A0A061I6J1_CRIGR Loading...

Apolipoprotein C-III

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

AlphaFold DB , UniProt , Accession A0A061I6J1, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Apoc3, Length 99 aa.

						>A0A061I6J1_CRIGR|A0A061I6J1|Apoc3
MQPRMLLIVALLALLASARAKEAEGSLLLGSVQGYMEHAAKKVQDALTSVQESEMAVQARGWMDGGLSSLKGYWSTFTDKFSSLWDSSSEAPPTPATEP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.3	Low	66.3	Low	222 Å²	222	122.7 Å²	122.7	100%	1.094	63%	0.631	S	S	*	*				0	114.9	0	-68.3	-74.4	178.2	0	0	107.5	P3	M1-P3 WeakPolarHBondContact O-CD 3.22Å
2	Q	57.8	Low	67	Low	132 Å²	132	121.7 Å²	121.7	62%	0.617	63%	0.626	S	S	*	*			trans	-70.9	117.7	-174.4	-71.9	-177.1	-44.3	0	0	109.9	R4 M5	Q2-R4 PolarHBondContact O-N 3.38Å; Q2-M5 PolarHBondContact O-N 2.92Å
3	P	59.1	Low	67.6	Low	89 Å²	89	116.8 Å²	116.8	58%	0.578	62%	0.615	S	S	*	*	H	α-helix	trans	-60.1	-23.1	-175.4	22.5	-32.9	0	0	0	113	M1 M5 L6 L7	M1-P3 WeakPolarHBondContact O-CD 3.22Å; P3-M5 PolarHBondContact O-N 3.09Å; P3-L6 PolarHBondContact O-N 3.04Å; P3-L7 PolarHBondContact O-N 2.82Å; P3-L7 VanDerWaalsContact O-N 3.13Å
4	R	58	Low	67.9	Low	205 Å²	205	117.1 Å²	117.1	77%	0.774	62%	0.616	S	S	*	*	H	α-helix	trans	-62.8	-38.2	173	-64.9	179.5	101.2	102.8	-3.1	113	Q2 L6 L7 I8	Q2-R4 PolarHBondContact O-N 3.38Å; R4-L6 VanDerWaalsContact C-N 3.34Å; R4-L7 PolarHBondContact O-N 3.35Å; R4-I8 VanDerWaalsContact O-CG1 3.3Å; R4-I8 WeakPolarHBondContact O-CG1 3.5Å; R4-I8 PolarHBondContact O-N 3.02Å; R4-I8 VanDerWaalsContact O-N 3.14Å
5	M	62	Low	67.8	Low	119 Å²	119	116.5 Å²	116.5	59%	0.586	61%	0.613	S	S	*	*	H	α-helix	trans	-68.6	-36.3	177.2	-73.8	-171.4	176.6	0	0	111.3	Q2 P3 I8 V9	Q2-M5 PolarHBondContact O-N 2.92Å; P3-M5 PolarHBondContact O-N 3.09Å; M5-I8 PolarHBondContact O-N 3.48Å; M5-V9 WeakPolarHBondContact O-CB 3.45Å; M5-V9 WeakPolarHBondContact O-CG2 3.25Å; M5-V9 PolarHBondContact O-N 3.48Å
6	L	69.8	Low	67.4	Low	89 Å²	89	112.9 Å²	112.9	47%	0.466	61%	0.605	S	S	.	*	H	α-helix	trans	-65.9	-40.2	177.1	-63	177.1	0	0	0	111.9	P3 R4 V9 A10 W85	P3-L6 PolarHBondContact O-N 3.04Å; R4-L6 VanDerWaalsContact C-N 3.34Å; L6-V9 PolarHBondContact O-N 3.29Å; L6-A10 VanDerWaalsContact O-CB 3.24Å; L6-A10 WeakPolarHBondContact O-CB 3.29Å; L6-A10 PolarHBondContact O-N 3.49Å; L6-W85 HydrophobicContact CD1-CH2 4.3Å
7	L	70.2	Confident	66.7	Low	130 Å²	130	110.9 Å²	110.9	68%	0.681	60%	0.602	S	S	*	*	H	α-helix	trans	-63.4	-42.6	174	-96.7	167.4	0	0	0	112.4	P3 R4 A10 L11	P3-L7 PolarHBondContact O-N 2.82Å; P3-L7 VanDerWaalsContact O-N 3.13Å; R4-L7 PolarHBondContact O-N 3.35Å; L7-A10 PolarHBondContact O-N 2.93Å; L7-L11 VanDerWaalsContact O-CB 3.26Å; L7-L11 WeakPolarHBondContact O-CB 3.3Å; L7-L11 PolarHBondContact O-N 2.96Å
8	I	74.9	Confident	66.1	Low	102 Å²	102	108.1 Å²	108.1	52%	0.523	60%	0.596	S	S	.	*	H	α-helix	trans	-65.2	-43.4	177.7	-68	166	0	0	0	110.4	R4 M5 L11 L12	R4-I8 VanDerWaalsContact O-CG1 3.3Å; R4-I8 WeakPolarHBondContact O-CG1 3.5Å; R4-I8 PolarHBondContact O-N 3.02Å; R4-I8 VanDerWaalsContact O-N 3.14Å; M5-I8 PolarHBondContact O-N 3.48Å; I8-L11 PolarHBondContact O-N 3.48Å; I8-L12 HydrophobicContact CG2-CD1 3.73Å; I8-L12 WeakPolarHBondContact O-CB 2.98Å; I8-L12 WeakPolarHBondContact O-CD1 3.04Å; I8-L12 WeakPolarHBondContact O-CG 3.43Å; I8-L12 PolarHBondContact O-N 2.9Å
9	V	79.2	Confident	65.2	Low	91 Å²	91	111.8 Å²	111.8	55%	0.552	60%	0.6	S	S	*	*	H	α-helix	trans	-66.7	-41.5	177.8	171.3	0	0	0	0	111.3	M5 L6 L12 A13	M5-V9 WeakPolarHBondContact O-CB 3.45Å; M5-V9 WeakPolarHBondContact O-CG2 3.25Å; M5-V9 PolarHBondContact O-N 3.48Å; L6-V9 PolarHBondContact O-N 3.29Å; V9-L12 PolarHBondContact O-N 3.49Å; V9-A13 VanDerWaalsContact O-CB 3.22Å; V9-A13 WeakPolarHBondContact O-CB 3.2Å; V9-A13 PolarHBondContact O-N 3.26Å
