A0A061HWL7_CRIGR Loading...

Transcription elongation factor A (SII)-like 8

AlphaFold DB , UniProt , Accession A0A061HWL7, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Tceal8, Length 117 aa.

						>A0A061HWL7_CRIGR|A0A061HWL7|Tceal8
MQKSCDENEGTPQNTPKADEGHPSEDTPQQAGGNLQASGESVGEEADGSLRAEPAQPSPEPKEDTPTRHLNPEEVIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.1	Low	55.6	Low	238 Å²	238	152.2 Å²	152.2	100%	1.172	83%	0.826	S	S	*	*				0	131.4	0	-65.6	-178.1	74.7	0	0	108.2
2	Q	60.6	Low	55.6	Low	193 Å²	193	149.2 Å²	149.2	90%	0.902	82%	0.82	S	S	*	*			trans	-55.3	146.3	-169.7	-75.1	143.5	-53.6	0	0	113.9
3	K	58.5	Low	55.6	Low	201 Å²	201	152.1 Å²	152.1	87%	0.874	82%	0.824	S	S	*	*			trans	-110	98.6	155.5	-54.3	-86	-176.3	171.6	0	104.5	C5	K3-C5 PolarHBondContact O-N 3.27Å
4	S	59.7	Low	55.6	Low	101 Å²	101	150.6 Å²	150.6	71%	0.706	82%	0.815	S	S	*	*			trans	-70.4	118.3	170	46.2	0	0	0	0	107.5	D6	S4-D6 PolarHBondContact O-N 3.31Å
5	C	51.5	Low	55.1	Low	125 Å²	125	148.4 Å²	148.4	85%	0.845	81%	0.809	S	S	*	*			trans	-78.4	104.4	164.3	-64.6	0	0	0	0	106.1	K3 E7	K3-C5 PolarHBondContact O-N 3.27Å; C5-E7 PolarHBondContact O-N 3.14Å
6	D	55.3	Low	54.9	Low	147 Å²	147	146.1 Å²	146.1	79%	0.786	80%	0.804	S	S	*	*			trans	-56.8	122.4	165.8	-92.8	-64.4	0	0	0	108.8	S4 N8	S4-D6 PolarHBondContact O-N 3.31Å; D6-N8 PolarHBondContact O-N 3.42Å; D6-N8 VanDerWaalsContact O-N 3.14Å
7	E	56.8	Low	54.6	Low	166 Å²	166	149.3 Å²	149.3	78%	0.776	81%	0.808	S	S	*	*			trans	-64.3	101.4	172.3	-173.3	162.1	88.4	0	0	108.1	C5 E9	C5-E7 PolarHBondContact O-N 3.14Å; E7-E9 VanDerWaalsContact C-N 3.32Å; E7-E9 HydrophobicContact CG-CG 4.01Å; E7-E9 PolarHBondContact O-N 2.92Å
8	N	56.9	Low	54.3	Low	151 Å²	151	146.2 Å²	146.2	81%	0.807	81%	0.806	S	S	*	*			trans	-83.1	88.3	163.9	53.7	18.6	0	0	0	108	D6 G10	D6-N8 PolarHBondContact O-N 3.42Å; D6-N8 VanDerWaalsContact O-N 3.14Å; N8-G10 VanDerWaalsContact C-N 3.32Å; N8-G10 PolarHBondContact O-N 2.98Å
9	E	50.1	Low	54	Low	161 Å²	161	145.8 Å²	145.8	75%	0.752	80%	0.803	S	S	*	*			trans	-54	99.6	164.3	-66.6	-166.1	106.2	0	0	108.6	E7 T11	E7-E9 VanDerWaalsContact C-N 3.32Å; E7-E9 HydrophobicContact CG-CG 4.01Å; E7-E9 PolarHBondContact O-N 2.92Å; E9-T11 PolarHBondContact O-N 2.86Å
10	G	52.2	Low	53.8	Low	70 Å²	70	148 Å²	148	72%	0.722	81%	0.806	S	S	*	*			trans	-64.3	102.5	171	0	0	0	0	0	108	N8 P12	N8-G10 VanDerWaalsContact C-N 3.32Å; N8-G10 PolarHBondContact O-N 2.98Å; G10-P12 WeakPolarHBondContact O-CD 2.95Å; G10-P12 VanDerWaalsContact O-N 3.14Å
11	T	57.4	Low	53.1	Low	121 Å²	121	143.2 Å²	143.2	74%	0.742	79%	0.792	S	S	*	*			trans	-53.1	117.7	165.3	-49.6	0	0	0	0	108.1	E9 Q13	E9-T11 PolarHBondContact O-N 2.86Å; T11-Q13 PolarHBondContact O-N 2.96Å
12	P	55.3	Low	53	Low	116 Å²	116	139.9 Å²	139.9	75%	0.753	77%	0.773	S	S	*	*			trans	-70.4	101	165.1	28.2	-29.1	0	0	0	106.7	G10 N14	G10-P12 WeakPolarHBondContact O-CD 2.95Å; G10-P12 VanDerWaalsContact O-N 3.14Å; P12-N14 PolarHBondContact O-N 3.2Å
13	Q	56	Low	52.2	Low	187 Å²	187	136.7 Å²	136.7	87%	0.874	77%	0.769	S	S	*	*			trans	-67.6	80.3	160.8	-81	-166.2	10	0	0	108.3	T11	T11-Q13 PolarHBondContact O-N 2.96Å
14	N	55.2	Low	51.6	Low	131 Å²	131	132.4 Å²	132.4	70%	0.701	76%	0.764	S	S	*	*			trans	-140.4	76.1	158.8	-157.9	-100.9	0	0	0	109.1	P12 P16	P12-N14 PolarHBondContact O-N 3.2Å; N14-P16 WeakPolarHBondContact O-CD 3.21Å
15	T	48.8	Very low	50.6	Low	118 Å²	118	135.8 Å²	135.8	72%	0.724	77%	0.769	S	S	*	*			trans	-78	120.1	151	50.6	0	0	0	0	107	K17	T15-K17 PolarHBondContact O-N 2.83Å
16	P	51.2	Low	49.9	Very low	112 Å²	112	137.1 Å²	137.1	73%	0.727	77%	0.768	S	S	*	*			trans	-63.3	117.8	151.3	26.6	-27.3	0	0	0	105.6	N14 A18	N14-P16 WeakPolarHBondContact O-CD 3.21Å; P16-A18 PolarHBondContact O-N 2.85Å
17	K	49.1	Very low	49.4	Very low	200 Å²	200	134.9 Å²	134.9	87%	0.87	76%	0.76	S	S	*	*			trans	-61	107.5	167.4	-79	-162.1	174	-172.3	0	106.6	T15 D19	T15-K17 PolarHBondContact O-N 2.83Å; K17-D19 PolarHBondContact O-N 3.29Å
18	A	50.4	Low	48.7	Very low	93 Å²	93	132.6 Å²	132.6	77%	0.769	76%	0.759	S	S	*	*			trans	-62.7	118.4	159.3	0	0	0	0	0	107.1	P16	P16-A18 PolarHBondContact O-N 2.85Å
19	D	47.5	Very low	48.1	Very low	140 Å²	140	134.3 Å²	134.3	75%	0.749	76%	0.763	S	S	*	*			trans	4.9	124.5	145.2	-165.1	25.7	0	0	0	118	K17	K17-D19 PolarHBondContact O-N 3.29Å
20	E	51.3	Low	48	Very low	188 Å²	188	136.2 Å²	136.2	88%	0.879	77%	0.771	S	S	*	*				-179.6	105	119.6	-101.7	175.1	137.7	0	0	109.2
21	G	39.1	Very low	47.2	Very low	49 Å²	49	136.8 Å²	136.8	51%	0.505	77%	0.769	S	S	.	*			trans	-169	49.5	-176	0	0	0	0	0	113
22	H	50	Low	46.6	Very low	167 Å²	167	135 Å²	135	77%	0.773	78%	0.775	S	S	*	*			trans	35.6	105	150.8	41.1	-93.8	0	0	0	117.7	S24	H22-S24 PolarHBondContact O-N 2.97Å
