-A61 PolarHBondContact O-N 3.28Å; A61-R65 WeakPolarHBondContact O-CG 3.45Å; A61-R65 PolarHBondContact O-N 3.36Å; A61-R65 VanDerWaalsContact O-N 3.14Å
62	L	97.8	Very high	95.5	Very high	114 Å²	114	94.3 Å²	94.3	60%	0.597	45%	0.452	S	S	*	.	H	α-helix	trans	-64.5	-43.9	174.6	-71.8	172.6	0	0	0	111.3	A58 R59 A60 R65 Y66	A58-L62 WeakPolarHBondContact O-CG 3.45Å; A58-L62 PolarHBondContact O-N 3.42Å; R59-L62 PolarHBondContact O-N 3.35Å; A60-L62 PolarHBondContact O-N 3.12Å; L62-R65 PolarHBondContact O-N 2.86Å; L62-Y66 WeakPolarHBondContact O-CB 3.44Å; L62-Y66 PolarHBondContact O-N 3.29Å
63	R	96.3	Very high	95.6	Very high	87 Å²	87	88 Å²	88	33%	0.328	42%	0.422	S	S	.	.	H	α-helix	trans	-62.9	-43.2	178.2	-175.7	59.3	173.7	-177.3	-0.3	111.6	R59 A60 Y66 L67 L97	R59-R63 VanDerWaalsContact O-CB 3.24Å; R59-R63 WeakPolarHBondContact O-CB 3.42Å; R59-R63 PolarHBondContact O-N 2.71Å; A60-R63 PolarHBondContact O-N 2.8Å; R63-Y66 PolarHBondContact O-N 3.44Å; R63-L67 HydrophobicContact CG-CD1 4.17Å; R63-L67 HydrophobicContact CG-CG 4.37Å; R63-L67 WeakPolarHBondContact O-CB 3.48Å; R63-L67 VanDerWaalsContact O-CG 3.29Å; R63-L67 WeakPolarHBondContact O-CG 3.35Å; R63-L67 PolarHBondContact O-N 3.11Å; R63-L97 PolarHBondContact NH2-O 2.77Å
64	E	97.6	Very high	95.5	Very high	93 Å²	93	86.8 Å²	86.8	44%	0.435	42%	0.423	S	S	.	.	H	α-helix	trans	-59.3	-47.6	176.5	-178.7	-174.3	163.5	0	0	111.6	A60 Y66 L67 R68	A60-E64 WeakPolarHBondContact O-CB 3.5Å; A60-E64 PolarHBondContact O-N 3.01Å; E64-Y66 VanDerWaalsContact C-N 3.32Å; E64-Y66 PolarHBondContact O-N 2.81Å; E64-L67 PolarHBondContact O-N 2.85Å; E64-R68 WeakPolarHBondContact O-CG 3.39Å; E64-R68 PolarHBondContact O-N 3.27Å; E64-R68 IonicContact OE1-CZ 2.99Å; E64-R68 IonicContact OE1-NH1 2.66Å; E64-R68 PolarHBondContact OE1-NH1 3Å; E64-R68 IonicContact OE1-NH2 2.65Å; E64-R68 PolarHBondContact OE1-NH2 2.92Å
65	R	97.4	Very high	95.2	Very high	180 Å²	180	85.2 Å²	85.2	68%	0.679	43%	0.433	S	S	*	.	H	α-helix	trans	-61.4	-42.3	176.6	-70.5	175.2	67.3	-172.2	0.6	111.7	A61 L62 R68 S69	A61-R65 WeakPolarHBondContact O-CG 3.45Å; A61-R65 PolarHBondContact O-N 3.36Å; A61-R65 VanDerWaalsContact O-N 3.14Å; L62-R65 PolarHBondContact O-N 2.86Å; R65-R68 PolarHBondContact O-N 3.42Å; R65-S69 PolarHBondContact O-N 3.48Å
66	Y	95	Very high	95.1	Very high	73 Å²	73	83.4 Å²	83.4	29%	0.286	42%	0.424	S	S	.	.	H	α-helix	trans	-62.5	-48.1	176.5	176.6	-110.3	0	0	0	112	L62 R63 E64 R68 S69 L70 V99	L62-Y66 WeakPolarHBondContact O-CB 3.44Å; L62-Y66 PolarHBondContact O-N 3.29Å; R63-Y66 PolarHBondContact O-N 3.44Å; E64-Y66 VanDerWaalsContact C-N 3.32Å; E64-Y66 PolarHBondContact O-N 2.81Å; Y66-R68 VanDerWaalsContact C-N 3.33Å; Y66-R68 PolarHBondContact O-N 2.63Å; Y66-S69 WeakPolarHBondContact O-CA 3.4Å; Y66-S69 WeakPolarHBondContact O-CB 3.46Å; Y66-S69 PolarHBondContact O-N 3.4Å; Y66-S69 PolarHBondContact O-OG 2.97Å; Y66-L70 HydrophobicContact CD1-CD1 4.19Å; Y66-L70 HydrophobicContact CE1-CD1 3.75Å; Y66-L70 HydrophobicContact CE1-CG 4.34Å; Y66-L70 HydrophobicContact CE2-CD2 4.38Å; Y66-L70 PolarHBondContact O-N 3.4Å; Y66-L70 VanDerWaalsContact O-N 3.07Å; Y66-V99 HydrophobicContact CE1-CB 4.45Å; Y66-V99 HydrophobicContact CE1-CG2 3.74Å; Y66-V99 WeakPolarHBondContact OH-CG1 3.34Å
67	L	94.8	Very high	95	Very high	75 Å²	75	82.4 Å²	82.4	39%	0.393	43%	0.426	S	S	.	.	H	α-helix	trans	-61.2	-38.9	176.7	-68.7	176.9	0	0	0	112.5	R63 E64 S69 L70 L71	R63-L67 HydrophobicContact CG-CD1 4.17Å; R63-L67 HydrophobicContact CG-CG 4.37Å; R63-L67 WeakPolarHBondContact O-CB 3.48Å; R63-L67 VanDerWaalsContact O-CG 3.29Å; R63-L67 WeakPolarHBondContact O-CG 3.35Å; R63-L67 PolarHBondContact O-N 3.11Å; E64-L67 PolarHBondContact O-N 2.85Å; L67-S69 VanDerWaalsContact C-N 3.28Å; L67-S69 PolarHBondContact O-N 2.98Å; L67-L70 HydrophobicContact CD2-CD1 4.01Å; L67-L70 PolarHBondContact O-N 3.14Å; L67-L71 PolarHBondContact O-N 2.87Å
68	R	95.6	Very high	95.1	Very high	155 Å²	155	74.1 Å²	74.1	59%	0.585	40%	0.395	S	S	*	.	H	α-helix	trans	-62.4	-36.5	172.9	-76	-170.1	179.5	118.3	7.2	112.3	E64 R65 Y66 L71 A72	E64-R68 WeakPolarHBondContact O-CG 3.39Å; E64-R68 PolarHBondContact O-N 3.27Å; E64-R68 IonicContact OE1-CZ 2.99Å; E64-R68 IonicContact OE1-NH1 2.66Å; E64-R68 PolarHBondContact OE1-NH1 3Å; E64-R68 IonicContact OE1-NH2 2.65Å; E64-R68 PolarHBondContact OE1-NH2 2.92Å; R65-R68 PolarHBondContact O-N 3.42Å; Y66-R68 VanDerWaalsContact C-N 3.33Å; Y66-R68 PolarHBondContact O-N 2.63Å; R68-L71 PolarHBondContact O-N 3.34Å; R68-A72 WeakPolarHBondContact O-CB 3.4Å; R68-A72 PolarHBondContact O-N 3.34Å
69	S	94	Very high	95.1	Very high	45 Å²	45	74.1 Å²	74.1	32%	0.315	39%	0.392	S	S	.	.	H	α-helix	trans	-66.8	-37.4	176.2	78.9	0	0	0	0	112.4	R65 Y66 L67 A72 M73	R65-S69 PolarHBondContact O-N 3.48Å; Y66-S69 WeakPolarHBondContact O-CA 3.4Å; Y66-S69 WeakPolarHBondContact O-CB 3.46Å; Y66-S69 PolarHBondContact O-N 3.4Å; Y66-S69 PolarHBondContact O-OG 2.97Å; L67-S69 VanDerWaalsContact C-N 3.28Å; L67-S69 PolarHBondContact O-N 2.98Å; S69-A72 PolarHBondContact O-N 3.18Å; S69-M73 PolarHBondContact O-N 3.21Å