10	A	76.3	Confident	64.2	Low	58 Å²	58	109 Å²	109	48%	0.479	59%	0.593	S	S	.	*	H	α-helix	trans	-64.5	-40.4	175.2	0	0	0	0	0	111.7	L6 L7 A13 L14	L6-A10 VanDerWaalsContact O-CB 3.24Å; L6-A10 WeakPolarHBondContact O-CB 3.29Å; L6-A10 PolarHBondContact O-N 3.49Å; L7-A10 PolarHBondContact O-N 2.93Å; A10-A13 PolarHBondContact O-N 3.42Å; A10-L14 VanDerWaalsContact O-CB 3.3Å; A10-L14 WeakPolarHBondContact O-CB 3.4Å; A10-L14 PolarHBondContact O-N 2.97Å
11	L	71.7	Confident	63.3	Low	113 Å²	113	112.2 Å²	112.2	59%	0.592	60%	0.601	S	S	*	*	H	α-helix	trans	-65.7	-43.4	175.8	-168	71.7	0	0	0	111.4	L7 I8 L14 L15	L7-L11 VanDerWaalsContact O-CB 3.26Å; L7-L11 WeakPolarHBondContact O-CB 3.3Å; L7-L11 PolarHBondContact O-N 2.96Å; I8-L11 PolarHBondContact O-N 3.48Å; L11-L14 PolarHBondContact O-N 2.85Å; L11-L15 WeakPolarHBondContact O-CB 3.23Å; L11-L15 PolarHBondContact O-N 3.28Å
12	L	74.1	Confident	63.2	Low	110 Å²	110	107.5 Å²	107.5	58%	0.576	58%	0.576	S	S	*	*	H	α-helix	trans	-63.6	-42	174.5	-82.5	159	0	0	0	112	I8 V9 L15 A16	I8-L12 HydrophobicContact CG2-CD1 3.73Å; I8-L12 WeakPolarHBondContact O-CB 2.98Å; I8-L12 WeakPolarHBondContact O-CD1 3.04Å; I8-L12 WeakPolarHBondContact O-CG 3.43Å; I8-L12 PolarHBondContact O-N 2.9Å; V9-L12 PolarHBondContact O-N 3.49Å; L12-L15 PolarHBondContact O-N 2.82Å; L12-A16 WeakPolarHBondContact O-CB 3.08Å; L12-A16 PolarHBondContact O-N 3.05Å
13	A	75.1	Confident	62.6	Low	58 Å²	58	104.5 Å²	104.5	48%	0.479	58%	0.575	S	S	.	*	H	α-helix	trans	-66	-40	176.8	0	0	0	0	0	111.5	V9 A10 A16 S17	V9-A13 VanDerWaalsContact O-CB 3.22Å; V9-A13 WeakPolarHBondContact O-CB 3.2Å; V9-A13 PolarHBondContact O-N 3.26Å; A10-A13 PolarHBondContact O-N 3.42Å; A13-A16 PolarHBondContact O-N 2.83Å; A13-S17 VanDerWaalsContact O-CB 3.28Å; A13-S17 WeakPolarHBondContact O-CB 3.45Å; A13-S17 PolarHBondContact O-N 2.97Å
14	L	72.6	Confident	61.9	Low	121 Å²	121	109 Å²	109	63%	0.634	59%	0.588	S	S	*	*	H	α-helix	trans	-66.6	-42.3	175.5	-166.4	75.5	0	0	0	111.6	A10 L11 S17 A18	A10-L14 VanDerWaalsContact O-CB 3.3Å; A10-L14 WeakPolarHBondContact O-CB 3.4Å; A10-L14 PolarHBondContact O-N 2.97Å; L11-L14 PolarHBondContact O-N 2.85Å; L14-S17 PolarHBondContact O-N 3.23Å; L14-A18 WeakPolarHBondContact O-CB 3.46Å; L14-A18 PolarHBondContact O-N 3.02Å
15	L	65.4	Low	61.3	Low	109 Å²	109	100.1 Å²	100.1	57%	0.571	56%	0.56	S	S	*	*	H	α-helix	trans	-63.8	-42.8	174.8	-123.3	68.6	0	0	0	111.7	L11 L12 S17 A18 R19	L11-L15 WeakPolarHBondContact O-CB 3.23Å; L11-L15 PolarHBondContact O-N 3.28Å; L12-L15 PolarHBondContact O-N 2.82Å; L15-S17 VanDerWaalsContact C-N 3.33Å; L15-A18 PolarHBondContact O-N 2.8Å; L15-R19 WeakPolarHBondContact O-CB 3.04Å; L15-R19 WeakPolarHBondContact O-CG 3.49Å; L15-R19 PolarHBondContact O-N 3.45Å
16	A	62.5	Low	60.5	Low	58 Å²	58	98.9 Å²	98.9	48%	0.479	56%	0.563	S	S	.	*	H	α-helix	trans	-64.8	-38.7	175.5	0	0	0	0	0	111.1	L12 A13 R19 A20	L12-A16 WeakPolarHBondContact O-CB 3.08Å; L12-A16 PolarHBondContact O-N 3.05Å; A13-A16 PolarHBondContact O-N 2.83Å; A16-R19 PolarHBondContact O-N 2.73Å; A16-A20 VanDerWaalsContact O-CB 3.23Å; A16-A20 WeakPolarHBondContact O-CB 3.19Å; A16-A20 PolarHBondContact O-N 2.66Å
17	S	54.7	Low	59.5	Low	80 Å²	80	103 Å²	103	56%	0.559	59%	0.585	S	S	*	*	H	α-helix	trans	-71.1	-33.1	177.3	-155.6	0	0	0	0	112.5	A13 L14 L15 K21	A13-S17 VanDerWaalsContact O-CB 3.28Å; A13-S17 WeakPolarHBondContact O-CB 3.45Å; A13-S17 PolarHBondContact O-N 2.97Å; L14-S17 PolarHBondContact O-N 3.23Å; L15-S17 VanDerWaalsContact C-N 3.33Å; S17-K21 PolarHBondContact O-N 3.47Å
18	A	55.2	Low	58.6	Low	59 Å²	59	102 Å²	102	49%	0.488	58%	0.579	S	S	.	*	H	α-helix	trans	-66.3	-43.9	170.7	0	0	0	0	0	111.4	L14 L15 K21	L14-A18 WeakPolarHBondContact O-CB 3.46Å; L14-A18 PolarHBondContact O-N 3.02Å; L15-A18 PolarHBondContact O-N 2.8Å; A18-K21 PolarHBondContact O-N 2.84Å