23	P	43.8	Very low	45.9	Very low	127 Å²	127	133.1 Å²	133.1	83%	0.825	78%	0.777	S	S	*	*			trans	-74	106	143.4	29.3	-21	0	0	0	106.6	E25	P23-E25 PolarHBondContact O-N 3.39Å; P23-E25 VanDerWaalsContact O-N 3.14Å
24	S	45.6	Very low	44.7	Very low	110 Å²	110	131.5 Å²	131.5	77%	0.769	77%	0.774	S	S	*	*			trans	-46.2	121.2	165.2	-176.4	0	0	0	0	108.4	H22 D26	H22-S24 PolarHBondContact O-N 2.97Å; S24-D26 PolarHBondContact O-N 2.82Å
25	E	39.3	Very low	44.1	Very low	173 Å²	173	133.4 Å²	133.4	81%	0.808	78%	0.783	S	S	*	*			trans	-56.5	106.4	167.2	-65.7	177.6	105.6	0	0	107.5	P23 T27	P23-E25 PolarHBondContact O-N 3.39Å; P23-E25 VanDerWaalsContact O-N 3.14Å; E25-T27 PolarHBondContact O-N 2.99Å; E25-T27 PolarHBondContact O-OG1 3.08Å
26	D	36	Very low	43.6	Very low	153 Å²	153	136.7 Å²	136.7	82%	0.818	79%	0.791	S	S	*	*			trans	-70.6	87.7	167	-155.8	-41.8	0	0	0	106.6	S24	S24-D26 PolarHBondContact O-N 2.82Å
27	T	44.9	Very low	42.9	Very low	100 Å²	100	135.2 Å²	135.2	61%	0.613	79%	0.788	S	S	*	*			trans	-70.5	124	167.7	-43.3	0	0	0	0	105.6	E25 Q29	E25-T27 PolarHBondContact O-N 2.99Å; E25-T27 PolarHBondContact O-OG1 3.08Å; T27-Q29 PolarHBondContact O-N 2.74Å
28	P	43.8	Very low	42.8	Very low	118 Å²	118	131.5 Å²	131.5	77%	0.766	79%	0.787	S	S	*	*			trans	-64.2	106.2	169.7	-6.9	19.2	0	0	0	107.2	Q30	P28-Q30 PolarHBondContact O-N 3.05Å
29	Q	43	Very low	41.9	Very low	187 Å²	187	130.6 Å²	130.6	87%	0.874	79%	0.786	S	S	*	*			trans	-55.5	102	172.6	-102.1	178	-24	0	0	108.8	T27 A31	T27-Q29 PolarHBondContact O-N 2.74Å; Q29-A31 PolarHBondContact O-N 3.35Å; Q29-A31 VanDerWaalsContact O-N 3.14Å
30	Q	47.6	Very low	41.5	Very low	200 Å²	200	133.1 Å²	133.1	94%	0.935	79%	0.794	S	S	*	*			trans	-75.8	93.4	161.4	-152.1	-165.1	38.6	0	0	107.7	P28	P28-Q30 PolarHBondContact O-N 3.05Å
31	A	36.1	Very low	40.6	Very low	83 Å²	83	129.6 Å²	129.6	69%	0.686	79%	0.79	S	S	*	*			trans	-150.6	106.4	160.4	0	0	0	0	0	105.5	Q29	Q29-A31 PolarHBondContact O-N 3.35Å; Q29-A31 VanDerWaalsContact O-N 3.14Å
32	G	44.8	Very low	40.7	Very low	84 Å²	84	134.4 Å²	134.4	87%	0.866	81%	0.809	S	S	*	*				71.4	66.5	53.3	0	0	0	0	0	109.7
33	G	40.3	Very low	40	Very low	76 Å²	76	129.5 Å²	129.5	78%	0.784	80%	0.803	S	S	*	*			trans	101.3	102.7	156.7	0	0	0	0	0	116.8
34	N	31.9	Very low	39.9	Very low	153 Å²	153	131.6 Å²	131.6	82%	0.818	80%	0.802	S	S	*	*				-159.2	110.5	125.5	-157.9	-43.7	0	0	0	109.8	Q36	N34-Q36 PolarHBondContact O-N 3.3Å
35	L	41.9	Very low	39.8	Very low	171 Å²	171	134.7 Å²	134.7	90%	0.895	81%	0.805	S	S	*	*			trans	-72.1	111.8	167.2	-75.4	164.7	0	0	0	108.2	A37	L35-A37 PolarHBondContact O-N 3.28Å
36	Q	37	Very low	39.6	Very low	187 Å²	187	131 Å²	131	87%	0.874	80%	0.804	S	S	*	*			trans	-73.7	109.9	171.8	-167.1	178.3	-72.7	0	0	110.1	N34	N34-Q36 PolarHBondContact O-N 3.3Å
37	A	36.8	Very low	40.2	Very low	81 Å²	81	131.9 Å²	131.9	67%	0.669	81%	0.808	S	S	*	*			trans	64.8	116.5	143.5	0	0	0	0	0	120.2	L35	L35-A37 PolarHBondContact O-N 3.28Å
38	S	47.4	Very low	39.8	Very low	122 Å²	122	130.1 Å²	130.1	85%	0.853	81%	0.81	S	S	*	*				70.3	96.8	121.2	-164.4	0	0	0	0	117.4
39	G	31.7	Very low	40.3	Very low	73 Å²	73	129.8 Å²	129.8	75%	0.753	81%	0.81	S	S	*	*			trans	-175.1	75.9	167.2	0	0	0	0	0	110.1	S41	G39-S41 PolarHBondContact O-N 2.95Å
40	E	39	Very low	40.3	Very low	193 Å²	193	128.5 Å²	128.5	90%	0.902	81%	0.809	S	S	*	*			trans	-63	109.8	164.8	29	173.5	114.9	0	0	109.8
41	S	32.6	Very low	40.7	Very low	115 Å²	115	130.8 Å²	130.8	80%	0.804	81%	0.809	S	S	*	*			trans	-159.2	122.1	146.5	56.3	0	0	0	0	111.7	G39	G39-S41 PolarHBondContact O-N 2.95Å
42	V	41.8	Very low	41.5	Very low	150 Å²	150	130.9 Å²	130.9	91%	0.909	81%	0.81	S	S	*	*			trans	-68.3	140.4	166	165.9	0	0	0	0	109.1
43	G	35.7	Very low	42.3	Very low	63 Å²	63	134.1 Å²	134.1	65%	0.649	80%	0.802	S	S	*	*			trans	167.9	80.9	170.3	0	0	0	0	0	114
44	E	39.7	Very low	43.2	Very low	172 Å²	172	135.9 Å²	135.9	80%	0.804	80%	0.8	S	S	*	*				35.8	126.2	124.5	-76.5	178.1	145.7	0	0	120.8
45	E	43.8	Very low	44.6	Very low	175 Å²	175	132.8 Å²	132.8	82%	0.818	80%	0.796	S	S	*	*			trans	66.8	119	146.4	-47.7	-61.7	125.8	0	0	119.7
46	A	35.9	Very low	45.8	Very low	95 Å²	95	132.6 Å²	132.6	79%	0.785	79%	0.79	S	S	*	*				172.9	118.6	118.5	0	0	0	0	0	111.6
47	D	48.9	Very low	47	Very low	171 Å²	171	129.2 Å²	129.2	91%	0.914	79%	0.785	S	S	*	*			trans	-44.5	129.8	158.2	-179.8	28.3	0	0	0	111.9
48	G	36.4	Very low	48.4	Very low	63 Å²	63	130.2 Å²	130.2	65%	0.649	79%	0.787	S	S	*	*			trans	-170.4	71.9	-170	0	0	0	0	0	112.9	L50	G48-L50 PolarHBondContact O-N 3.48Å; G48-L50 VanDerWaalsContact O-N 3.14Å
49	S	54.3	Low	49.2	Very low	111 Å²	111	129.9 Å²	129.9	78%	0.776	78%	0.782	S	S	*	*			trans	-11.4	102.9	158.5	166.3	0	0	0	0	115.4
50	L	43.4	Very low	50.7	Low	160 Å²	160	134.7 Å²	134.7	84%	0.838	78%	0.784	S	S	*	*			trans	-142.7	95.3	152.4	-68.9	-179.4	0	0	0	109.3	G48 A52	G48-L50 PolarHBondContact O-N 3.48Å; G48-L50 VanDerWaalsContact O-N 3.14Å; L50-A52 PolarHBondContact O-N 3.21Å