70	L	94	Very high	95.1	Very high	11 Å²	11	68.2 Å²	68.2	6%	0.058	37%	0.369	C	S	.	.	H	α-helix	trans	-63.1	-44.1	173	-62.1	172	0	0	0	111.8	Y66 L67 A72 M73 T95 V99	Y66-L70 HydrophobicContact CD1-CD1 4.19Å; Y66-L70 HydrophobicContact CE1-CD1 3.75Å; Y66-L70 HydrophobicContact CE1-CG 4.34Å; Y66-L70 HydrophobicContact CE2-CD2 4.38Å; Y66-L70 PolarHBondContact O-N 3.4Å; Y66-L70 VanDerWaalsContact O-N 3.07Å; L67-L70 HydrophobicContact CD2-CD1 4.01Å; L67-L70 PolarHBondContact O-N 3.14Å; L70-A72 VanDerWaalsContact C-N 3.26Å; L70-A72 PolarHBondContact O-N 3.25Å; L70-M73 HydrophobicContact CB-CE 4.32Å; L70-M73 HydrophobicContact CD2-CE 3.38Å; L70-M73 HydrophobicContact CG-CE 4.4Å; L70-M73 WeakPolarHBondContact O-CB 3.45Å; L70-M73 PolarHBondContact O-N 3.43Å; L70-T95 HydrophobicContact CD1-CG2 3.84Å; L70-T95 HydrophobicContact CD2-CG2 4.26Å; L70-T95 HydrophobicContact CG-CG2 4.45Å; L70-V99 HydrophobicContact CD1-CG2 3.82Å
71	L	93.6	Very high	95.1	Very high	133 Å²	133	67.2 Å²	67.2	70%	0.696	36%	0.357	S	S	*	.	H	α-helix	trans	-63	-36.3	177.2	-169.2	146.9	0	0	0	111.5	L67 R68 M73 V74	L67-L71 PolarHBondContact O-N 2.87Å; R68-L71 PolarHBondContact O-N 3.34Å; L71-M73 PolarHBondContact O-N 2.84Å; L71-V74 WeakPolarHBondContact O-CB 3.26Å; L71-V74 WeakPolarHBondContact O-CG2 3.1Å; L71-V74 PolarHBondContact O-N 2.96Å
72	A	94.6	Very high	95.1	Very high	31 Å²	31	66.2 Å²	66.2	26%	0.256	35%	0.345	S	S	.	.	H	α-helix	trans	-69	-19.9	178.2	0	0	0	0	0	113.7	R68 S69 L70 V74 H76 F129 L131	R68-A72 WeakPolarHBondContact O-CB 3.4Å; R68-A72 PolarHBondContact O-N 3.34Å; S69-A72 PolarHBondContact O-N 3.18Å; L70-A72 VanDerWaalsContact C-N 3.26Å; L70-A72 PolarHBondContact O-N 3.25Å; A72-V74 VanDerWaalsContact C-N 3.27Å; A72-V74 PolarHBondContact O-N 3.29Å; A72-H76 PolarHBondContact O-ND1 3.07Å; A72-H76 VanDerWaalsContact O-ND1 3.17Å; A72-F129 HydrophobicContact CB-CE2 4.34Å; A72-F129 HydrophobicContact CB-CZ 4.32Å; A72-L131 HydrophobicContact CB-CD2 3.53Å
73	M	94.3	Very high	95	Very high	0 Å²	0	65.8 Å²	65.8	0%	0	34%	0.34	C	S	.	.	T	Hydrogen-bonded Turn	trans	-71.3	-20.8	172.6	-71.6	-166.9	-72.2	0	0	113.5	S69 L70 L71 G75 H76 V78 F92 F102 Y127 F129	S69-M73 PolarHBondContact O-N 3.21Å; L70-M73 HydrophobicContact CB-CE 4.32Å; L70-M73 HydrophobicContact CD2-CE 3.38Å; L70-M73 HydrophobicContact CG-CE 4.4Å; L70-M73 WeakPolarHBondContact O-CB 3.45Å; L70-M73 PolarHBondContact O-N 3.43Å; L71-M73 PolarHBondContact O-N 2.84Å; M73-G75 PolarHBondContact O-N 3.45Å; M73-H76 WeakPolarHBondContact O-CB 3.4Å; M73-H76 PolarHBondContact O-N 2.88Å; M73-V78 HydrophobicContact CB-CG2 4.26Å; M73-V78 HydrophobicContact CG-CG2 4.32Å; M73-V78 HydrophobicContact SD-CG1 4.22Å; M73-V78 HydrophobicContact SD-CG2 3.97Å; M73-F92 HydrophobicContact CB-CB 4.24Å; M73-F92 HydrophobicContact CB-CD1 3.65Å; M73-F92 HydrophobicContact CB-CE1 4.12Å; M73-F92 HydrophobicContact CB-CG 3.92Å; M73-F92 HydrophobicContact CE-CD2 4.34Å; M73-F92 HydrophobicContact CE-CE2 4.1Å; M73-F92 HydrophobicContact CE-CZ 4.23Å; M73-F102 HydrophobicContact CE-CE1 4.21Å; M73-Y127 HydrophobicContact CE-CD2 4.33Å; M73-Y127 HydrophobicContact CE-CE2 3.73Å; M73-Y127 HydrophobicContact SD-CD2 3.69Å; M73-Y127 HydrophobicContact SD-CE2 3.55Å; M73-Y127 VanDerWaalsContact SD-CE2 3.55Å; M73-F129 HydrophobicContact CB-CD2 4.39Å; M73-F129 HydrophobicContact CB-CE2 4.29Å; M73-F129 HydrophobicContact CB-CZ 4.4Å; M73-F129 HydrophobicContact CG-CD1 3.38Å; M73-F129 HydrophobicContact CG-CD2 3.78Å; M73-F129 HydrophobicContact CG-CE1 3.25Å; M73-F129 HydrophobicContact CG-CE2 3.63Å; M73-F129 HydrophobicContact CG-CG 3.65Å; M73-F129 HydrophobicContact CG-CZ 3.37Å; M73-F129 HydrophobicContact SD-CD1 3.75Å; M73-F129 HydrophobicContact SD-CE1 3.91Å; M73-F129 HydrophobicContact SD-CG 4.33Å
74	V	90.1	Very high	94.8	Very high	82 Å²	82	70.3 Å²	70.3	50%	0.497	37%	0.365	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.2	128.5	-176.9	177.9	0	0	0	0	109.9	L71 A72 H76 F92	L71-V74 WeakPolarHBondContact O-CB 3.26Å; L71-V74 WeakPolarHBondContact O-CG2 3.1Å; L71-V74 PolarHBondContact O-N 2.96Å; A72-V74 VanDerWaalsContact C-N 3.27Å; A72-V74 PolarHBondContact O-N 3.29Å; V74-H76 VanDerWaalsContact C-N 3.27Å; V74-H76 PolarHBondContact O-N 3.43Å; V74-H76 PolarHBondContact O-ND1 3.28Å; V74-F92 HydrophobicContact CG2-CD1 4.04Å; V74-F92 HydrophobicContact CG2-CE1 3.86Å
75	G	85.5	Confident	94.4	Very high	63 Å²	63	68.4 Å²	68.4	65%	0.649	37%	0.37	S	S	*	.	T	Hydrogen-bonded Turn	trans	80	0.9	-178.9	0	0	0	0	0	115.3	M73	M73-G75 PolarHBondContact O-N 3.45Å
76	H	92.9	Very high	94.2	Very high	59 Å²	59	62.3 Å²	62.3	27%	0.273	35%	0.353	S	S	.	.	S	Bend	trans	-106	146.1	176.3	-63.3	80.9	0	0	0	111.4	A72 M73 V74 V78 Q91 F92 F129 K130	A72-H76 PolarHBondContact O-ND1 3.07Å; A72-H76 VanDerWaalsContact O-ND1 3.17Å; M73-H76 WeakPolarHBondContact O-CB 3.4Å; M73-H76 PolarHBondContact O-N 2.88Å; V74-H76 VanDerWaalsContact C-N 3.27Å; V74-H76 PolarHBondContact O-N 3.43Å; V74-H76 PolarHBondContact O-ND1 3.28Å; H76-V78 PolarHBondContact O-N 2.95Å; H76-Q91 VanDerWaalsContact C-OE1 3.27Å; H76-Q91 PolarHBondContact O-OE1 2.85Å; H76-F92 PolarHBondContact O-N 3.17Å; H76-F129 HydrophobicContact CB-CD2 4.29Å; H76-K130 PolarHBondContact CD2-O 3.27Å
77	P	95.9	Very high	94.3	Very high	74 Å²	74	65 Å²	65	48%	0.481	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.8	131.1	168.2	28.4	-32.4	0	0	0	109.3	T89 A90	P77-T89 HydrophobicContact CB-CG2 4.21Å; P77-A90 WeakPolarHBondContact CA-O 3.27Å