19	R	49.3	Very low	57.5	Low	180 Å²	180	101.8 Å²	101.8	68%	0.679	58%	0.579	S	S	*	*	H	α-helix	trans	-66.8	-34.7	174.6	-77.6	-78.1	-117.1	-149.8	-5	113.4	L15 A16 K21 E22 A23	L15-R19 WeakPolarHBondContact O-CB 3.04Å; L15-R19 WeakPolarHBondContact O-CG 3.49Å; L15-R19 PolarHBondContact O-N 3.45Å; A16-R19 PolarHBondContact O-N 2.73Å; R19-K21 VanDerWaalsContact C-N 3.34Å; R19-E22 WeakPolarHBondContact O-CB 3.44Å; R19-E22 PolarHBondContact O-N 3.25Å; R19-A23 PolarHBondContact O-N 3.15Å
20	A	45.2	Very low	56.3	Low	55 Å²	55	100.8 Å²	100.8	46%	0.455	59%	0.587	S	S	.	*	H	α-helix	trans	-70.6	-32.1	178.7	0	0	0	0	0	111.8	A16 E22 A23	A16-A20 VanDerWaalsContact O-CB 3.23Å; A16-A20 WeakPolarHBondContact O-CB 3.19Å; A16-A20 PolarHBondContact O-N 2.66Å; A20-E22 PolarHBondContact O-N 3.13Å; A20-A23 WeakPolarHBondContact O-CB 3.35Å; A20-A23 PolarHBondContact O-N 3.29Å; A20-A23 VanDerWaalsContact O-N 3.08Å
21	K	46.8	Very low	55.1	Low	177 Å²	177	101.2 Å²	101.2	77%	0.77	59%	0.586	S	S	*	*	H	α-helix	trans	-66.1	-24.8	172.3	-163	177.4	178.3	72.3	0	112.6	S17 A18 R19	S17-K21 PolarHBondContact O-N 3.47Å; A18-K21 PolarHBondContact O-N 2.84Å; R19-K21 VanDerWaalsContact C-N 3.34Å
22	E	47.4	Very low	54.3	Low	122 Å²	122	99 Å²	99	57%	0.57	58%	0.577	S	S	*	*	H	α-helix	trans	-79	-24.6	172.4	-61.7	175.9	167.3	0	0	112.3	R19 A20 G25	R19-E22 WeakPolarHBondContact O-CB 3.44Å; R19-E22 PolarHBondContact O-N 3.25Å; A20-E22 PolarHBondContact O-N 3.13Å; E22-G25 PolarHBondContact O-N 3.32Å
23	A	44.5	Very low	53.3	Low	70 Å²	70	99.9 Å²	99.9	58%	0.579	58%	0.579	S	S	*	*	H	α-helix	trans	-79.3	-19.6	-172.1	0	0	0	0	0	114.7	R19 A20 G25	R19-A23 PolarHBondContact O-N 3.15Å; A20-A23 WeakPolarHBondContact O-CB 3.35Å; A20-A23 PolarHBondContact O-N 3.29Å; A20-A23 VanDerWaalsContact O-N 3.08Å; A23-G25 PolarHBondContact O-N 2.88Å
24	E	44.9	Very low	52.5	Low	183 Å²	183	99.3 Å²	99.3	86%	0.855	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.9	-10	170.1	-66.7	-174.1	170.5	0	0	112.4	S26	E24-S26 VanDerWaalsContact C-N 3.29Å; E24-S26 PolarHBondContact O-N 3.03Å
25	G	45.8	Very low	51.6	Low	19 Å²	19	102.3 Å²	102.3	20%	0.196	58%	0.583	C	S	.	*	T	Hydrogen-bonded Turn	trans	-82.5	20.1	176.8	0	0	0	0	0	115.6	E22 A23 L27 L28 L29	E22-G25 PolarHBondContact O-N 3.32Å; A23-G25 PolarHBondContact O-N 2.88Å; G25-L27 PolarHBondContact O-N 2.75Å; G25-L27 VanDerWaalsContact O-N 3.08Å; G25-L28 CarbonylContact O-C 3.59Å; G25-L28 WeakPolarHBondContact O-CA 3.24Å; G25-L28 PolarHBondContact O-N 3.46Å; G25-L29 PolarHBondContact O-N 2.77Å; G25-L29 VanDerWaalsContact O-N 3.09Å
26	S	45.1	Very low	51.2	Low	92 Å²	92	103 Å²	103	64%	0.643	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.4	-18.5	-176.9	-167.8	0	0	0	0	114.2	E24	E24-S26 VanDerWaalsContact C-N 3.29Å; E24-S26 PolarHBondContact O-N 3.03Å
27	L	48.7	Very low	51	Low	175 Å²	175	106.6 Å²	106.6	92%	0.916	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	-14	173.3	-147.2	134	0	0	0	112.8	G25	G25-L27 PolarHBondContact O-N 2.75Å; G25-L27 VanDerWaalsContact O-N 3.08Å
28	L	50.9	Low	51	Low	109 Å²	109	110.1 Å²	110.1	57%	0.571	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98	-1.7	173.5	-79.6	165.7	0	0	0	112.8	G25 G30 S31 V32	G25-L28 CarbonylContact O-C 3.59Å; G25-L28 WeakPolarHBondContact O-CA 3.24Å; G25-L28 PolarHBondContact O-N 3.46Å; L28-G30 VanDerWaalsContact C-N 3.32Å; L28-G30 PolarHBondContact O-N 2.81Å; L28-S31 PolarHBondContact O-N 3.43Å; L28-S31 PolarHBondContact O-OG 2.74Å; L28-S31 VanDerWaalsContact O-OG 3.08Å; L28-V32 WeakPolarHBondContact O-CB 3.07Å; L28-V32 VanDerWaalsContact O-CG2 3.27Å; L28-V32 WeakPolarHBondContact O-CG2 3.42Å; L28-V32 PolarHBondContact O-N 3.33Å