51	R	55.7	Low	52.1	Low	248 Å²	248	131.2 Å²	131.2	94%	0.936	78%	0.779	S	S	*	*			trans	-63.4	78.6	160.2	-115.2	-80.4	-171.1	179.9	0.4	107.6	E53	R51-E53 PolarHBondContact O-N 3Å
52	A	53.3	Low	53.8	Low	86 Å²	86	135 Å²	135	71%	0.711	78%	0.781	S	S	*	*			trans	-80.1	98.7	169.6	0	0	0	0	0	107.8	L50	L50-A52 PolarHBondContact O-N 3.21Å
53	E	60.1	Low	54.9	Low	152 Å²	152	136.1 Å²	136.1	71%	0.71	78%	0.776	S	S	*	*			trans	-55.9	124.6	163.3	-172.2	-155.5	144.3	0	0	108.5	R51 A55	R51-E53 PolarHBondContact O-N 3Å; E53-A55 PolarHBondContact O-N 3.18Å
54	P	59.6	Low	56.4	Low	112 Å²	112	140.1 Å²	140.1	73%	0.727	78%	0.783	S	S	*	*			trans	-69.4	105.5	172.8	26.3	-28.9	0	0	0	107.8	Q56	P54-Q56 PolarHBondContact O-N 3.2Å; P54-Q56 VanDerWaalsContact O-N 3.16Å
55	A	62.6	Low	57.8	Low	89 Å²	89	136 Å²	136	74%	0.736	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-48.7	122.9	172.4	0	0	0	0	0	109.3	E53	E53-A55 PolarHBondContact O-N 3.18Å
56	Q	65.8	Low	59	Low	167 Å²	167	132.4 Å²	132.4	78%	0.78	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-51.3	139.9	176.6	-72.9	-85.2	-72.9	0	0	110.5	P54 S58	P54-Q56 PolarHBondContact O-N 3.2Å; P54-Q56 VanDerWaalsContact O-N 3.16Å; Q56-S58 PolarHBondContact O-N 3.06Å
57	P	63	Low	60.4	Low	116 Å²	116	133.3 Å²	133.3	75%	0.753	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-60.8	129.8	174.6	25.9	-32.3	0	0	0	109.2
58	S	65.7	Low	61.5	Low	102 Å²	102	135.8 Å²	135.8	71%	0.713	75%	0.753	S	S	*	*	P	Polyproline II helix	trans	-51	136.3	172.2	177.9	0	0	0	0	109.2	Q56 E60	Q56-S58 PolarHBondContact O-N 3.06Å; S58-E60 PolarHBondContact O-N 3.05Å; S58-E60 VanDerWaalsContact O-N 3.13Å
59	P	63.8	Low	63.2	Low	115 Å²	115	140.2 Å²	140.2	75%	0.747	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-56.8	124.6	173.9	22.2	-30.1	0	0	0	108.7
60	E	63.7	Low	64.2	Low	173 Å²	173	140.5 Å²	140.5	81%	0.808	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-51.3	139.1	175.6	-66	-178.9	158.5	0	0	109.2	S58 K62	S58-E60 PolarHBondContact O-N 3.05Å; S58-E60 VanDerWaalsContact O-N 3.13Å; E60-K62 PolarHBondContact O-N 2.99Å
61	P	68.9	Low	66.1	Low	121 Å²	121	136.6 Å²	136.6	79%	0.786	73%	0.729	S	S	*	*			trans	-59.9	110	176.2	25.3	-31.4	0	0	0	107.3	E63	P61-E63 PolarHBondContact O-N 3.45Å
62	K	68.6	Low	67.4	Low	195 Å²	195	128.3 Å²	128.3	85%	0.848	71%	0.707	S	S	*	*			trans	-56.1	110	171.5	-67.2	176.6	-178.1	178.1	0	105.7	E60 D64	E60-K62 PolarHBondContact O-N 2.99Å; K62-D64 PolarHBondContact O-N 3.45Å
63	E	63.9	Low	68.7	Low	173 Å²	173	130 Å²	130	81%	0.808	70%	0.7	S	S	*	*			trans	-66.5	85.2	175.6	-165.6	148.1	154.7	0	0	107.5	P61 T65	P61-E63 PolarHBondContact O-N 3.45Å; E63-T65 VanDerWaalsContact CG-OG1 3.26Å; E63-T65 WeakPolarHBondContact CG-OG1 3.5Å; E63-T65 PolarHBondContact O-N 2.83Å
64	D	67.4	Low	69.6	Low	147 Å²	147	127.1 Å²	127.1	79%	0.786	69%	0.687	S	S	*	*			trans	-74.9	51.3	169.7	-173.8	44.7	0	0	0	108.5	K62 P66	K62-D64 PolarHBondContact O-N 3.45Å; D64-P66 WeakPolarHBondContact O-CD 3.44Å
65	T	69.9	Low	70.8	Confident	85 Å²	85	125.3 Å²	125.3	52%	0.521	67%	0.674	S	S	.	*			trans	-83.5	108.2	165.7	-55.1	0	0	0	0	104.5	E63 T67	E63-T65 VanDerWaalsContact CG-OG1 3.26Å; E63-T65 WeakPolarHBondContact CG-OG1 3.5Å; E63-T65 PolarHBondContact O-N 2.83Å; T65-T67 PolarHBondContact O-N 2.85Å
66	P	67.7	Low	71.7	Confident	99 Å²	99	126.5 Å²	126.5	64%	0.643	67%	0.666	S	S	*	*			trans	-65.4	93.8	176.7	25.7	-32.6	0	0	0	107.1	D64 R68	D64-P66 WeakPolarHBondContact O-CD 3.44Å; P66-R68 PolarHBondContact O-N 3.47Å
67	T	66.1	Low	72.6	Confident	114 Å²	114	125.6 Å²	125.6	70%	0.699	66%	0.656	S	S	*	*			trans	-62.2	94.6	168.1	-61.2	0	0	0	0	104.4	T65 H69	T65-T67 PolarHBondContact O-N 2.85Å; T67-H69 PolarHBondContact O-N 2.95Å
68	R	71.7	Confident	73.8	Confident	224 Å²	224	121.1 Å²	121.1	85%	0.845	63%	0.631	S	S	*	*			trans	-65.8	89.5	171.8	-70.4	-171.6	-179.5	-178.3	1	105.4	P66 L70	P66-R68 PolarHBondContact O-N 3.47Å; R68-L70 VanDerWaalsContact C-N 3.32Å; R68-L70 PolarHBondContact O-N 3.37Å
69	H	73.1	Confident	75	Confident	156 Å²	156	120.1 Å²	120.1	72%	0.722	62%	0.62	S	S	*	*			trans	-63.8	97.8	178.6	-144.7	-66.7	0	0	0	106.1	T67 N71	T67-H69 PolarHBondContact O-N 2.95Å; H69-N71 PolarHBondContact O-N 2.99Å
70	L	74.1	Confident	76.3	Confident	116 Å²	116	119.8 Å²	119.8	61%	0.607	61%	0.612	S	S	*	*			trans	-68.1	127.3	171.8	-66.4	175.6	0	0	0	106.5	R68 V75	R68-L70 VanDerWaalsContact C-N 3.32Å; R68-L70 PolarHBondContact O-N 3.37Å; L70-V75 HydrophobicContact CB-CG2 3.97Å