78	V	97.6	Very high	94.5	Very high	0 Å²	0	61.6 Å²	61.6	0%	0	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	129.6	179.7	-175.1	0	0	0	0	108.6	M73 H76 F80 T89 A90 F92 Y127 F129	M73-V78 HydrophobicContact CB-CG2 4.26Å; M73-V78 HydrophobicContact CG-CG2 4.32Å; M73-V78 HydrophobicContact SD-CG1 4.22Å; M73-V78 HydrophobicContact SD-CG2 3.97Å; H76-V78 PolarHBondContact O-N 2.95Å; V78-F80 HydrophobicContact CB-CE2 3.72Å; V78-F80 HydrophobicContact CB-CZ 3.87Å; V78-F80 HydrophobicContact CG1-CD2 4.28Å; V78-F80 HydrophobicContact CG1-CE1 4.01Å; V78-F80 HydrophobicContact CG1-CE2 3.69Å; V78-F80 HydrophobicContact CG1-CZ 3.53Å; V78-F80 WeakPolarHBondContact O-CD2 3.35Å; V78-F80 WeakPolarHBondContact O-CE2 3.08Å; V78-T89 WeakPolarHBondContact O-CA 3.41Å; V78-A90 PolarHBondContact N-O 3.38Å; V78-A90 PolarHBondContact O-N 3Å; V78-F92 HydrophobicContact CG2-CB 3.59Å; V78-F92 HydrophobicContact CG2-CG 4.47Å; V78-Y127 HydrophobicContact CG1-CD2 4.23Å; V78-F129 HydrophobicContact CB-CB 4.49Å; V78-F129 HydrophobicContact CG1-CB 4.49Å; V78-F129 HydrophobicContact CG2-CB 3.96Å
79	S	97.8	Very high	94.6	Very high	51 Å²	51	56.7 Å²	56.7	36%	0.357	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	128.9	173.3	-64.4	0	0	0	0	109.6	V88 T89 Y127 S128	S79-V88 CarbonylContact C-O 3.58Å; S79-V88 WeakPolarHBondContact CA-O 3.48Å; S79-T89 PolarHBondContact OG-OG1 3.3Å; S79-Y127 CarbonylContact O-C 3.59Å; S79-Y127 WeakPolarHBondContact O-CA 3.43Å; S79-S128 PolarHBondContact N-O 3.43Å; S79-S128 PolarHBondContact O-N 3.03Å
80	F	97.6	Very high	94.7	Very high	1 Å²	1	54.7 Å²	54.7	0%	0.004	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	135.9	178.6	-56.9	-95.8	0	0	0	109.8	V78 L82 H87 V88 A90 F102 V104 L119 I124 S126 Y127	V78-F80 HydrophobicContact CB-CE2 3.72Å; V78-F80 HydrophobicContact CB-CZ 3.87Å; V78-F80 HydrophobicContact CG1-CD2 4.28Å; V78-F80 HydrophobicContact CG1-CE1 4.01Å; V78-F80 HydrophobicContact CG1-CE2 3.69Å; V78-F80 HydrophobicContact CG1-CZ 3.53Å; V78-F80 WeakPolarHBondContact O-CD2 3.35Å; V78-F80 WeakPolarHBondContact O-CE2 3.08Å; F80-L82 HydrophobicContact CB-CD2 4.07Å; F80-H87 WeakPolarHBondContact O-CA 3.46Å; F80-V88 HydrophobicContact CB-CG2 3.79Å; F80-V88 HydrophobicContact CD2-CG2 4.34Å; F80-V88 HydrophobicContact CG-CG2 4.47Å; F80-V88 PolarHBondContact N-O 3.39Å; F80-V88 PolarHBondContact O-N 3.3Å; F80-A90 HydrophobicContact CE2-CB 4.35Å; F80-F102 HydrophobicContact CE1-CB 4.39Å; F80-F102 AromaticContact CE1-CD1 3.85Å; F80-F102 HydrophobicContact CE1-CD1 3.85Å; F80-F102 HydrophobicContact CE1-CE1 4.29Å; F80-F102 HydrophobicContact CE1-CG 4.04Å; F80-F102 HydrophobicContact CZ-CD1 4.17Å; F80-F102 HydrophobicContact CZ-CG 4.49Å; F80-V104 HydrophobicContact CE2-CG1 4.15Å; F80-V104 HydrophobicContact CZ-CG1 4.03Å; F80-L119 HydrophobicContact CB-CD1 4.42Å; F80-L119 HydrophobicContact CD1-CD1 4.07Å; F80-L119 HydrophobicContact CD2-CD1 3.79Å; F80-L119 HydrophobicContact CE1-CD1 4.28Å; F80-L119 HydrophobicContact CE2-CD1 4Å; F80-L119 HydrophobicContact CG-CD1 3.83Å; F80-L119 HydrophobicContact CZ-CD1 4.25Å; F80-I124 HydrophobicContact CD1-CD1 3.95Å; F80-I124 HydrophobicContact CD1-CG1 4.28Å; F80-I124 HydrophobicContact CD1-CG2 4.19Å; F80-I124 HydrophobicContact CE1-CD1 4.2Å; F80-S126 WeakPolarHBondContact CA-O 3.24Å; F80-Y127 HydrophobicContact CE1-CG 4.4Å
81	T	97.6	Very high	94.9	Very high	37 Å²	37	57.4 Å²	57.4	23%	0.227	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	116.8	165.8	-60.4	0	0	0	0	107.6	H87 I125 S126	T81-H87 PolarHBondContact OG1-CD2 3.38Å; T81-I125 HydrophobicContact CG2-CB 4.46Å; T81-I125 WeakPolarHBondContact O-CB 3.27Å; T81-I125 PolarHBondContact O-N 2.81Å; T81-S126 PolarHBondContact N-O 3.06Å; T81-S126 PolarHBondContact O-N 3.38Å
82	L	96.6	Very high	95	Very high	26 Å²	26	51.6 Å²	51.6	14%	0.136	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	176	178.5	-49.4	-178.5	0	0	0	110.4	F80 V86 V88 D123 I124 I125	F80-L82 HydrophobicContact CB-CD2 4.07Å; L82-V86 HydrophobicContact CB-CB 4.28Å; L82-V86 HydrophobicContact CD1-CG1 4.4Å; L82-V86 PolarHBondContact N-O 3.17Å; L82-V88 HydrophobicContact CD1-CG1 4.1Å; L82-V88 HydrophobicContact CD1-CG2 3.89Å; L82-V88 HydrophobicContact CD2-CG2 4.42Å; L82-V88 HydrophobicContact CG-CG2 4.09Å; L82-D123 VanDerWaalsContact CA-O 3.25Å; L82-D123 WeakPolarHBondContact CA-O 3.36Å; L82-D123 WeakPolarHBondContact CB-O 3.47Å; L82-D123 WeakPolarHBondContact CD2-O 3.46Å; L82-I124 HydrophobicContact CD2-CB 4.42Å; L82-I124 HydrophobicContact CD2-CG1 3.8Å; L82-I125 WeakPolarHBondContact O-CD1 3.38Å
83	H	95.4	Very high	95	Very high	105 Å²	105	52.3 Å²	52.3	49%	0.486	32%	0.315	S	S	.	.	G	3₁₀ helix	trans	-57.2	161.2	169.1	-74.2	-76.6	0	0	0	112.8	G85 V86 S122 D123	H83-G85 PolarHBondContact O-N 3.42Å; H83-V86 PolarHBondContact O-N 2.94Å; H83-S122 PolarHBondContact CD2-O 2.77Å; H83-S122 PolarHBondContact NE2-O 2.69Å; H83-D123 PolarHBondContact N-O 3.34Å
84	E	92.3	Very high	95	Very high	183 Å²	183	54.4 Å²	54.4	86%	0.855	33%	0.333	S	S	*	.	G	3₁₀ helix	trans	60.4	22.4	-176.8	-52.8	-54.8	138.9	0	0	114.7	V86	E84-V86 HydrophobicContact CB-CG2 4.42Å; E84-V86 PolarHBondContact O-N 2.62Å