29	L	52.8	Low	51.2	Low	98 Å²	98	109.8 Å²	109.8	51%	0.513	60%	0.596	S	S	.	*	H	α-helix	trans	-66.2	-32.3	-177.8	-124.4	75.9	0	0	0	112.8	G25 S31 Q33	G25-L29 PolarHBondContact O-N 2.77Å; G25-L29 VanDerWaalsContact O-N 3.09Å; L29-S31 VanDerWaalsContact C-N 3.34Å; L29-S31 PolarHBondContact O-N 2.74Å; L29-Q33 WeakPolarHBondContact O-CB 3.04Å; L29-Q33 PolarHBondContact O-N 3.47Å
30	G	52.5	Low	51.6	Low	70 Å²	70	103.6 Å²	103.6	72%	0.722	58%	0.583	S	S	*	*	H	α-helix	trans	-69	-29	179.3	0	0	0	0	0	114	L28	L28-G30 VanDerWaalsContact C-N 3.32Å; L28-G30 PolarHBondContact O-N 2.81Å
31	S	52.7	Low	52.3	Low	67 Å²	67	107.8 Å²	107.8	47%	0.469	59%	0.591	S	S	.	*	H	α-helix	trans	-91	-32.7	176.8	54.4	0	0	0	0	112.4	L28 L29 Y35	L28-S31 PolarHBondContact O-N 3.43Å; L28-S31 PolarHBondContact O-OG 2.74Å; L28-S31 VanDerWaalsContact O-OG 3.08Å; L29-S31 VanDerWaalsContact C-N 3.34Å; L29-S31 PolarHBondContact O-N 2.74Å; S31-Y35 WeakPolarHBondContact O-CD2 3.1Å
32	V	54.7	Low	52.9	Low	66 Å²	66	107.3 Å²	107.3	40%	0.4	59%	0.589	S	S	.	*	H	α-helix	trans	-75.6	-30.6	177.8	177.6	0	0	0	0	111.8	L28 G34 Y35 M36	L28-V32 WeakPolarHBondContact O-CB 3.07Å; L28-V32 VanDerWaalsContact O-CG2 3.27Å; L28-V32 WeakPolarHBondContact O-CG2 3.42Å; L28-V32 PolarHBondContact O-N 3.33Å; V32-G34 VanDerWaalsContact C-N 3.3Å; V32-G34 PolarHBondContact O-N 3.32Å; V32-Y35 CarbonylContact O-C 3.49Å; V32-Y35 PolarHBondContact O-N 3.42Å; V32-M36 HydrophobicContact CG1-CB 4.42Å; V32-M36 VanDerWaalsContact O-CB 3.26Å; V32-M36 WeakPolarHBondContact O-CB 3.17Å; V32-M36 PolarHBondContact O-N 3.44Å
33	Q	52.2	Low	53.6	Low	129 Å²	129	105.3 Å²	105.3	60%	0.603	59%	0.585	S	S	*	*	H	α-helix	trans	-59	-38.5	-178.8	-169.4	167.1	17	0	0	113	L29 M36 E37	L29-Q33 WeakPolarHBondContact O-CB 3.04Å; L29-Q33 PolarHBondContact O-N 3.47Å; Q33-M36 PolarHBondContact O-N 2.94Å; Q33-E37 PolarHBondContact O-N 3.37Å; Q33-E37 VanDerWaalsContact O-N 3.07Å
34	G	58.4	Low	54.4	Low	46 Å²	46	107.8 Å²	107.8	47%	0.474	59%	0.585	S	S	.	*	H	α-helix	trans	-69.7	-33.1	174.2	0	0	0	0	0	114	V32	V32-G34 VanDerWaalsContact C-N 3.3Å; V32-G34 PolarHBondContact O-N 3.32Å
35	Y	54.3	Low	55.3	Low	185 Å²	185	104.9 Å²	104.9	73%	0.725	58%	0.575	S	S	*	*	H	α-helix	trans	-77.2	-33	173.5	-83.4	-82.2	0	0	0	112.4	S31 V32 H38 A39	S31-Y35 WeakPolarHBondContact O-CD2 3.1Å; V32-Y35 CarbonylContact O-C 3.49Å; V32-Y35 PolarHBondContact O-N 3.42Å; Y35-H38 PolarHBondContact O-N 3.07Å; Y35-A39 WeakPolarHBondContact O-CB 3.2Å; Y35-A39 PolarHBondContact O-N 3.43Å
36	M	56.4	Low	56	Low	123 Å²	123	106.6 Å²	106.6	61%	0.606	59%	0.587	S	S	*	*	H	α-helix	trans	-72.7	-36	-178.5	-154.5	178	-123.3	0	0	110.8	V32 Q33 A40	V32-M36 HydrophobicContact CG1-CB 4.42Å; V32-M36 VanDerWaalsContact O-CB 3.26Å; V32-M36 WeakPolarHBondContact O-CB 3.17Å; V32-M36 PolarHBondContact O-N 3.44Å; Q33-M36 PolarHBondContact O-N 2.94Å; M36-A40 WeakPolarHBondContact O-CA 2.93Å; M36-A40 WeakPolarHBondContact O-CB 3.39Å; M36-A40 PolarHBondContact O-N 2.72Å
37	E	58.5	Low	56.6	Low	134 Å²	134	107.1 Å²	107.1	63%	0.626	58%	0.582	S	S	*	*	H	α-helix	trans	-64	-42.8	171.6	-105.2	-175.1	127.8	0	0	112.4	Q33 K41	Q33-E37 PolarHBondContact O-N 3.37Å; Q33-E37 VanDerWaalsContact O-N 3.07Å; E37-K41 PolarHBondContact O-N 3.04Å
38	H	55.4	Low	57.3	Low	153 Å²	153	101.7 Å²	101.7	71%	0.708	56%	0.556	S	S	*	*	H	α-helix	trans	-71.6	-41.1	179.4	-114.3	-85.3	0	0	0	112.3	Y35 K42	Y35-H38 PolarHBondContact O-N 3.07Å; H38-K42 WeakPolarHBondContact O-CB 3.15Å; H38-K42 PolarHBondContact O-N 2.85Å; H38-K42 VanDerWaalsContact O-N 3.13Å
39	A	58.2	Low	57.5	Low	52 Å²	52	99.8 Å²	99.8	43%	0.43	55%	0.552	S	S	.	*	H	α-helix	trans	-70.5	-40.9	175.8	0	0	0	0	0	111.1	Y35 K42 V43	Y35-A39 WeakPolarHBondContact O-CB 3.2Å; Y35-A39 PolarHBondContact O-N 3.43Å; A39-K42 PolarHBondContact O-N 3.37Å; A39-V43 WeakPolarHBondContact O-CB 3Å; A39-V43 WeakPolarHBondContact O-CG2 3.43Å; A39-V43 PolarHBondContact O-N 3.16Å