71	N	83.6	Confident	77.8	Confident	79 Å²	79	117.7 Å²	117.7	42%	0.422	60%	0.602	S	S	.	*			trans	-62.8	130.2	175.8	-65.8	-52.2	0	0	0	108.1	H69 E73 E74 V75	H69-N71 PolarHBondContact O-N 2.99Å; N71-E73 PolarHBondContact O-N 3.31Å; N71-E73 VanDerWaalsContact O-N 3.12Å; N71-E74 HydrophobicContact CB-CB 4.33Å; N71-E74 HydrophobicContact CB-CG 4.05Å; N71-E74 PolarHBondContact ND2-OE1 2.93Å; N71-E74 WeakPolarHBondContact O-CA 3.48Å; N71-E74 WeakPolarHBondContact O-CB 3.25Å; N71-E74 PolarHBondContact O-N 2.94Å; N71-V75 PolarHBondContact O-N 3.25Å; N71-V75 VanDerWaalsContact O-N 3.12Å
72	P	82.8	Confident	79	Confident	73 Å²	73	117.5 Å²	117.5	47%	0.474	59%	0.594	S	S	.	*	H	α-helix	trans	-57.1	-30.6	-178.7	19.7	-28.4	0	0	0	112.2	E74 V75 I76	P72-E74 PolarHBondContact O-N 3.34Å; P72-V75 WeakPolarHBondContact O-CB 3.48Å; P72-V75 PolarHBondContact O-N 3.16Å; P72-I76 WeakPolarHBondContact O-CD1 3.39Å; P72-I76 WeakPolarHBondContact O-CG1 3.24Å; P72-I76 PolarHBondContact O-N 3.19Å
73	E	79.8	Confident	80.3	Confident	121 Å²	121	114.5 Å²	114.5	57%	0.565	58%	0.583	S	S	*	*	H	α-helix	trans	-66.4	-33.4	174.6	-65.3	70.8	-155.5	0	0	113.2	N71 R77	N71-E73 PolarHBondContact O-N 3.31Å; N71-E73 VanDerWaalsContact O-N 3.12Å; E73-R77 WeakPolarHBondContact O-CB 3.49Å; E73-R77 WeakPolarHBondContact O-CG 3.35Å; E73-R77 PolarHBondContact O-N 3.4Å
74	E	80.6	Confident	81.8	Confident	92 Å²	92	115.2 Å²	115.2	43%	0.43	58%	0.578	S	S	.	*	H	α-helix	trans	-73.5	-36.3	174.1	-70.8	172.8	-155.2	0	0	111.4	N71 P72 R77 G78	N71-E74 HydrophobicContact CB-CB 4.33Å; N71-E74 HydrophobicContact CB-CG 4.05Å; N71-E74 PolarHBondContact ND2-OE1 2.93Å; N71-E74 WeakPolarHBondContact O-CA 3.48Å; N71-E74 WeakPolarHBondContact O-CB 3.25Å; N71-E74 PolarHBondContact O-N 2.94Å; P72-E74 PolarHBondContact O-N 3.34Å; E74-R77 PolarHBondContact O-N 2.87Å; E74-G78 PolarHBondContact O-N 3.14Å
75	V	83.6	Confident	83.3	Confident	75 Å²	75	112.5 Å²	112.5	46%	0.455	56%	0.563	S	S	.	*	H	α-helix	trans	-62.3	-48.2	173.6	178.8	0	0	0	0	109.7	L70 N71 P72 R77 G78 V79	L70-V75 HydrophobicContact CB-CG2 3.97Å; N71-V75 PolarHBondContact O-N 3.25Å; N71-V75 VanDerWaalsContact O-N 3.12Å; P72-V75 WeakPolarHBondContact O-CB 3.48Å; P72-V75 PolarHBondContact O-N 3.16Å; V75-R77 PolarHBondContact O-N 3Å; V75-G78 PolarHBondContact O-N 3.45Å; V75-G78 VanDerWaalsContact O-N 3.15Å; V75-V79 WeakPolarHBondContact O-CG2 3.29Å; V75-V79 PolarHBondContact O-N 3.38Å; V75-V79 VanDerWaalsContact O-N 3.08Å
76	I	82.7	Confident	84.6	Confident	113 Å²	113	117.2 Å²	117.2	58%	0.579	57%	0.572	S	S	*	*	H	α-helix	trans	-59.9	-47.2	178.6	-66.7	160.7	0	0	0	110.7	P72 G78 V79	P72-I76 WeakPolarHBondContact O-CD1 3.39Å; P72-I76 WeakPolarHBondContact O-CG1 3.24Å; P72-I76 PolarHBondContact O-N 3.19Å; I76-G78 VanDerWaalsContact C-N 3.32Å; I76-G78 PolarHBondContact O-N 3.23Å; I76-V79 PolarHBondContact O-N 3.37Å
77	R	84	Confident	86	Confident	149 Å²	149	117.3 Å²	117.3	56%	0.562	56%	0.563	S	S	*	*	H	α-helix	trans	-62.5	-37.1	175.1	-79.9	171.8	42.8	-122.1	-15.7	113.2	E73 E74 V75 V79	E73-R77 WeakPolarHBondContact O-CB 3.49Å; E73-R77 WeakPolarHBondContact O-CG 3.35Å; E73-R77 PolarHBondContact O-N 3.4Å; E74-R77 PolarHBondContact O-N 2.87Å; V75-R77 PolarHBondContact O-N 3Å; R77-V79 VanDerWaalsContact C-N 3.28Å; R77-V79 PolarHBondContact O-N 3.35Å
78	G	87.3	Confident	87.5	Confident	22 Å²	22	115.5 Å²	115.5	23%	0.227	55%	0.547	C	S	.	.	H	α-helix	trans	-67.1	-27.2	178.9	0	0	0	0	0	113.3	E74 V75 I76 E81 L82	E74-G78 PolarHBondContact O-N 3.14Å; V75-G78 PolarHBondContact O-N 3.45Å; V75-G78 VanDerWaalsContact O-N 3.15Å; I76-G78 VanDerWaalsContact C-N 3.32Å; I76-G78 PolarHBondContact O-N 3.23Å; G78-E81 PolarHBondContact O-N 3.38Å; G78-L82 VanDerWaalsContact O-CB 3.32Å; G78-L82 WeakPolarHBondContact O-CB 3.46Å; G78-L82 WeakPolarHBondContact O-CG 3.36Å; G78-L82 PolarHBondContact O-N 3.19Å
79	V	91.3	Very high	88.8	Confident	80 Å²	80	109.9 Å²	109.9	49%	0.485	53%	0.533	S	S	.	.	H	α-helix	trans	-63	-45.6	177.8	170.9	0	0	0	0	111.4	V75 I76 R77 E81 L82 E83	V75-V79 WeakPolarHBondContact O-CG2 3.29Å; V75-V79 PolarHBondContact O-N 3.38Å; V75-V79 VanDerWaalsContact O-N 3.08Å; I76-V79 PolarHBondContact O-N 3.37Å; R77-V79 VanDerWaalsContact C-N 3.28Å; R77-V79 PolarHBondContact O-N 3.35Å; V79-E81 PolarHBondContact O-N 2.85Å; V79-L82 PolarHBondContact O-N 3.05Å; V79-E83 WeakPolarHBondContact O-CB 3.28Å; V79-E83 PolarHBondContact O-N 3.14Å
80	D	91.4	Very high	90	Very high	108 Å²	108	107.6 Å²	107.6	58%	0.578	52%	0.518	S	S	*	.	H	α-helix	trans	-64.9	-39.8	179.3	-67.5	-17.9	0	0	0	111.8	E83 R84	D80-E83 PolarHBondContact O-N 2.98Å; D80-R84 WeakPolarHBondContact O-CB 3.47Å; D80-R84 PolarHBondContact O-N 3.42Å
81	E	94.4	Very high	91.1	Very high	129 Å²	129	109.6 Å²	109.6	60%	0.603	52%	0.517	S	S	*	.	H	α-helix	trans	-65.5	-41.7	176.5	-67.7	178.8	-169.9	0	0	111.6	G78 V79 R84 L85	G78-E81 PolarHBondContact O-N 3.38Å; V79-E81 PolarHBondContact O-N 2.85Å; E81-R84 PolarHBondContact O-N 3.39Å; E81-L85 WeakPolarHBondContact O-CB 3.34Å; E81-L85 PolarHBondContact O-N 2.92Å