85	G	88.8	Confident	95.2	Very high	53 Å²	53	52.1 Å²	52.1	55%	0.546	32%	0.319	S	S	.	.	G	3₁₀ helix	trans	69.7	17.4	178.1	0	0	0	0	0	113.8	H83 H87	H83-G85 PolarHBondContact O-N 3.42Å; G85-H87 PolarHBondContact O-CE1 3.36Å; G85-H87 VanDerWaalsContact O-CE1 3.29Å; G85-H87 PolarHBondContact O-ND1 3.03Å
86	V	95.1	Very high	95.6	Very high	52 Å²	52	51.1 Å²	51.1	32%	0.315	30%	0.299	S	S	.	.			trans	-76.9	127.6	179.5	-179.9	0	0	0	0	109.5	L82 H83 E84 V88	L82-V86 HydrophobicContact CB-CB 4.28Å; L82-V86 HydrophobicContact CD1-CG1 4.4Å; L82-V86 PolarHBondContact N-O 3.17Å; H83-V86 PolarHBondContact O-N 2.94Å; E84-V86 HydrophobicContact CB-CG2 4.42Å; E84-V86 PolarHBondContact O-N 2.62Å; V86-V88 HydrophobicContact CG1-CG1 3.94Å
87	H	96.9	Very high	95	Very high	128 Å²	128	54.8 Å²	54.8	59%	0.593	32%	0.32	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111.8	125.8	176.5	-63.6	74.5	0	0	0	108.7	F80 T81 G85	F80-H87 WeakPolarHBondContact O-CA 3.46Å; T81-H87 PolarHBondContact OG1-CD2 3.38Å; G85-H87 PolarHBondContact O-CE1 3.36Å; G85-H87 VanDerWaalsContact O-CE1 3.29Å; G85-H87 PolarHBondContact O-ND1 3.03Å
88	V	97.6	Very high	94.6	Very high	4 Å²	4	57.7 Å²	57.7	2%	0.024	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	150.9	179.4	-60.5	0	0	0	0	109.9	S79 F80 L82 V86 L107 Q108 T109 L119	S79-V88 CarbonylContact C-O 3.58Å; S79-V88 WeakPolarHBondContact CA-O 3.48Å; F80-V88 HydrophobicContact CB-CG2 3.79Å; F80-V88 HydrophobicContact CD2-CG2 4.34Å; F80-V88 HydrophobicContact CG-CG2 4.47Å; F80-V88 PolarHBondContact N-O 3.39Å; F80-V88 PolarHBondContact O-N 3.3Å; L82-V88 HydrophobicContact CD1-CG1 4.1Å; L82-V88 HydrophobicContact CD1-CG2 3.89Å; L82-V88 HydrophobicContact CD2-CG2 4.42Å; L82-V88 HydrophobicContact CG-CG2 4.09Å; V86-V88 HydrophobicContact CG1-CG1 3.94Å; V88-L107 HydrophobicContact CB-CD1 3.72Å; V88-L107 HydrophobicContact CG1-CD1 4.45Å; V88-L107 HydrophobicContact CG2-CD1 3.67Å; V88-Q108 WeakPolarHBondContact CA-O 3.48Å; V88-Q108 WeakPolarHBondContact CB-O 3.21Å; V88-T109 HydrophobicContact CG1-CG2 4.36Å; V88-L119 HydrophobicContact CG2-CD1 4.45Å
89	T	97.9	Very high	93.9	Very high	53 Å²	53	58.2 Å²	58.2	33%	0.325	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	138.4	174.3	-59.7	0	0	0	0	108.4	P77 V78 S79 Q108	P77-T89 HydrophobicContact CB-CG2 4.21Å; V78-T89 WeakPolarHBondContact O-CA 3.41Å; S79-T89 PolarHBondContact OG-OG1 3.3Å; T89-Q108 WeakPolarHBondContact O-CB 3.48Å; T89-Q108 PolarHBondContact O-N 3.5Å
90	A	97.6	Very high	93.2	Very high	3 Å²	3	57.8 Å²	57.8	3%	0.025	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.5	162.5	178.7	0	0	0	0	0	111.1	P77 V78 F80 V104 L107	P77-A90 WeakPolarHBondContact CA-O 3.27Å; V78-A90 PolarHBondContact N-O 3.38Å; V78-A90 PolarHBondContact O-N 3Å; F80-A90 HydrophobicContact CE2-CB 4.35Å; A90-V104 HydrophobicContact CB-CB 3.6Å; A90-V104 HydrophobicContact CB-CG1 4.18Å; A90-V104 HydrophobicContact CB-CG2 3.69Å; A90-L107 HydrophobicContact CB-CB 4.11Å; A90-L107 HydrophobicContact CB-CD1 3.72Å
91	Q	97	Very high	93.1	Very high	67 Å²	67	59.5 Å²	59.5	31%	0.313	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	123.8	170.2	-63.8	-71.4	38.7	0	0	109.5	H76 G93 V104 S105	H76-Q91 VanDerWaalsContact C-OE1 3.27Å; H76-Q91 PolarHBondContact O-OE1 2.85Å; Q91-G93 PolarHBondContact O-N 3.48Å; Q91-V104 VanDerWaalsContact O-CA 3.24Å; Q91-V104 WeakPolarHBondContact O-CA 3.49Å; Q91-V104 WeakPolarHBondContact O-CB 3.46Å; Q91-S105 PolarHBondContact N-O 3.39Å; Q91-S105 PolarHBondContact O-N 3.31Å
92	F	96.1	Very high	93	Very high	12 Å²	12	58 Å²	58	5%	0.053	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.1	122.9	177.3	177.6	-98.4	0	0	0	110.7	M73 V74 H76 V78 A94 T95 F102	M73-F92 HydrophobicContact CB-CB 4.24Å; M73-F92 HydrophobicContact CB-CD1 3.65Å; M73-F92 HydrophobicContact CB-CE1 4.12Å; M73-F92 HydrophobicContact CB-CG 3.92Å; M73-F92 HydrophobicContact CE-CD2 4.34Å; M73-F92 HydrophobicContact CE-CE2 4.1Å; M73-F92 HydrophobicContact CE-CZ 4.23Å; V74-F92 HydrophobicContact CG2-CD1 4.04Å; V74-F92 HydrophobicContact CG2-CE1 3.86Å; H76-F92 PolarHBondContact O-N 3.17Å; V78-F92 HydrophobicContact CG2-CB 3.59Å; V78-F92 HydrophobicContact CG2-CG 4.47Å; F92-A94 WeakPolarHBondContact CE2-O 3.15Å; F92-T95 HydrophobicContact CZ-CG2 4.11Å; F92-F102 AromaticContact CD2-CD1 3.94Å; F92-F102 HydrophobicContact CD2-CD1 3.94Å; F92-F102 AromaticContact CE2-CD1 3.64Å; F92-F102 HydrophobicContact CE2-CD1 3.64Å; F92-F102 HydrophobicContact CE2-CE1 4.13Å
93	G	93.6	Very high	93	Very high	45 Å²	45	62.2 Å²	62.2	46%	0.464	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	-63.7	173.4	0	0	0	0	0	111.4	Q91 Y103	Q91-G93 PolarHBondContact O-N 3.48Å; G93-Y103 WeakPolarHBondContact CA-O 3.41Å; G93-Y103 PolarHBondContact N-O 3.45Å
94	A	94.2	Very high	93.1	Very high	45 Å²	45	57.3 Å²	57.3	37%	0.372	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.9	169.9	-175.7	0	0	0	0	0	112.3	F92 Y103	F92-A94 WeakPolarHBondContact CE2-O 3.15Å; A94-Y103 HydrophobicContact CB-CD2 4.27Å; A94-Y103 PolarHBondContact N-O 3.08Å; A94-Y103 VanDerWaalsContact N-O 3.11Å; A94-Y103 PolarHBondContact O-N 3.42Å