40	A	57.7	Low	57.6	Low	50 Å²	50	98.5 Å²	98.5	41%	0.413	55%	0.548	S	S	.	.	H	α-helix	trans	-62.6	-44.3	177.1	0	0	0	0	0	111	M36 K42 V43 Q44	M36-A40 WeakPolarHBondContact O-CA 2.93Å; M36-A40 WeakPolarHBondContact O-CB 3.39Å; M36-A40 PolarHBondContact O-N 2.72Å; A40-K42 PolarHBondContact O-N 3.26Å; A40-V43 PolarHBondContact O-N 3.48Å; A40-Q44 WeakPolarHBondContact O-CA 3.32Å; A40-Q44 WeakPolarHBondContact O-CB 3.35Å; A40-Q44 PolarHBondContact O-N 2.72Å
41	K	59.9	Low	57.6	Low	144 Å²	144	101.5 Å²	101.5	63%	0.626	54%	0.544	S	S	*	.	H	α-helix	trans	-61.5	-43.3	174	-94.1	179	174.7	161.3	0	112.6	E37 Q44 D45	E37-K41 PolarHBondContact O-N 3.04Å; K41-Q44 PolarHBondContact O-N 3.28Å; K41-D45 WeakPolarHBondContact O-CB 3.2Å; K41-D45 PolarHBondContact O-N 2.98Å
42	K	59.8	Low	57.8	Low	167 Å²	167	106.1 Å²	106.1	73%	0.726	56%	0.558	S	S	*	*	H	α-helix	trans	-70.8	-36.2	-178.8	-141	174.5	-172	164.6	0	112.7	H38 A39 A40 A46	H38-K42 WeakPolarHBondContact O-CB 3.15Å; H38-K42 PolarHBondContact O-N 2.85Å; H38-K42 VanDerWaalsContact O-N 3.13Å; A39-K42 PolarHBondContact O-N 3.37Å; A40-K42 PolarHBondContact O-N 3.26Å; K42-A46 WeakPolarHBondContact O-CB 3.22Å; K42-A46 PolarHBondContact O-N 3.45Å
43	V	62.5	Low	57.7	Low	80 Å²	80	106.9 Å²	106.9	49%	0.485	57%	0.566	S	S	.	*	H	α-helix	trans	-70.5	-37.7	173	168.9	0	0	0	0	110.1	A39 A40 L47	A39-V43 WeakPolarHBondContact O-CB 3Å; A39-V43 WeakPolarHBondContact O-CG2 3.43Å; A39-V43 PolarHBondContact O-N 3.16Å; A40-V43 PolarHBondContact O-N 3.48Å; V43-L47 HydrophobicContact CG1-CD1 3.5Å; V43-L47 VanDerWaalsContact CG1-CD1 3.5Å; V43-L47 HydrophobicContact CG1-CG 4.08Å; V43-L47 WeakPolarHBondContact O-CA 3.26Å; V43-L47 WeakPolarHBondContact O-CB 3.46Å; V43-L47 WeakPolarHBondContact O-CD1 3.04Å; V43-L47 WeakPolarHBondContact O-CG 3.24Å; V43-L47 PolarHBondContact O-N 3.07Å
44	Q	62	Low	57.8	Low	122 Å²	122	106.3 Å²	106.3	57%	0.57	56%	0.563	S	S	*	*	H	α-helix	trans	-70.4	-39.9	177.7	-168.5	171.5	12.2	0	0	111.8	A40 K41 T48	A40-Q44 WeakPolarHBondContact O-CA 3.32Å; A40-Q44 WeakPolarHBondContact O-CB 3.35Å; A40-Q44 PolarHBondContact O-N 2.72Å; K41-Q44 PolarHBondContact O-N 3.28Å; Q44-T48 VanDerWaalsContact O-CB 3.23Å; Q44-T48 WeakPolarHBondContact O-CB 3.45Å; Q44-T48 PolarHBondContact O-N 3.08Å; Q44-T48 PolarHBondContact O-OG1 2.81Å
45	D	63.2	Low	57.7	Low	121 Å²	121	108.5 Å²	108.5	65%	0.647	56%	0.563	S	S	*	*	H	α-helix	trans	-67.3	-42.7	172.6	-86.4	-10.1	0	0	0	111.7	K41 T48 S49	K41-D45 WeakPolarHBondContact O-CB 3.2Å; K41-D45 PolarHBondContact O-N 2.98Å; D45-T48 PolarHBondContact O-N 3.39Å; D45-S49 VanDerWaalsContact O-CB 3.25Å; D45-S49 WeakPolarHBondContact O-CB 3.18Å; D45-S49 PolarHBondContact O-N 3.45Å
46	A	60.2	Low	57.8	Low	55 Å²	55	103.6 Å²	103.6	46%	0.455	56%	0.56	S	S	.	*	H	α-helix	trans	-67.1	-40.1	175.5	0	0	0	0	0	112	K42 S49 V50	K42-A46 WeakPolarHBondContact O-CB 3.22Å; K42-A46 PolarHBondContact O-N 3.45Å; A46-S49 PolarHBondContact O-N 3.34Å; A46-V50 WeakPolarHBondContact O-CB 3.27Å; A46-V50 WeakPolarHBondContact O-CG2 3.5Å; A46-V50 PolarHBondContact O-N 3.37Å
47	L	58.7	Low	57.8	Low	103 Å²	103	102.7 Å²	102.7	54%	0.539	56%	0.561	S	S	.	*	H	α-helix	trans	-65.7	-41.4	175.3	-80.5	167.3	0	0	0	111.2	V43 V50 Q51	V43-L47 HydrophobicContact CG1-CD1 3.5Å; V43-L47 VanDerWaalsContact CG1-CD1 3.5Å; V43-L47 HydrophobicContact CG1-CG 4.08Å; V43-L47 WeakPolarHBondContact O-CA 3.26Å; V43-L47 WeakPolarHBondContact O-CB 3.46Å; V43-L47 WeakPolarHBondContact O-CD1 3.04Å; V43-L47 WeakPolarHBondContact O-CG 3.24Å; V43-L47 PolarHBondContact O-N 3.07Å; L47-V50 PolarHBondContact O-N 3.36Å; L47-Q51 WeakPolarHBondContact O-CA 3.2Å; L47-Q51 WeakPolarHBondContact O-CB 3.2Å; L47-Q51 PolarHBondContact O-N 2.8Å