82	L	94.7	Very high	91.8	Very high	117 Å²	117	108.9 Å²	108.9	61%	0.613	52%	0.516	S	S	*	.	H	α-helix	trans	-65.9	-39.5	175.3	-76.3	174	0	0	0	112	G78 V79 L85 R86	G78-L82 VanDerWaalsContact O-CB 3.32Å; G78-L82 WeakPolarHBondContact O-CB 3.46Å; G78-L82 WeakPolarHBondContact O-CG 3.36Å; G78-L82 PolarHBondContact O-N 3.19Å; V79-L82 PolarHBondContact O-N 3.05Å; L82-L85 PolarHBondContact O-N 2.57Å; L82-R86 WeakPolarHBondContact O-CB 3.47Å; L82-R86 PolarHBondContact O-N 2.93Å
83	E	96.1	Very high	92.5	Very high	133 Å²	133	113.6 Å²	113.6	62%	0.621	52%	0.524	S	S	*	.	H	α-helix	trans	-63.8	-46.3	175.5	-177.7	167.3	-152.3	0	0	111.2	V79 D80 L85 R86 E87	V79-E83 WeakPolarHBondContact O-CB 3.28Å; V79-E83 PolarHBondContact O-N 3.14Å; D80-E83 PolarHBondContact O-N 2.98Å; E83-L85 VanDerWaalsContact C-N 3.32Å; E83-L85 PolarHBondContact O-N 2.77Å; E83-R86 WeakPolarHBondContact O-CB 3.36Å; E83-R86 PolarHBondContact O-N 2.86Å; E83-R86 VanDerWaalsContact O-N 3.16Å; E83-E87 PolarHBondContact O-N 2.94Å
84	R	96.5	Very high	93.4	Very high	188 Å²	188	112.2 Å²	112.2	71%	0.709	52%	0.52	S	S	*	.	H	α-helix	trans	-58.1	-44.3	174.2	178.2	-176.3	152.5	-169.8	-7.4	111.7	D80 E81 R86 E87 E88	D80-R84 WeakPolarHBondContact O-CB 3.47Å; D80-R84 PolarHBondContact O-N 3.42Å; E81-R84 PolarHBondContact O-N 3.39Å; R84-R86 VanDerWaalsContact C-N 3.33Å; R84-R86 PolarHBondContact O-N 3.31Å; R84-E87 PolarHBondContact O-N 3.46Å; R84-E88 PolarHBondContact O-N 3.14Å
85	L	97.2	Very high	94.1	Very high	90 Å²	90	115.2 Å²	115.2	47%	0.471	53%	0.532	S	S	.	.	H	α-helix	trans	-62.5	-41.7	177.2	179.2	62.3	0	0	0	111.4	E81 L82 E83 E87 E88 I89	E81-L85 WeakPolarHBondContact O-CB 3.34Å; E81-L85 PolarHBondContact O-N 2.92Å; L82-L85 PolarHBondContact O-N 2.57Å; E83-L85 VanDerWaalsContact C-N 3.32Å; E83-L85 PolarHBondContact O-N 2.77Å; L85-E87 VanDerWaalsContact C-N 3.33Å; L85-E87 PolarHBondContact O-N 3.04Å; L85-E88 PolarHBondContact O-N 2.89Å; L85-I89 HydrophobicContact CD1-CD1 4.39Å; L85-I89 HydrophobicContact CD1-CG1 4.48Å; L85-I89 HydrophobicContact CG-CD1 4.09Å; L85-I89 WeakPolarHBondContact O-CG1 3.21Å; L85-I89 PolarHBondContact O-N 3.46Å
86	R	97.6	Very high	94.8	Very high	183 Å²	183	117.6 Å²	117.6	69%	0.691	54%	0.536	S	S	*	.	H	α-helix	trans	-63	-40.4	177.9	-166.5	178.4	-174.8	-166	2.9	111.6	L82 E83 R84 R90	L82-R86 WeakPolarHBondContact O-CB 3.47Å; L82-R86 PolarHBondContact O-N 2.93Å; E83-R86 WeakPolarHBondContact O-CB 3.36Å; E83-R86 PolarHBondContact O-N 2.86Å; E83-R86 VanDerWaalsContact O-N 3.16Å; R84-R86 VanDerWaalsContact C-N 3.33Å; R84-R86 PolarHBondContact O-N 3.31Å; R86-R90 WeakPolarHBondContact O-CB 3.31Å; R86-R90 PolarHBondContact O-N 3.33Å
87	E	97.6	Very high	95.4	Very high	101 Å²	101	116.3 Å²	116.3	47%	0.472	53%	0.534	S	S	.	.	H	α-helix	trans	-63.1	-43.9	172.6	-172.4	63.1	-113.1	0	0	111.4	E83 R84 L85 I89 R90 R91	E83-E87 PolarHBondContact O-N 2.94Å; R84-E87 PolarHBondContact O-N 3.46Å; L85-E87 VanDerWaalsContact C-N 3.33Å; L85-E87 PolarHBondContact O-N 3.04Å; E87-I89 PolarHBondContact O-N 3.27Å; E87-R90 CarbonylContact O-C 3.6Å; E87-R90 WeakPolarHBondContact O-CB 3.35Å; E87-R90 PolarHBondContact O-N 2.9Å; E87-R90 VanDerWaalsContact O-N 3.14Å; E87-R90 IonicContact OE1-CZ 4Å; E87-R90 IonicContact OE1-NH1 2.77Å; E87-R90 PolarHBondContact OE1-NH1 2.79Å; E87-R90 IonicContact OE2-CZ 3.73Å; E87-R90 IonicContact OE2-NH1 2.57Å; E87-R90 PolarHBondContact OE2-NH1 3.42Å; E87-R91 WeakPolarHBondContact O-CB 3.33Å; E87-R91 PolarHBondContact O-N 3.45Å
88	E	98	Very high	95.9	Very high	76 Å²	76	113.6 Å²	113.6	36%	0.355	53%	0.528	S	S	.	.	H	α-helix	trans	-62.3	-44	178.7	-179.9	148.4	-137.3	0	0	112.3	R84 L85 R90 R91 V92	R84-E88 PolarHBondContact O-N 3.14Å; L85-E88 PolarHBondContact O-N 2.89Å; E88-R90 VanDerWaalsContact C-N 3.3Å; E88-R90 PolarHBondContact O-N 2.88Å; E88-R91 PolarHBondContact O-N 2.95Å; E88-R91 IonicContact OE1-NH2 2.97Å; E88-R91 PolarHBondContact OE1-NH2 3.18Å; E88-V92 HydrophobicContact CG-CG2 4.45Å; E88-V92 WeakPolarHBondContact O-CB 3.49Å; E88-V92 WeakPolarHBondContact O-CG2 3.39Å; E88-V92 PolarHBondContact O-N 2.95Å
89	I	98.3	Very high	96.2	Very high	107 Å²	107	117.7 Å²	117.7	55%	0.549	54%	0.543	S	S	.	.	H	α-helix	trans	-58.3	-45.1	173.4	-68.6	167.1	0	0	0	110.1	L85 E87 R93	L85-I89 HydrophobicContact CD1-CD1 4.39Å; L85-I89 HydrophobicContact CD1-CG1 4.48Å; L85-I89 HydrophobicContact CG-CD1 4.09Å; L85-I89 WeakPolarHBondContact O-CG1 3.21Å; L85-I89 PolarHBondContact O-N 3.46Å; E87-I89 PolarHBondContact O-N 3.27Å; I89-R93 VanDerWaalsContact O-CB 3.31Å; I89-R93 WeakPolarHBondContact O-CB 3.38Å; I89-R93 PolarHBondContact O-N 3.4Å