95	T	95.2	Very high	93.3	Very high	34 Å²	34	49.9 Å²	49.9	21%	0.209	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	154.7	167.1	-173.8	0	0	0	0	109.3	L70 F92 V99 N101	L70-T95 HydrophobicContact CD1-CG2 3.84Å; L70-T95 HydrophobicContact CD2-CG2 4.26Å; L70-T95 HydrophobicContact CG-CG2 4.45Å; F92-T95 HydrophobicContact CZ-CG2 4.11Å; T95-V99 HydrophobicContact CG2-CG1 4.44Å; T95-V99 HydrophobicContact CG2-CG2 4.31Å; T95-V99 WeakPolarHBondContact OG1-CG1 3.29Å; T95-N101 VanDerWaalsContact CA-O 3.26Å; T95-N101 WeakPolarHBondContact CA-O 3.24Å; T95-N101 WeakPolarHBondContact CB-O 3.39Å; T95-N101 PolarHBondContact OG1-O 3.39Å
96	D	93	Very high	93.7	Very high	41 Å²	41	53.2 Å²	53.2	22%	0.219	30%	0.296	C	S	.	.			trans	-71.5	165.9	173.6	55	-3.9	0	0	0	111.7	D98 V99 A100 N101	D96-D98 PolarHBondContact O-N 2.9Å; D96-V99 PolarHBondContact O-N 2.93Å; D96-V99 VanDerWaalsContact OD1-C 3.26Å; D96-V99 WeakPolarHBondContact OD1-CA 3.49Å; D96-V99 PolarHBondContact OD1-N 3.33Å; D96-V99 VanDerWaalsContact OD1-N 3.12Å; D96-A100 PolarHBondContact OD1-N 3.06Å; D96-A100 WeakPolarHBondContact OD2-CB 3.36Å; D96-N101 PolarHBondContact N-O 2.86Å; D96-N101 PolarHBondContact OD1-N 2.93Å; D96-N101 PolarHBondContact OD2-N 2.98Å; D96-N101 PolarHBondContact OD2-ND2 3.36Å
97	L	80.6	Confident	93.9	Very high	137 Å²	137	51.1 Å²	51.1	72%	0.717	28%	0.283	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.9	-39.1	-175.1	-174.1	67.7	0	0	0	111.5	R63 V99	R63-L97 PolarHBondContact NH2-O 2.77Å; L97-V99 PolarHBondContact O-N 2.55Å
98	D	87.6	Confident	93.9	Very high	135 Å²	135	50.9 Å²	50.9	72%	0.722	28%	0.282	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.9	-3.6	-178.8	-58.6	-32.7	0	0	0	112.6	D96 A100	D96-D98 PolarHBondContact O-N 2.9Å; D98-A100 PolarHBondContact O-N 3.37Å
99	V	83.1	Confident	93.8	Very high	11 Å²	11	52.8 Å²	52.8	7%	0.067	29%	0.294	C	S	.	.	S	Bend	trans	54.4	38.5	-176.7	-163.1	0	0	0	0	112.4	Y66 L70 T95 D96 L97 N101 F102	Y66-V99 HydrophobicContact CE1-CB 4.45Å; Y66-V99 HydrophobicContact CE1-CG2 3.74Å; Y66-V99 WeakPolarHBondContact OH-CG1 3.34Å; L70-V99 HydrophobicContact CD1-CG2 3.82Å; T95-V99 HydrophobicContact CG2-CG1 4.44Å; T95-V99 HydrophobicContact CG2-CG2 4.31Å; T95-V99 WeakPolarHBondContact OG1-CG1 3.29Å; D96-V99 PolarHBondContact O-N 2.93Å; D96-V99 VanDerWaalsContact OD1-C 3.26Å; D96-V99 WeakPolarHBondContact OD1-CA 3.49Å; D96-V99 PolarHBondContact OD1-N 3.33Å; D96-V99 VanDerWaalsContact OD1-N 3.12Å; L97-V99 PolarHBondContact O-N 2.55Å; V99-N101 VanDerWaalsContact C-N 3.35Å; V99-F102 HydrophobicContact CG1-CE2 4Å; V99-F102 HydrophobicContact CG1-CZ 3.79Å
100	A	84.3	Confident	93.5	Very high	42 Å²	42	55.5 Å²	55.5	35%	0.347	31%	0.312	S	S	.	.			trans	-82.8	-15	171.5	0	0	0	0	0	111.7	D96 D98 C121	D96-A100 PolarHBondContact OD1-N 3.06Å; D96-A100 WeakPolarHBondContact OD2-CB 3.36Å; D98-A100 PolarHBondContact O-N 3.37Å; A100-C121 WeakPolarHBondContact O-CB 3.37Å; A100-C121 PolarHBondContact O-N 3.35Å
101	N	94.4	Very high	93.3	Very high	37 Å²	37	63.5 Å²	63.5	20%	0.198	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.2	146.5	-177	-54.9	-77.5	0	0	0	113.4	T95 D96 V99 L118 L119	T95-N101 VanDerWaalsContact CA-O 3.26Å; T95-N101 WeakPolarHBondContact CA-O 3.24Å; T95-N101 WeakPolarHBondContact CB-O 3.39Å; T95-N101 PolarHBondContact OG1-O 3.39Å; D96-N101 PolarHBondContact N-O 2.86Å; D96-N101 PolarHBondContact OD1-N 2.93Å; D96-N101 PolarHBondContact OD2-N 2.98Å; D96-N101 PolarHBondContact OD2-ND2 3.36Å; V99-N101 VanDerWaalsContact C-N 3.35Å; N101-L118 HydrophobicContact CB-CD1 3.72Å; N101-L118 HydrophobicContact CB-CG 4.26Å; N101-L119 CarbonylContact C-O 3.49Å; N101-L119 WeakPolarHBondContact CA-O 3.3Å
102	F	96.3	Very high	93.2	Very high	4 Å²	4	61.9 Å²	61.9	2%	0.018	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	118.4	175.6	-68.1	-104.8	0	0	0	109.7	M73 F80 F92 V99 V104 L118 L119 I124 Y127	M73-F102 HydrophobicContact CE-CE1 4.21Å; F80-F102 HydrophobicContact CE1-CB 4.39Å; F80-F102 AromaticContact CE1-CD1 3.85Å; F80-F102 HydrophobicContact CE1-CD1 3.85Å; F80-F102 HydrophobicContact CE1-CE1 4.29Å; F80-F102 HydrophobicContact CE1-CG 4.04Å; F80-F102 HydrophobicContact CZ-CD1 4.17Å; F80-F102 HydrophobicContact CZ-CG 4.49Å; F92-F102 AromaticContact CD2-CD1 3.94Å; F92-F102 HydrophobicContact CD2-CD1 3.94Å; F92-F102 AromaticContact CE2-CD1 3.64Å; F92-F102 HydrophobicContact CE2-CD1 3.64Å; F92-F102 HydrophobicContact CE2-CE1 4.13Å; V99-F102 HydrophobicContact CG1-CE2 4Å; V99-F102 HydrophobicContact CG1-CZ 3.79Å; F102-V104 HydrophobicContact CB-CG1 4.19Å; F102-L118 WeakPolarHBondContact O-CA 3.49Å; F102-L119 HydrophobicContact CB-CB 4.3Å; F102-L119 PolarHBondContact N-O 2.97Å; F102-L119 PolarHBondContact O-N 2.84Å; F102-I124 HydrophobicContact CD2-CD1 3.42Å; F102-I124 VanDerWaalsContact CD2-CD1 3.42Å; F102-I124 HydrophobicContact CE2-CD1 3.84Å; F102-I124 HydrophobicContact CG-CD1 4.14Å; F102-Y127 HydrophobicContact CE1-CD1 4.38Å; F102-Y127 HydrophobicContact CE1-CE1 4.28Å; F102-Y127 AromaticContact CZ-CD1 4Å; F102-Y127 HydrophobicContact CZ-CD1 4Å; F102-Y127 AromaticContact CZ-CE1 3.75Å; F102-Y127 HydrophobicContact CZ-CE1 3.75Å