48	T	61.9	Low	57.9	Low	61 Å²	61	100.9 Å²	100.9	37%	0.374	55%	0.553	S	S	.	*	H	α-helix	trans	-66.8	-42.4	177.6	-57.2	0	0	0	0	110.6	Q44 D45 V50 Q51 E52	Q44-T48 VanDerWaalsContact O-CB 3.23Å; Q44-T48 WeakPolarHBondContact O-CB 3.45Å; Q44-T48 PolarHBondContact O-N 3.08Å; Q44-T48 PolarHBondContact O-OG1 2.81Å; D45-T48 PolarHBondContact O-N 3.39Å; T48-V50 PolarHBondContact O-N 2.71Å; T48-Q51 PolarHBondContact O-N 3.4Å; T48-E52 PolarHBondContact O-N 3.48Å
49	S	55.4	Low	58.2	Low	70 Å²	70	96 Å²	96	49%	0.49	54%	0.539	S	S	.	.	H	α-helix	trans	-64.4	-38.8	176.6	-176.7	0	0	0	0	113.2	D45 A46 S53	D45-S49 VanDerWaalsContact O-CB 3.25Å; D45-S49 WeakPolarHBondContact O-CB 3.18Å; D45-S49 PolarHBondContact O-N 3.45Å; A46-S49 PolarHBondContact O-N 3.34Å; S49-S53 WeakPolarHBondContact O-CB 3.27Å; S49-S53 PolarHBondContact O-N 2.86Å; S49-S53 PolarHBondContact O-OG 3.39Å
50	V	54.6	Low	58.2	Low	71 Å²	71	102.6 Å²	102.6	43%	0.43	55%	0.553	S	S	.	*	H	α-helix	trans	-75.4	-34.1	175.5	174.4	0	0	0	0	111.4	A46 L47 T48 S53 M55	A46-V50 WeakPolarHBondContact O-CB 3.27Å; A46-V50 WeakPolarHBondContact O-CG2 3.5Å; A46-V50 PolarHBondContact O-N 3.37Å; L47-V50 PolarHBondContact O-N 3.36Å; T48-V50 PolarHBondContact O-N 2.71Å; V50-S53 PolarHBondContact O-N 3.39Å; V50-M55 HydrophobicContact CB-CE 4.5Å; V50-M55 HydrophobicContact CG1-CE 3.9Å
51	Q	53.7	Low	58.5	Low	133 Å²	133	102.4 Å²	102.4	62%	0.621	56%	0.555	S	S	*	*	H	α-helix	trans	-64.9	-38.7	177.6	-177.8	174	49.6	0	0	112.2	L47 T48 M55	L47-Q51 WeakPolarHBondContact O-CA 3.2Å; L47-Q51 WeakPolarHBondContact O-CB 3.2Å; L47-Q51 PolarHBondContact O-N 2.8Å; T48-Q51 PolarHBondContact O-N 3.4Å; Q51-M55 HydrophobicContact CB-CE 3.99Å
52	E	55.7	Low	58.6	Low	163 Å²	163	104.1 Å²	104.1	76%	0.762	56%	0.558	S	S	*	*	H	α-helix	trans	-76.5	-27.6	176.3	-77.8	-173.6	138.5	0	0	113.6	T48	T48-E52 PolarHBondContact O-N 3.48Å
53	S	53.7	Low	58.7	Low	83 Å²	83	101.6 Å²	101.6	58%	0.58	55%	0.55	S	S	*	*	H	α-helix	trans	-86.3	-51.8	-167.7	-62	0	0	0	0	114.3	S49 V50	S49-S53 WeakPolarHBondContact O-CB 3.27Å; S49-S53 PolarHBondContact O-N 2.86Å; S49-S53 PolarHBondContact O-OG 3.39Å; V50-S53 PolarHBondContact O-N 3.39Å
54	E	52.9	Low	58.7	Low	116 Å²	116	104.4 Å²	104.4	54%	0.542	56%	0.562	S	S	.	*	T	Hydrogen-bonded Turn	trans	-153	12.7	-162.8	-84.9	-174.8	120	0	0	116.8	A56 V57 Q58	E54-A56 PolarHBondContact O-N 2.95Å; E54-V57 PolarHBondContact O-N 3.43Å; E54-V57 VanDerWaalsContact O-N 3.09Å; E54-Q58 HydrophobicContact CB-CB 4.49Å; E54-Q58 VanDerWaalsContact O-CB 3.22Å; E54-Q58 WeakPolarHBondContact O-CB 3.41Å; E54-Q58 PolarHBondContact O-N 3.08Å
55	M	56.8	Low	58.7	Low	93 Å²	93	101 Å²	101	46%	0.458	56%	0.56	S	S	.	*	H	α-helix	trans	-53.1	-36.6	-176	-66.8	-85.8	-169.7	0	0	113.5	V50 Q51 A59	V50-M55 HydrophobicContact CB-CE 4.5Å; V50-M55 HydrophobicContact CG1-CE 3.9Å; Q51-M55 HydrophobicContact CB-CE 3.99Å; M55-A59 WeakPolarHBondContact O-CB 3.42Å; M55-A59 PolarHBondContact O-N 3.09Å
56	A	55.8	Low	58.6	Low	82 Å²	82	96.1 Å²	96.1	68%	0.678	54%	0.538	S	S	*	.	H	α-helix	trans	-77.4	-33.3	-178.7	0	0	0	0	0	114	E54 R60	E54-A56 PolarHBondContact O-N 2.95Å; A56-R60 PolarHBondContact O-N 3.03Å
57	V	57.2	Low	58.7	Low	103 Å²	103	97.9 Å²	97.9	62%	0.624	54%	0.54	S	S	*	.	H	α-helix	trans	-85	-40.4	-179.6	178.6	0	0	0	0	110.2	E54 R60 G61	E54-V57 PolarHBondContact O-N 3.43Å; E54-V57 VanDerWaalsContact O-N 3.09Å; V57-R60 PolarHBondContact O-N 3.13Å; V57-G61 PolarHBondContact O-N 3.28Å
58	Q	60.9	Low	58.8	Low	97 Å²	97	97.2 Å²	97.2	45%	0.453	54%	0.544	S	S	.	.	H	α-helix	trans	-69.5	-37.5	176.2	-163.4	169.6	37.4	0	0	111.6	E54 R60 G61 W62	E54-Q58 HydrophobicContact CB-CB 4.49Å; E54-Q58 VanDerWaalsContact O-CB 3.22Å; E54-Q58 WeakPolarHBondContact O-CB 3.41Å; E54-Q58 PolarHBondContact O-N 3.08Å; Q58-R60 VanDerWaalsContact C-N 3.31Å; Q58-R60 PolarHBondContact O-N 3.3Å; Q58-G61 PolarHBondContact O-N 2.93Å; Q58-W62 WeakPolarHBondContact O-CB 3.38Å; Q58-W62 PolarHBondContact O-N 3.48Å