90	R	98.3	Very high	96.2	Very high	108 Å²	108	117.6 Å²	117.6	41%	0.408	54%	0.537	S	S	.	.	H	α-helix	trans	-63.8	-44	178.6	-160.4	-173.7	-52.5	104.7	-4.8	111.7	R86 E87 E88 R93 N94	R86-R90 WeakPolarHBondContact O-CB 3.31Å; R86-R90 PolarHBondContact O-N 3.33Å; E87-R90 CarbonylContact O-C 3.6Å; E87-R90 WeakPolarHBondContact O-CB 3.35Å; E87-R90 PolarHBondContact O-N 2.9Å; E87-R90 VanDerWaalsContact O-N 3.14Å; E87-R90 IonicContact OE1-CZ 4Å; E87-R90 IonicContact OE1-NH1 2.77Å; E87-R90 PolarHBondContact OE1-NH1 2.79Å; E87-R90 IonicContact OE2-CZ 3.73Å; E87-R90 IonicContact OE2-NH1 2.57Å; E87-R90 PolarHBondContact OE2-NH1 3.42Å; E88-R90 VanDerWaalsContact C-N 3.3Å; E88-R90 PolarHBondContact O-N 2.88Å; R90-R93 PolarHBondContact O-N 2.84Å; R90-N94 WeakPolarHBondContact O-CB 3.49Å; R90-N94 PolarHBondContact O-N 3.14Å
91	R	98.1	Very high	96.1	Very high	157 Å²	157	120.1 Å²	120.1	59%	0.592	54%	0.539	S	S	*	.	H	α-helix	trans	-60.7	-48.9	177.9	-176.8	-176.5	71	153.2	-2.6	111.5	E87 E88 N94 K95	E87-R91 WeakPolarHBondContact O-CB 3.33Å; E87-R91 PolarHBondContact O-N 3.45Å; E88-R91 PolarHBondContact O-N 2.95Å; E88-R91 IonicContact OE1-NH2 2.97Å; E88-R91 PolarHBondContact OE1-NH2 3.18Å; R91-N94 PolarHBondContact O-N 2.86Å; R91-K95 PolarHBondContact O-N 3.47Å
92	V	98.2	Very high	95.7	Very high	64 Å²	64	120.3 Å²	120.3	39%	0.388	54%	0.538	S	S	.	.	H	α-helix	trans	-62.1	-48.7	177.7	172.6	0	0	0	0	109.7	E88 N94 K95 F96	E88-V92 HydrophobicContact CG-CG2 4.45Å; E88-V92 WeakPolarHBondContact O-CB 3.49Å; E88-V92 WeakPolarHBondContact O-CG2 3.39Å; E88-V92 PolarHBondContact O-N 2.95Å; V92-N94 VanDerWaalsContact C-N 3.33Å; V92-N94 PolarHBondContact O-N 3.3Å; V92-K95 WeakPolarHBondContact O-CB 3.33Å; V92-K95 PolarHBondContact O-N 3.4Å; V92-K95 VanDerWaalsContact O-N 3.14Å; V92-F96 HydrophobicContact CG1-CD2 3.84Å; V92-F96 HydrophobicContact CG1-CE2 3.72Å; V92-F96 VanDerWaalsContact O-CD2 3.31Å; V92-F96 WeakPolarHBondContact O-CD2 3.31Å; V92-F96 PolarHBondContact O-N 3.49Å
93	R	97.7	Very high	95.3	Very high	173 Å²	173	118.8 Å²	118.8	65%	0.653	53%	0.527	S	S	*	.	H	α-helix	trans	-56.2	-46	176.8	-166.7	-173.2	90.7	-163.4	7.3	112	I89 R90 K95 F96 V97	I89-R93 VanDerWaalsContact O-CB 3.31Å; I89-R93 WeakPolarHBondContact O-CB 3.38Å; I89-R93 PolarHBondContact O-N 3.4Å; R90-R93 PolarHBondContact O-N 2.84Å; R93-K95 VanDerWaalsContact C-N 3.34Å; R93-K95 PolarHBondContact O-N 3.36Å; R93-F96 PolarHBondContact O-N 3.16Å; R93-V97 WeakPolarHBondContact O-CG2 3.38Å; R93-V97 PolarHBondContact O-N 2.97Å
94	N	97	Very high	94.7	Very high	91 Å²	91	119.8 Å²	119.8	49%	0.487	53%	0.526	S	S	.	.	H	α-helix	trans	-61.8	-41.9	178.8	-169.5	-1.2	0	0	0	111.5	R90 R91 V92 F96 V97 M98	R90-N94 WeakPolarHBondContact O-CB 3.49Å; R90-N94 PolarHBondContact O-N 3.14Å; R91-N94 PolarHBondContact O-N 2.86Å; V92-N94 VanDerWaalsContact C-N 3.33Å; V92-N94 PolarHBondContact O-N 3.3Å; N94-F96 VanDerWaalsContact C-N 3.32Å; N94-F96 PolarHBondContact O-N 2.93Å; N94-V97 PolarHBondContact O-N 2.94Å; N94-M98 WeakPolarHBondContact O-CB 3.46Å; N94-M98 PolarHBondContact O-N 3.48Å
95	K	97.2	Very high	93.8	Very high	156 Å²	156	115 Å²	115	68%	0.678	51%	0.511	S	S	*	.	H	α-helix	trans	-57.8	-44.5	174	-172.9	179.4	179.5	-178.1	0	111.8	R91 V92 R93 M98 M99	R91-K95 PolarHBondContact O-N 3.47Å; V92-K95 WeakPolarHBondContact O-CB 3.33Å; V92-K95 PolarHBondContact O-N 3.4Å; V92-K95 VanDerWaalsContact O-N 3.14Å; R93-K95 VanDerWaalsContact C-N 3.34Å; R93-K95 PolarHBondContact O-N 3.36Å; K95-M98 PolarHBondContact O-N 3.29Å; K95-M99 WeakPolarHBondContact O-CB 3.44Å; K95-M99 PolarHBondContact O-N 3.08Å
96	F	96.6	Very high	92.6	Very high	124 Å²	124	114.7 Å²	114.7	54%	0.544	52%	0.516	S	S	.	.	H	α-helix	trans	-63.4	-45.7	175.9	-85.7	-85.3	0	0	0	112.3	V92 R93 N94 M98 M99 H100	V92-F96 HydrophobicContact CG1-CD2 3.84Å; V92-F96 HydrophobicContact CG1-CE2 3.72Å; V92-F96 VanDerWaalsContact O-CD2 3.31Å; V92-F96 WeakPolarHBondContact O-CD2 3.31Å; V92-F96 PolarHBondContact O-N 3.49Å; R93-F96 PolarHBondContact O-N 3.16Å; N94-F96 VanDerWaalsContact C-N 3.32Å; N94-F96 PolarHBondContact O-N 2.93Å; F96-M98 VanDerWaalsContact C-N 3.34Å; F96-M98 PolarHBondContact O-N 3.43Å; F96-M99 HydrophobicContact CD1-CE 4.13Å; F96-M99 HydrophobicContact CE1-CE 4.3Å; F96-M99 PolarHBondContact O-N 3.42Å; F96-H100 VanDerWaalsContact O-CB 3.28Å; F96-H100 WeakPolarHBondContact O-CB 3.32Å; F96-H100 PolarHBondContact O-N 2.84Å
97	V	95.3	Very high	91.2	Very high	87 Å²	87	114.9 Å²	114.9	53%	0.527	52%	0.517	S	S	.	.	H	α-helix	trans	-57.5	-48.5	176	170.2	0	0	0	0	110.5	R93 N94 H100 W101	R93-V97 WeakPolarHBondContact O-CG2 3.38Å; R93-V97 PolarHBondContact O-N 2.97Å; N94-V97 PolarHBondContact O-N 2.94Å; V97-H100 PolarHBondContact O-N 2.91Å; V97-W101 VanDerWaalsContact O-CB 3.25Å; V97-W101 WeakPolarHBondContact O-CB 3.4Å; V97-W101 PolarHBondContact O-N 2.94Å