103	Y	96.4	Very high	93.3	Very high	115 Å²	115	66.1 Å²	66.1	45%	0.451	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	116.4	172.3	-60.8	-95.4	0	0	0	107.9	G93 A94 L118	G93-Y103 WeakPolarHBondContact CA-O 3.41Å; G93-Y103 PolarHBondContact N-O 3.45Å; A94-Y103 HydrophobicContact CB-CD2 4.27Å; A94-Y103 PolarHBondContact N-O 3.08Å; A94-Y103 VanDerWaalsContact N-O 3.11Å; A94-Y103 PolarHBondContact O-N 3.42Å; Y103-L118 HydrophobicContact CD1-CD1 3.54Å; Y103-L118 HydrophobicContact CD2-CD1 4.05Å; Y103-L118 HydrophobicContact CE1-CD1 3.41Å; Y103-L118 VanDerWaalsContact CE1-CD1 3.41Å; Y103-L118 HydrophobicContact CE2-CD1 3.93Å; Y103-L118 HydrophobicContact CG-CD1 3.86Å
104	V	96.8	Very high	93.5	Very high	2 Å²	2	68.9 Å²	68.9	1%	0.012	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	148.6	-173.7	-57.6	0	0	0	0	111.1	F80 A90 Q91 F102 L107 A117 L119	F80-V104 HydrophobicContact CE2-CG1 4.15Å; F80-V104 HydrophobicContact CZ-CG1 4.03Å; A90-V104 HydrophobicContact CB-CB 3.6Å; A90-V104 HydrophobicContact CB-CG1 4.18Å; A90-V104 HydrophobicContact CB-CG2 3.69Å; Q91-V104 VanDerWaalsContact O-CA 3.24Å; Q91-V104 WeakPolarHBondContact O-CA 3.49Å; Q91-V104 WeakPolarHBondContact O-CB 3.46Å; F102-V104 HydrophobicContact CB-CG1 4.19Å; V104-L107 HydrophobicContact CG2-CB 4.27Å; V104-L107 HydrophobicContact CG2-CD1 4.41Å; V104-A117 HydrophobicContact CG2-CB 3.99Å; V104-A117 PolarHBondContact N-O 2.81Å; V104-A117 PolarHBondContact O-N 3.34Å; V104-L119 HydrophobicContact CG2-CD1 4.23Å; V104-L119 HydrophobicContact CG2-CG 4.2Å
105	S	97.3	Very high	93.6	Very high	28 Å²	28	70.1 Å²	70.1	20%	0.196	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	159.1	173	64	0	0	0	0	111	Q91 L107 A115 E116	Q91-S105 PolarHBondContact N-O 3.39Å; Q91-S105 PolarHBondContact O-N 3.31Å; S105-L107 VanDerWaalsContact C-N 3.27Å; S105-L107 PolarHBondContact O-N 2.89Å; S105-A115 CarbonylContact C-O 3.51Å; S105-A115 VanDerWaalsContact CA-O 3.25Å; S105-A115 WeakPolarHBondContact CA-O 3.26Å; S105-A115 WeakPolarHBondContact CB-O 3.33Å; S105-E116 WeakPolarHBondContact CB-OE1 3.47Å; S105-E116 WeakPolarHBondContact CB-OE2 3.39Å
106	Q	97.3	Very high	93.7	Very high	122 Å²	122	74.9 Å²	74.9	57%	0.57	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	52.5	45	-179.6	-57.1	176.5	56.5	0	0	112.4	Q108 V113 Q114 A115	Q106-Q108 PolarHBondContact O-N 2.84Å; Q106-Q108 VanDerWaalsContact O-N 3.09Å; Q106-V113 HydrophobicContact CB-CG1 4.49Å; Q106-Q114 CarbonylContact C-O 3.51Å; Q106-Q114 WeakPolarHBondContact CA-O 3.36Å; Q106-Q114 PolarHBondContact N-O 2.84Å; Q106-A115 PolarHBondContact N-O 2.9Å
107	L	97.8	Very high	93.9	Very high	9 Å²	9	73.6 Å²	73.6	5%	0.047	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.5	109.9	179.3	176.1	67	0	0	0	109.7	V88 A90 V104 S105 T109 V113 Q114 A117 L119	V88-L107 HydrophobicContact CB-CD1 3.72Å; V88-L107 HydrophobicContact CG1-CD1 4.45Å; V88-L107 HydrophobicContact CG2-CD1 3.67Å; A90-L107 HydrophobicContact CB-CB 4.11Å; A90-L107 HydrophobicContact CB-CD1 3.72Å; V104-L107 HydrophobicContact CG2-CB 4.27Å; V104-L107 HydrophobicContact CG2-CD1 4.41Å; S105-L107 VanDerWaalsContact C-N 3.27Å; S105-L107 PolarHBondContact O-N 2.89Å; L107-T109 HydrophobicContact CD2-CG2 4.2Å; L107-T109 HydrophobicContact CG-CG2 4.02Å; L107-T109 PolarHBondContact O-N 3.32Å; L107-V113 WeakPolarHBondContact O-CA 3.32Å; L107-Q114 HydrophobicContact CB-CB 4.34Å; L107-Q114 PolarHBondContact N-O 3.23Å; L107-Q114 PolarHBondContact O-N 3.25Å; L107-A117 HydrophobicContact CB-CB 4.06Å; L107-A117 HydrophobicContact CD2-CB 3.53Å; L107-A117 HydrophobicContact CG-CB 4.43Å; L107-L119 HydrophobicContact CD1-CD1 4.26Å; L107-L119 HydrophobicContact CD2-CD2 3.98Å
108	Q	97.8	Very high	94.7	Very high	122 Å²	122	71 Å²	71	57%	0.57	39%	0.394	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.9	111.1	177.8	-169.9	162.3	8.9	0	0	110	V88 T89 Q106 V113	V88-Q108 WeakPolarHBondContact CA-O 3.48Å; V88-Q108 WeakPolarHBondContact CB-O 3.21Å; T89-Q108 WeakPolarHBondContact O-CB 3.48Å; T89-Q108 PolarHBondContact O-N 3.5Å; Q106-Q108 PolarHBondContact O-N 2.84Å; Q106-Q108 VanDerWaalsContact O-N 3.09Å; Q108-V113 HydrophobicContact CG-CG2 4.46Å
109	T	95.4	Very high	95.2	Very high	44 Å²	44	65.3 Å²	65.3	27%	0.27	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	164.5	175	74.2	0	0	0	0	110	V88 L107 I111 G112	V88-T109 HydrophobicContact CG1-CG2 4.36Å; L107-T109 HydrophobicContact CD2-CG2 4.2Å; L107-T109 HydrophobicContact CG-CG2 4.02Å; L107-T109 PolarHBondContact O-N 3.32Å; T109-I111 PolarHBondContact O-N 3.12Å; T109-I111 VanDerWaalsContact O-N 3.11Å; T109-I111 PolarHBondContact OG1-N 3.46Å; T109-G112 WeakPolarHBondContact CA-O 3.41Å; T109-G112 PolarHBondContact N-O 2.93Å; T109-G112 PolarHBondContact O-N 3.19Å; T109-G112 VanDerWaalsContact O-O 3.12Å; T109-G112 PolarHBondContact OG1-N 3.14Å; T109-G112 PolarHBondContact OG1-O 3.37Å
110	P	91.6	Very high	95.8	Very high	111 Å²	111	71.1 Å²	71.1	72%	0.721	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.2	-24.5	176.3	-27	36.1	0	0	0	114.7
111	I	93.9	Very high	96.3	Very high	170 Å²	170	72.1 Å²	72.1	87%	0.872	39%	0.387	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.8	-20.3	-175.8	-51.8	174.7	0	0	0	111.1	T109	T109-I111 PolarHBondContact O-N 3.12Å; T109-I111 VanDerWaalsContact O-N 3.11Å; T109-I111 PolarHBondContact OG1-N 3.46Å