59	A	62.1	Low	58.9	Low	49 Å²	49	98.1 Å²	98.1	41%	0.405	55%	0.553	S	S	.	*	H	α-helix	trans	-62.4	-36.4	172	0	0	0	0	0	112.5	M55 M63	M55-A59 WeakPolarHBondContact O-CB 3.42Å; M55-A59 PolarHBondContact O-N 3.09Å; A59-M63 VanDerWaalsContact O-CB 3.3Å; A59-M63 WeakPolarHBondContact O-CB 3.44Å; A59-M63 VanDerWaalsContact O-CG 3.29Å; A59-M63 WeakPolarHBondContact O-CG 3.43Å; A59-M63 PolarHBondContact O-N 2.89Å
60	R	58.5	Low	59.6	Low	192 Å²	192	99.8 Å²	99.8	73%	0.725	56%	0.555	S	S	*	*	H	α-helix	trans	-65.4	-43.8	172.2	-89.6	-169.2	173.8	179.6	-0.6	112.2	A56 V57 Q58 W62 M63 D64	A56-R60 PolarHBondContact O-N 3.03Å; V57-R60 PolarHBondContact O-N 3.13Å; Q58-R60 VanDerWaalsContact C-N 3.31Å; Q58-R60 PolarHBondContact O-N 3.3Å; R60-W62 PolarHBondContact O-N 3.49Å; R60-M63 PolarHBondContact O-N 2.9Å; R60-D64 PolarHBondContact O-N 3.34Å
61	G	64	Low	60.5	Low	46 Å²	46	104 Å²	104	47%	0.474	57%	0.568	S	S	.	*	H	α-helix	trans	-63.6	-38.2	175.7	0	0	0	0	0	113.7	V57 Q58 G65	V57-G61 PolarHBondContact O-N 3.28Å; Q58-G61 PolarHBondContact O-N 2.93Å; G61-G65 PolarHBondContact O-N 3.14Å
62	W	61.9	Low	61.5	Low	180 Å²	180	99.7 Å²	99.7	68%	0.682	56%	0.559	S	S	*	*	H	α-helix	trans	-72.7	-32.1	173.4	-83.7	68.5	0	0	0	112.7	Q58 R60 G66 L67	Q58-W62 WeakPolarHBondContact O-CB 3.38Å; Q58-W62 PolarHBondContact O-N 3.48Å; R60-W62 PolarHBondContact O-N 3.49Å; W62-G66 CarbonylContact O-C 3.53Å; W62-G66 WeakPolarHBondContact O-CA 3.41Å; W62-G66 PolarHBondContact O-N 3.49Å; W62-L67 PolarHBondContact O-N 3.34Å
63	M	60.6	Low	62.4	Low	114 Å²	114	100.6 Å²	100.6	56%	0.562	56%	0.557	S	S	*	*	H	α-helix	trans	-66	-54.4	171.7	-82.8	179.4	63.7	0	0	110.8	A59 R60 L67	A59-M63 VanDerWaalsContact O-CB 3.3Å; A59-M63 WeakPolarHBondContact O-CB 3.44Å; A59-M63 VanDerWaalsContact O-CG 3.29Å; A59-M63 WeakPolarHBondContact O-CG 3.43Å; A59-M63 PolarHBondContact O-N 2.89Å; R60-M63 PolarHBondContact O-N 2.9Å; M63-L67 HydrophobicContact CB-CD1 3.75Å; M63-L67 HydrophobicContact CE-CD1 4.34Å; M63-L67 HydrophobicContact CG-CD1 3.72Å; M63-L67 WeakPolarHBondContact O-CB 3.3Å; M63-L67 WeakPolarHBondContact O-CD1 3.15Å; M63-L67 VanDerWaalsContact O-CG 3.24Å; M63-L67 WeakPolarHBondContact O-CG 3.22Å; M63-L67 PolarHBondContact O-N 2.83Å; M63-L67 VanDerWaalsContact O-N 3.15Å
64	D	62.8	Low	63.6	Low	138 Å²	138	104.9 Å²	104.9	74%	0.738	56%	0.56	S	S	*	*	H	α-helix	trans	-71	-41.5	-175.9	-82.9	-43.5	0	0	0	113.1	R60	R60-D64 PolarHBondContact O-N 3.34Å
65	G	61.5	Low	64.5	Low	50 Å²	50	103 Å²	103	52%	0.515	56%	0.56	S	S	.	*	H	α-helix	trans	-87.3	-37.6	-178.5	0	0	0	0	0	114.4	G61	G61-G65 PolarHBondContact O-N 3.14Å
66	G	62.4	Low	65.7	Low	19 Å²	19	102.5 Å²	102.5	20%	0.196	56%	0.562	C	S	.	*	H	α-helix	trans	-83.8	-41.3	-176.7	0	0	0	0	0	113.2	W62 S68 L70	W62-G66 CarbonylContact O-C 3.53Å; W62-G66 WeakPolarHBondContact O-CA 3.41Å; W62-G66 PolarHBondContact O-N 3.49Å; G66-S68 VanDerWaalsContact C-N 3.31Å; G66-S68 PolarHBondContact O-N 3.36Å; G66-L70 VanDerWaalsContact O-CB 3.22Å; G66-L70 WeakPolarHBondContact O-CB 3.34Å; G66-L70 WeakPolarHBondContact O-CD1 3.39Å; G66-L70 WeakPolarHBondContact O-CG 3.47Å; G66-L70 PolarHBondContact O-N 2.87Å
67	L	61.7	Low	66.9	Low	93 Å²	93	104.2 Å²	104.2	49%	0.487	56%	0.555	S	S	.	*	H	α-helix	trans	-67.1	-30.3	-178.2	-66.9	166.8	0	0	0	112.6	W62 M63 K71	W62-L67 PolarHBondContact O-N 3.34Å; M63-L67 HydrophobicContact CB-CD1 3.75Å; M63-L67 HydrophobicContact CE-CD1 4.34Å; M63-L67 HydrophobicContact CG-CD1 3.72Å; M63-L67 WeakPolarHBondContact O-CB 3.3Å; M63-L67 WeakPolarHBondContact O-CD1 3.15Å; M63-L67 VanDerWaalsContact O-CG 3.24Å; M63-L67 WeakPolarHBondContact O-CG 3.22Å; M63-L67 PolarHBondContact O-N 2.83Å; M63-L67 VanDerWaalsContact O-N 3.15Å; L67-K71 WeakPolarHBondContact O-CA 3.35Å; L67-K71 WeakPolarHBondContact O-CB 3.26Å; L67-K71 PolarHBondContact O-N 2.72Å