98	M	95.2	Very high	89.8	Confident	91 Å²	91	114.1 Å²	114.1	45%	0.448	52%	0.523	S	S	.	.	H	α-helix	trans	-68.2	-39.5	-178.7	-169.4	177.6	-59.3	0	0	112.6	N94 K95 F96 K102	N94-M98 WeakPolarHBondContact O-CB 3.46Å; N94-M98 PolarHBondContact O-N 3.48Å; K95-M98 PolarHBondContact O-N 3.29Å; F96-M98 VanDerWaalsContact C-N 3.34Å; F96-M98 PolarHBondContact O-N 3.43Å; M98-K102 HydrophobicContact CG-CD 4.43Å; M98-K102 WeakPolarHBondContact O-CB 3.44Å; M98-K102 VanDerWaalsContact O-CG 3.29Å; M98-K102 WeakPolarHBondContact O-CG 3.42Å; M98-K102 PolarHBondContact O-N 3.28Å
99	M	94.4	Very high	88.5	Confident	109 Å²	109	120.8 Å²	120.8	54%	0.537	55%	0.545	S	S	.	.	H	α-helix	trans	-62	-49	175.6	-176.2	177.3	77.9	0	0	111	K95 F96 K102 Q103	K95-M99 WeakPolarHBondContact O-CB 3.44Å; K95-M99 PolarHBondContact O-N 3.08Å; F96-M99 HydrophobicContact CD1-CE 4.13Å; F96-M99 HydrophobicContact CE1-CE 4.3Å; F96-M99 PolarHBondContact O-N 3.42Å; M99-K102 PolarHBondContact O-N 3.47Å; M99-Q103 WeakPolarHBondContact O-CB 3.2Å; M99-Q103 PolarHBondContact O-N 3.44Å
100	H	91.3	Very high	87.4	Confident	78 Å²	78	121.2 Å²	121.2	36%	0.361	56%	0.555	S	S	.	*	H	α-helix	trans	-69	-36.5	-179.7	177.4	-106.7	0	0	0	112.4	F96 V97 Q103 R104	F96-H100 VanDerWaalsContact O-CB 3.28Å; F96-H100 WeakPolarHBondContact O-CB 3.32Å; F96-H100 PolarHBondContact O-N 2.84Å; V97-H100 PolarHBondContact O-N 2.91Å; H100-Q103 PolarHBondContact O-N 2.91Å; H100-R104 PolarHBondContact CE1-NE 3.12Å; H100-R104 PolarHBondContact CE1-NH2 2.88Å; H100-R104 VanDerWaalsContact NE2-CZ 3.28Å; H100-R104 PolarHBondContact NE2-NE 3.39Å; H100-R104 PolarHBondContact NE2-NH2 2.75Å; H100-R104 VanDerWaalsContact NE2-NH2 3.2Å; H100-R104 PolarHBondContact O-N 3.12Å
101	W	88.5	Confident	86.1	Confident	161 Å²	161	126.2 Å²	126.2	61%	0.61	58%	0.575	S	S	*	*	H	α-helix	trans	-57.3	-53.2	170.4	177.1	-90.4	0	0	0	110.9	V97 Q103 R104 H105	V97-W101 VanDerWaalsContact O-CB 3.25Å; V97-W101 WeakPolarHBondContact O-CB 3.4Å; V97-W101 PolarHBondContact O-N 2.94Å; W101-Q103 VanDerWaalsContact C-N 3.3Å; W101-Q103 PolarHBondContact O-N 3.15Å; W101-R104 PolarHBondContact O-N 3.47Å; W101-H105 AromaticContact CD1-ND1 3.95Å; W101-H105 AromaticContact CD2-CE1 3.31Å; W101-H105 AromaticContact CD2-ND1 3.45Å; W101-H105 AromaticContact CE2-CE1 3.4Å; W101-H105 VanDerWaalsContact CE2-CE1 3.4Å; W101-H105 AromaticContact CE2-ND1 3.49Å; W101-H105 AromaticContact CE2-NE2 3.93Å; W101-H105 AromaticContact CE3-CE1 3.28Å; W101-H105 AromaticContact CE3-ND1 3.89Å; W101-H105 AromaticContact CG-ND1 3.76Å; W101-H105 AromaticContact CH2-CE1 3.44Å; W101-H105 VanDerWaalsContact CH2-CE1 3.44Å; W101-H105 WeakPolarHBondContact CH2-CE1 3.21Å; W101-H105 AromaticContact CH2-NE2 3.5Å; W101-H105 WeakPolarHBondContact CH2-NE2 3.46Å; W101-H105 AromaticContact CZ2-CE1 3.48Å; W101-H105 VanDerWaalsContact CZ2-CE1 3.48Å; W101-H105 WeakPolarHBondContact CZ2-CE1 3.49Å; W101-H105 AromaticContact CZ2-ND1 3.95Å; W101-H105 AromaticContact CZ2-NE2 3.57Å; W101-H105 AromaticContact CZ3-CE1 3.35Å; W101-H105 WeakPolarHBondContact CZ3-CE1 3.41Å; W101-H105 AromaticContact CZ3-NE2 3.81Å; W101-H105 AromaticContact NE1-ND1 3.79Å; W101-H105 PolarHBondContact O-N 2.79Å; W101-H105 PolarHBondContact O-ND1 2.7Å
102	K	85.8	Confident	85	Confident	133 Å²	133	123.8 Å²	123.8	58%	0.578	58%	0.579	S	S	*	*	H	α-helix	trans	-59.1	-41.1	178.5	-72.9	175.1	-178.9	-175.4	0	111.9	M98 M99 S106	M98-K102 HydrophobicContact CG-CD 4.43Å; M98-K102 WeakPolarHBondContact O-CB 3.44Å; M98-K102 VanDerWaalsContact O-CG 3.29Å; M98-K102 WeakPolarHBondContact O-CG 3.42Å; M98-K102 PolarHBondContact O-N 3.28Å; M99-K102 PolarHBondContact O-N 3.47Å; K102-S106 VanDerWaalsContact O-CB 3.24Å; K102-S106 WeakPolarHBondContact O-CB 3.41Å; K102-S106 PolarHBondContact O-N 2.93Å; K102-S106 PolarHBondContact O-OG 3.05Å
103	Q	87.5	Confident	83.9	Confident	85 Å²	85	126.7 Å²	126.7	40%	0.397	60%	0.597	S	S	.	*	H	α-helix	trans	-64.3	-42.6	179.3	-174.1	-177.6	32.8	0	0	113	M99 H100 W101 S106 R107	M99-Q103 WeakPolarHBondContact O-CB 3.2Å; M99-Q103 PolarHBondContact O-N 3.44Å; H100-Q103 PolarHBondContact O-N 2.91Å; W101-Q103 VanDerWaalsContact C-N 3.3Å; W101-Q103 PolarHBondContact O-N 3.15Å; Q103-S106 PolarHBondContact O-OG 2.86Å; Q103-R107 WeakPolarHBondContact O-CG 3.5Å
104	R	81.9	Confident	82.9	Confident	154 Å²	154	123.4 Å²	123.4	58%	0.581	60%	0.6	S	S	*	*	H	α-helix	trans	-67.1	-47.8	177.4	-75.9	-171.1	175.5	173.4	0.5	111	H100 W101 S106 R107 S108	H100-R104 PolarHBondContact CE1-NE 3.12Å; H100-R104 PolarHBondContact CE1-NH2 2.88Å; H100-R104 VanDerWaalsContact NE2-CZ 3.28Å; H100-R104 PolarHBondContact NE2-NE 3.39Å; H100-R104 PolarHBondContact NE2-NH2 2.75Å; H100-R104 VanDerWaalsContact NE2-NH2 3.2Å; H100-R104 PolarHBondContact O-N 3.12Å; W101-R104 PolarHBondContact O-N 3.47Å; R104-S106 PolarHBondContact O-N 2.91Å; R104-R107 PolarHBondContact O-N 2.74Å; R104-S108 WeakPolarHBondContact O-CB 3.26Å; R104-S108 PolarHBondContact O-N 2.89Å; R104-S108 VanDerWaalsContact O-N 3.08Å; R104-S108 PolarHBondContact O-OG 3.13Å