112	G	94.9	Very high	96.4	Very high	34 Å²	34	74 Å²	74	35%	0.351	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	159.9	-170.1	-179.2	0	0	0	0	0	113.3	T109	T109-G112 WeakPolarHBondContact CA-O 3.41Å; T109-G112 PolarHBondContact N-O 2.93Å; T109-G112 PolarHBondContact O-N 3.19Å; T109-G112 VanDerWaalsContact O-O 3.12Å; T109-G112 PolarHBondContact OG1-N 3.14Å; T109-G112 PolarHBondContact OG1-O 3.37Å
113	V	97.8	Very high	96.3	Very high	101 Å²	101	76 Å²	76	61%	0.612	42%	0.415	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.2	124.5	-179.1	-177.3	0	0	0	0	109.7	Q106 L107 Q108	Q106-V113 HydrophobicContact CB-CG1 4.49Å; L107-V113 WeakPolarHBondContact O-CA 3.32Å; Q108-V113 HydrophobicContact CG-CG2 4.46Å
114	Q	97.4	Very high	96.3	Very high	102 Å²	102	71.5 Å²	71.5	48%	0.477	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	123.7	171.4	-178.6	171.2	-34.2	0	0	109.3	Q106 L107 E116 A117	Q106-Q114 CarbonylContact C-O 3.51Å; Q106-Q114 WeakPolarHBondContact CA-O 3.36Å; Q106-Q114 PolarHBondContact N-O 2.84Å; L107-Q114 HydrophobicContact CB-CB 4.34Å; L107-Q114 PolarHBondContact N-O 3.23Å; L107-Q114 PolarHBondContact O-N 3.25Å; Q114-E116 WeakPolarHBondContact CG-O 3.16Å; Q114-E116 PolarHBondContact NE2-O 3.08Å; Q114-E116 PolarHBondContact O-N 2.96Å; Q114-A117 HydrophobicContact CG-CB 4.32Å
115	A	97.3	Very high	96.3	Very high	71 Å²	71	76.5 Å²	76.5	59%	0.587	42%	0.423	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-60.1	-46.8	-173.6	0	0	0	0	0	112.5	S105 Q106	S105-A115 CarbonylContact C-O 3.51Å; S105-A115 VanDerWaalsContact CA-O 3.25Å; S105-A115 WeakPolarHBondContact CA-O 3.26Å; S105-A115 WeakPolarHBondContact CB-O 3.33Å; Q106-A115 PolarHBondContact N-O 2.9Å
116	E	97.6	Very high	96.2	Very high	134 Å²	134	77.9 Å²	77.9	63%	0.626	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-136.9	136.3	179.2	-63.2	-61.2	151.3	0	0	109.4	S105 Q114	S105-E116 WeakPolarHBondContact CB-OE1 3.47Å; S105-E116 WeakPolarHBondContact CB-OE2 3.39Å; Q114-E116 WeakPolarHBondContact CG-O 3.16Å; Q114-E116 PolarHBondContact NE2-O 3.08Å; Q114-E116 PolarHBondContact O-N 2.96Å
117	A	97.3	Very high	96.2	Very high	14 Å²	14	75.4 Å²	75.4	12%	0.116	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147	153.7	-177.5	0	0	0	0	0	112.5	V104 L107 Q114	V104-A117 HydrophobicContact CG2-CB 3.99Å; V104-A117 PolarHBondContact N-O 2.81Å; V104-A117 PolarHBondContact O-N 3.34Å; L107-A117 HydrophobicContact CB-CB 4.06Å; L107-A117 HydrophobicContact CD2-CB 3.53Å; L107-A117 HydrophobicContact CG-CB 4.43Å; Q114-A117 HydrophobicContact CG-CB 4.32Å
118	L	97.1	Very high	96.1	Very high	84 Å²	84	78.5 Å²	78.5	44%	0.44	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	112.4	169.5	-174.3	71.4	0	0	0	108.3	N101 F102 Y103	N101-L118 HydrophobicContact CB-CD1 3.72Å; N101-L118 HydrophobicContact CB-CG 4.26Å; F102-L118 WeakPolarHBondContact O-CA 3.49Å; Y103-L118 HydrophobicContact CD1-CD1 3.54Å; Y103-L118 HydrophobicContact CD2-CD1 4.05Å; Y103-L118 HydrophobicContact CE1-CD1 3.41Å; Y103-L118 VanDerWaalsContact CE1-CD1 3.41Å; Y103-L118 HydrophobicContact CE2-CD1 3.93Å; Y103-L118 HydrophobicContact CG-CD1 3.86Å
119	L	96.8	Very high	96.1	Very high	14 Å²	14	75.2 Å²	75.2	7%	0.073	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	119.6	171.6	-61.2	176.5	0	0	0	109	F80 V88 N101 F102 V104 L107 I124	F80-L119 HydrophobicContact CB-CD1 4.42Å; F80-L119 HydrophobicContact CD1-CD1 4.07Å; F80-L119 HydrophobicContact CD2-CD1 3.79Å; F80-L119 HydrophobicContact CE1-CD1 4.28Å; F80-L119 HydrophobicContact CE2-CD1 4Å; F80-L119 HydrophobicContact CG-CD1 3.83Å; F80-L119 HydrophobicContact CZ-CD1 4.25Å; V88-L119 HydrophobicContact CG2-CD1 4.45Å; N101-L119 CarbonylContact C-O 3.49Å; N101-L119 WeakPolarHBondContact CA-O 3.3Å; F102-L119 HydrophobicContact CB-CB 4.3Å; F102-L119 PolarHBondContact N-O 2.97Å; F102-L119 PolarHBondContact O-N 2.84Å; V104-L119 HydrophobicContact CG2-CD1 4.23Å; V104-L119 HydrophobicContact CG2-CG 4.2Å; L107-L119 HydrophobicContact CD1-CD1 4.26Å; L107-L119 HydrophobicContact CD2-CD2 3.98Å; L119-I124 HydrophobicContact CB-CD1 3.86Å; L119-I124 HydrophobicContact CB-CG1 4.31Å
120	R	96.2	Very high	96	Very high	133 Å²	133	81.9 Å²	81.9	50%	0.502	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	145.7	176.8	-58.4	172.6	-64.2	176.5	6.4	109.4	S122 D123	R120-S122 PolarHBondContact O-N 3.07Å; R120-D123 IonicContact CZ-OD1 3.63Å; R120-D123 IonicContact CZ-OD2 3.3Å; R120-D123 VanDerWaalsContact CZ-OD2 3.3Å; R120-D123 IonicContact NE-OD1 2.77Å; R120-D123 IonicContact NE-OD2 3.7Å; R120-D123 PolarHBondContact NE-OD2 2.65Å; R120-D123 VanDerWaalsContact NH2-CG 3.34Å; R120-D123 IonicContact NH2-OD1 2.91Å; R120-D123 PolarHBondContact NH2-OD1 2.66Å; R120-D123 IonicContact NH2-OD2 2.93Å; R120-D123 PolarHBondContact NH2-OD2 2.91Å; R120-D123 WeakPolarHBondContact O-CB 3.44Å; R120-D123 PolarHBondContact O-N 2.9Å
121	C	95.1	Very high	95.9	Very high	63 Å²	63	85 Å²	85	43%	0.426	46%	0.46	S	S	.	.	G	3₁₀ helix	trans	-60.4	-29.7	176.9	-175.2	0	0	0	0	111.8	A100 D123 I124	A100-C121 WeakPolarHBondContact O-CB 3.37Å; A100-C121 PolarHBondContact O-N 3.35Å; C121-D123 PolarHBondContact O-N 2.98Å; C121-I124 PolarHBondContact O-N 2.94Å
122	S	95.7	Very high	96	Very high	78 Å²	78	80.8 Å²	80.8	55%	0.545	44%	0.44	S	S	.	.	G	3₁₀ helix	trans	-64.8	-21.6	174.5	60.5	0	0	0	0	113.8	H83 R120	H83-S122 PolarHBondContact CD2-O 2.77Å; H83-S122 PolarHBondContact NE2-O 2.69Å; R120-S122 PolarHBondContact O-N 3.07Å