105	H	78.3	Confident	81.4	Confident	87 Å²	87	128.5 Å²	128.5	40%	0.403	62%	0.618	S	S	.	*	H	α-helix	trans	-77.5	-23.5	-172.8	-64.2	84.6	0	0	0	114	W101 R107	W101-H105 AromaticContact CD1-ND1 3.95Å; W101-H105 AromaticContact CD2-CE1 3.31Å; W101-H105 AromaticContact CD2-ND1 3.45Å; W101-H105 AromaticContact CE2-CE1 3.4Å; W101-H105 VanDerWaalsContact CE2-CE1 3.4Å; W101-H105 AromaticContact CE2-ND1 3.49Å; W101-H105 AromaticContact CE2-NE2 3.93Å; W101-H105 AromaticContact CE3-CE1 3.28Å; W101-H105 AromaticContact CE3-ND1 3.89Å; W101-H105 AromaticContact CG-ND1 3.76Å; W101-H105 AromaticContact CH2-CE1 3.44Å; W101-H105 VanDerWaalsContact CH2-CE1 3.44Å; W101-H105 WeakPolarHBondContact CH2-CE1 3.21Å; W101-H105 AromaticContact CH2-NE2 3.5Å; W101-H105 WeakPolarHBondContact CH2-NE2 3.46Å; W101-H105 AromaticContact CZ2-CE1 3.48Å; W101-H105 VanDerWaalsContact CZ2-CE1 3.48Å; W101-H105 WeakPolarHBondContact CZ2-CE1 3.49Å; W101-H105 AromaticContact CZ2-ND1 3.95Å; W101-H105 AromaticContact CZ2-NE2 3.57Å; W101-H105 AromaticContact CZ3-CE1 3.35Å; W101-H105 WeakPolarHBondContact CZ3-CE1 3.41Å; W101-H105 AromaticContact CZ3-NE2 3.81Å; W101-H105 AromaticContact NE1-ND1 3.79Å; W101-H105 PolarHBondContact O-N 2.79Å; W101-H105 PolarHBondContact O-ND1 2.7Å; H105-R107 VanDerWaalsContact C-N 3.32Å
106	S	71.8	Confident	80	Confident	84 Å²	84	132.2 Å²	132.2	59%	0.587	63%	0.627	S	S	*	*	H	α-helix	trans	-70.1	-31.3	171.4	63.4	0	0	0	0	112.4	K102 Q103 R104	K102-S106 VanDerWaalsContact O-CB 3.24Å; K102-S106 WeakPolarHBondContact O-CB 3.41Å; K102-S106 PolarHBondContact O-N 2.93Å; K102-S106 PolarHBondContact O-OG 3.05Å; Q103-S106 PolarHBondContact O-OG 2.86Å; R104-S106 PolarHBondContact O-N 2.91Å
107	R	68.9	Low	78.9	Confident	187 Å²	187	135.9 Å²	135.9	71%	0.706	66%	0.664	S	S	*	*	H	α-helix	trans	-88.8	-18.9	-179.6	-66.4	178	175.4	175.7	-3.1	113.5	Q103 R104 H105 R109	Q103-R107 WeakPolarHBondContact O-CG 3.5Å; R104-R107 PolarHBondContact O-N 2.74Å; H105-R107 VanDerWaalsContact C-N 3.32Å; R107-R109 VanDerWaalsContact C-N 3.3Å; R107-R109 PolarHBondContact O-N 3.29Å
108	S	68	Low	78.1	Confident	85 Å²	85	138.4 Å²	138.4	59%	0.594	67%	0.671	S	S	*	*			trans	-85.7	14.4	-179.4	-65.6	0	0	0	0	114.8	R104 P110	R104-S108 WeakPolarHBondContact O-CB 3.26Å; R104-S108 PolarHBondContact O-N 2.89Å; R104-S108 VanDerWaalsContact O-N 3.08Å; R104-S108 PolarHBondContact O-OG 3.13Å; S108-P110 WeakPolarHBondContact O-CD 3.14Å
109	R	71.3	Confident	77.2	Confident	215 Å²	215	140.8 Å²	140.8	81%	0.811	68%	0.683	S	S	*	*			trans	-89.5	96.2	170.3	-73.2	-170.9	171.8	-125.9	-1	109.3	R107 Y111	R107-R109 VanDerWaalsContact C-N 3.3Å; R107-R109 PolarHBondContact O-N 3.29Å; R109-Y111 PolarHBondContact O-N 3.16Å
110	P	75.1	Confident	76.2	Confident	117 Å²	117	142.6 Å²	142.6	76%	0.76	69%	0.691	S	S	*	*			trans	-58.1	130.8	167.7	24.8	-32.2	0	0	0	108	S108	S108-P110 WeakPolarHBondContact O-CD 3.14Å
111	Y	70.7	Confident	75.3	Confident	213 Å²	213	146.4 Å²	146.4	84%	0.835	71%	0.71	S	S	*	*			trans	-51.1	132.7	171.4	-111.1	-94.3	0	0	0	108.1	R109 V113	R109-Y111 PolarHBondContact O-N 3.16Å; Y111-V113 PolarHBondContact O-N 2.99Å
112	P	74.7	Confident	74.5	Confident	105 Å²	105	145.5 Å²	145.5	68%	0.682	72%	0.716	S	S	*	*			trans	-60.8	106.2	169.6	23.8	-28.9	0	0	0	106.8	C114	P112-C114 PolarHBondContact O-N 3.25Å
113	V	74.9	Confident	73.8	Confident	125 Å²	125	146.3 Å²	146.3	76%	0.758	73%	0.726	S	S	*	*			trans	-67.7	91.3	168.2	-121.2	0	0	0	0	104.9	Y111 F115	Y111-V113 PolarHBondContact O-N 2.99Å; V113-F115 VanDerWaalsContact C-N 3.31Å; V113-F115 PolarHBondContact O-N 2.83Å
114	C	77.6	Confident	72.8	Confident	105 Å²	105	150.7 Å²	150.7	71%	0.709	75%	0.749	S	S	*	*			trans	-63.9	98.8	170.3	-61.2	0	0	0	0	106.5	P112 R116	P112-C114 PolarHBondContact O-N 3.25Å; C114-R116 VanDerWaalsContact C-N 3.34Å; C114-R116 PolarHBondContact O-N 3.14Å
115	F	64.6	Low	72.1	Confident	198 Å²	198	150.5 Å²	150.5	87%	0.868	76%	0.762	S	S	*	*			trans	-60.1	103.7	158.7	-76.9	-87	0	0	0	106.3	V113	V113-F115 VanDerWaalsContact C-N 3.31Å; V113-F115 PolarHBondContact O-N 2.83Å
116	R	68.7	Low	71.6	Confident	233 Å²	233	155.8 Å²	155.8	88%	0.879	79%	0.792	S	S	*	*			trans	-72	129.8	167.9	-78.4	-170.1	172.8	-155.8	-0.6	107.5	C114	C114-R116 VanDerWaalsContact C-N 3.34Å; C114-R116 PolarHBondContact O-N 3.14Å
117	P	72.3	Confident	71.5	Confident	202 Å²	202	162.3 Å²	162.3	100%	1.312	81%	0.81	S	S	*	*			trans	-59.7	0	173.4	-18.1	29.7	0	0	0	112.7

Retrieved 117 of 117 residues in 25.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).