123	D	95.4	Very high	96.1	Very high	46 Å²	46	83.2 Å²	83.2	25%	0.246	44%	0.444	C	S	.	.	G	3₁₀ helix	trans	-93.2	-15.5	-177.9	-55.8	-27.4	0	0	0	111.5	L82 H83 R120 C121	L82-D123 VanDerWaalsContact CA-O 3.25Å; L82-D123 WeakPolarHBondContact CA-O 3.36Å; L82-D123 WeakPolarHBondContact CB-O 3.47Å; L82-D123 WeakPolarHBondContact CD2-O 3.46Å; H83-D123 PolarHBondContact N-O 3.34Å; R120-D123 IonicContact CZ-OD1 3.63Å; R120-D123 IonicContact CZ-OD2 3.3Å; R120-D123 VanDerWaalsContact CZ-OD2 3.3Å; R120-D123 IonicContact NE-OD1 2.77Å; R120-D123 IonicContact NE-OD2 3.7Å; R120-D123 PolarHBondContact NE-OD2 2.65Å; R120-D123 VanDerWaalsContact NH2-CG 3.34Å; R120-D123 IonicContact NH2-OD1 2.91Å; R120-D123 PolarHBondContact NH2-OD1 2.66Å; R120-D123 IonicContact NH2-OD2 2.93Å; R120-D123 PolarHBondContact NH2-OD2 2.91Å; R120-D123 WeakPolarHBondContact O-CB 3.44Å; R120-D123 PolarHBondContact O-N 2.9Å; C121-D123 PolarHBondContact O-N 2.98Å
124	I	96.1	Very high	96	Very high	20 Å²	20	82.2 Å²	82.2	10%	0.103	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	126.4	-172.5	-59.6	164.9	0	0	0	110	F80 L82 F102 L119 C121 S126	F80-I124 HydrophobicContact CD1-CD1 3.95Å; F80-I124 HydrophobicContact CD1-CG1 4.28Å; F80-I124 HydrophobicContact CD1-CG2 4.19Å; F80-I124 HydrophobicContact CE1-CD1 4.2Å; L82-I124 HydrophobicContact CD2-CB 4.42Å; L82-I124 HydrophobicContact CD2-CG1 3.8Å; F102-I124 HydrophobicContact CD2-CD1 3.42Å; F102-I124 VanDerWaalsContact CD2-CD1 3.42Å; F102-I124 HydrophobicContact CE2-CD1 3.84Å; F102-I124 HydrophobicContact CG-CD1 4.14Å; L119-I124 HydrophobicContact CB-CD1 3.86Å; L119-I124 HydrophobicContact CB-CG1 4.31Å; C121-I124 PolarHBondContact O-N 2.94Å; I124-S126 WeakPolarHBondContact CG2-O 3.36Å
125	I	96.4	Very high	95.9	Very high	106 Å²	106	81.1 Å²	81.1	54%	0.544	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.2	-44.5	170.8	-59.7	175.9	0	0	0	109.9	T81 L82	T81-I125 HydrophobicContact CG2-CB 4.46Å; T81-I125 WeakPolarHBondContact O-CB 3.27Å; T81-I125 PolarHBondContact O-N 2.81Å; L82-I125 WeakPolarHBondContact O-CD1 3.38Å
126	S	96.1	Very high	95.8	Very high	57 Å²	57	81.7 Å²	81.7	40%	0.399	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.5	162.5	179.6	65.7	0	0	0	0	111.6	F80 T81 I124	F80-S126 WeakPolarHBondContact CA-O 3.24Å; T81-S126 PolarHBondContact N-O 3.06Å; T81-S126 PolarHBondContact O-N 3.38Å; I124-S126 WeakPolarHBondContact CG2-O 3.36Å
127	Y	96.1	Very high	95.7	Very high	71 Å²	71	78.2 Å²	78.2	28%	0.278	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.6	152.3	171.6	64.2	-90	0	0	0	110.7	M73 V78 S79 F80 F102	M73-Y127 HydrophobicContact CE-CD2 4.33Å; M73-Y127 HydrophobicContact CE-CE2 3.73Å; M73-Y127 HydrophobicContact SD-CD2 3.69Å; M73-Y127 HydrophobicContact SD-CE2 3.55Å; M73-Y127 VanDerWaalsContact SD-CE2 3.55Å; V78-Y127 HydrophobicContact CG1-CD2 4.23Å; S79-Y127 CarbonylContact O-C 3.59Å; S79-Y127 WeakPolarHBondContact O-CA 3.43Å; F80-Y127 HydrophobicContact CE1-CG 4.4Å; F102-Y127 HydrophobicContact CE1-CD1 4.38Å; F102-Y127 HydrophobicContact CE1-CE1 4.28Å; F102-Y127 AromaticContact CZ-CD1 4Å; F102-Y127 HydrophobicContact CZ-CD1 4Å; F102-Y127 AromaticContact CZ-CE1 3.75Å; F102-Y127 HydrophobicContact CZ-CE1 3.75Å
128	S	96.7	Very high	95.6	Very high	74 Å²	74	82.8 Å²	82.8	52%	0.517	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.8	148.4	178.7	62.1	0	0	0	0	111.1	S79	S79-S128 PolarHBondContact N-O 3.43Å; S79-S128 PolarHBondContact O-N 3.03Å
129	F	96.5	Very high	95.4	Very high	53 Å²	53	82.7 Å²	82.7	23%	0.232	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.5	161.4	178	73.8	-73.2	0	0	0	109.7	A72 M73 H76 V78 L131	A72-F129 HydrophobicContact CB-CE2 4.34Å; A72-F129 HydrophobicContact CB-CZ 4.32Å; M73-F129 HydrophobicContact CB-CD2 4.39Å; M73-F129 HydrophobicContact CB-CE2 4.29Å; M73-F129 HydrophobicContact CB-CZ 4.4Å; M73-F129 HydrophobicContact CG-CD1 3.38Å; M73-F129 HydrophobicContact CG-CD2 3.78Å; M73-F129 HydrophobicContact CG-CE1 3.25Å; M73-F129 HydrophobicContact CG-CE2 3.63Å; M73-F129 HydrophobicContact CG-CG 3.65Å; M73-F129 HydrophobicContact CG-CZ 3.37Å; M73-F129 HydrophobicContact SD-CD1 3.75Å; M73-F129 HydrophobicContact SD-CE1 3.91Å; M73-F129 HydrophobicContact SD-CG 4.33Å; H76-F129 HydrophobicContact CB-CD2 4.29Å; V78-F129 HydrophobicContact CB-CB 4.49Å; V78-F129 HydrophobicContact CG1-CB 4.49Å; V78-F129 HydrophobicContact CG2-CB 3.96Å; F129-L131 HydrophobicContact CE2-CD2 3.51Å; F129-L131 HydrophobicContact CE2-CG 3.83Å; F129-L131 HydrophobicContact CZ-CD2 3.99Å; F129-L131 HydrophobicContact CZ-CG 4.23Å
130	K	95.1	Very high	95.3	Very high	184 Å²	184	88.4 Å²	88.4	80%	0.8	46%	0.459	S	S	*	.			trans	-101.5	131.3	174.2	-65.2	-177.2	-180	177.7	0	108.6	H76	H76-K130 PolarHBondContact CD2-O 3.27Å
131	L	88.6	Confident	95.2	Very high	176 Å²	176	84.4 Å²	84.4	92%	0.921	46%	0.456	S	S	*	.			trans	-79.7	0	169.2	-72.1	165.7	0	0	0	111.2	A72 F129	A72-L131 HydrophobicContact CB-CD2 3.53Å; F129-L131 HydrophobicContact CE2-CD2 3.51Å; F129-L131 HydrophobicContact CE2-CG 3.83Å; F129-L131 HydrophobicContact CZ-CD2 3.99Å; F129-L131 HydrophobicContact CZ-CG 4.23Å

Retrieved 131 of 131 residues in 58.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).