68	S	60.9	Low	68.1	Low	89 Å²	89	102.2 Å²	102.2	62%	0.622	54%	0.543	S	S	*	.	H	α-helix	trans	-65.9	-47.9	-179.8	-171.3	0	0	0	0	111.8	G66 K71 G72	G66-S68 VanDerWaalsContact C-N 3.31Å; G66-S68 PolarHBondContact O-N 3.36Å; S68-K71 PolarHBondContact O-N 3.46Å; S68-G72 PolarHBondContact O-N 2.82Å
69	S	64.4	Low	69.1	Low	80 Å²	80	103 Å²	103	56%	0.559	55%	0.55	S	S	*	*	H	α-helix	trans	-68.8	-42.5	175.7	-62.2	0	0	0	0	111.6	K71 G72 Y73	S69-K71 VanDerWaalsContact C-N 3.31Å; S69-K71 PolarHBondContact O-N 3.42Å; S69-G72 PolarHBondContact O-N 2.86Å; S69-Y73 WeakPolarHBondContact O-CD2 3.5Å; S69-Y73 PolarHBondContact O-N 3.38Å
70	L	69.1	Low	70.1	Confident	104 Å²	104	107.3 Å²	107.3	55%	0.545	56%	0.56	S	S	.	*	H	α-helix	trans	-67.4	-29.8	177.1	-72	165	0	0	0	112.4	G66 G72 Y73 W74	G66-L70 VanDerWaalsContact O-CB 3.22Å; G66-L70 WeakPolarHBondContact O-CB 3.34Å; G66-L70 WeakPolarHBondContact O-CD1 3.39Å; G66-L70 WeakPolarHBondContact O-CG 3.47Å; G66-L70 PolarHBondContact O-N 2.87Å; L70-G72 VanDerWaalsContact C-N 3.33Å; L70-G72 PolarHBondContact O-N 3.48Å; L70-Y73 PolarHBondContact O-N 2.87Å; L70-W74 WeakPolarHBondContact O-CA 3.48Å; L70-W74 WeakPolarHBondContact O-CB 3.26Å; L70-W74 PolarHBondContact O-N 3.39Å
71	K	72.9	Confident	71.1	Confident	159 Å²	159	103.4 Å²	103.4	69%	0.691	55%	0.548	S	S	*	.	H	α-helix	trans	-64.3	-39.1	176.3	-178.7	-175.2	-179.8	-161.2	0	111.1	L67 S68 S69 S75	L67-K71 WeakPolarHBondContact O-CA 3.35Å; L67-K71 WeakPolarHBondContact O-CB 3.26Å; L67-K71 PolarHBondContact O-N 2.72Å; S68-K71 PolarHBondContact O-N 3.46Å; S69-K71 VanDerWaalsContact C-N 3.31Å; S69-K71 PolarHBondContact O-N 3.42Å; K71-S75 VanDerWaalsContact O-CB 3.24Å; K71-S75 WeakPolarHBondContact O-CB 3.38Å; K71-S75 PolarHBondContact O-N 3.05Å
72	G	76.3	Confident	71.8	Confident	43 Å²	43	104.3 Å²	104.3	44%	0.443	55%	0.547	S	S	.	.	H	α-helix	trans	-62.7	-50.1	173.8	0	0	0	0	0	112.1	S68 S69 L70 S75 T76	S68-G72 PolarHBondContact O-N 2.82Å; S69-G72 PolarHBondContact O-N 2.86Å; L70-G72 VanDerWaalsContact C-N 3.33Å; L70-G72 PolarHBondContact O-N 3.48Å; G72-S75 PolarHBondContact O-N 2.8Å; G72-T76 PolarHBondContact O-N 2.86Å; G72-T76 VanDerWaalsContact O-N 3.16Å; G72-T76 PolarHBondContact O-OG1 3.4Å
73	Y	73.6	Confident	72.3	Confident	182 Å²	182	98.9 Å²	98.9	71%	0.714	54%	0.537	S	S	*	.	H	α-helix	trans	-64.2	-41	176.9	-79.9	-77.9	0	0	0	112.7	S69 L70 S75 T76 F77	S69-Y73 WeakPolarHBondContact O-CD2 3.5Å; S69-Y73 PolarHBondContact O-N 3.38Å; L70-Y73 PolarHBondContact O-N 2.87Å; Y73-S75 VanDerWaalsContact C-N 3.34Å; Y73-T76 PolarHBondContact O-N 3.3Å; Y73-F77 VanDerWaalsContact O-CB 3.27Å; Y73-F77 WeakPolarHBondContact O-CB 3.22Å; Y73-F77 PolarHBondContact O-N 2.83Å
74	W	79.2	Confident	73.1	Confident	173 Å²	173	99.3 Å²	99.3	66%	0.655	54%	0.541	S	S	*	.	H	α-helix	trans	-68	-34.8	178.7	-167.5	-98.8	0	0	0	111.7	L70 F77 T78	L70-W74 WeakPolarHBondContact O-CA 3.48Å; L70-W74 WeakPolarHBondContact O-CB 3.26Å; L70-W74 PolarHBondContact O-N 3.39Å; W74-F77 HydrophobicContact CE3-CD1 4.42Å; W74-F77 HydrophobicContact CZ3-CD1 4.31Å; W74-F77 PolarHBondContact O-N 2.91Å; W74-T78 PolarHBondContact NE1-OG1 3.45Å; W74-T78 WeakPolarHBondContact O-CB 3.2Å; W74-T78 PolarHBondContact O-N 3.42Å; W74-T78 PolarHBondContact O-OG1 2.77Å
75	S	72.5	Confident	73.7	Confident	77 Å²	77	100 Å²	100	54%	0.538	53%	0.533	S	S	.	.	H	α-helix	trans	-63.7	-49.4	173.6	-167.5	0	0	0	0	110.6	K71 G72 Y73 F77 T78 D79	K71-S75 VanDerWaalsContact O-CB 3.24Å; K71-S75 WeakPolarHBondContact O-CB 3.38Å; K71-S75 PolarHBondContact O-N 3.05Å; G72-S75 PolarHBondContact O-N 2.8Å; Y73-S75 VanDerWaalsContact C-N 3.34Å; S75-F77 VanDerWaalsContact C-N 3.33Å; S75-F77 PolarHBondContact O-N 2.83Å; S75-T78 PolarHBondContact O-N 3.43Å; S75-D79 WeakPolarHBondContact O-CB 3.3Å; S75-D79 PolarHBondContact O-N 2.89Å
76	T	81.3	Confident	74.1	Confident	82 Å²	82	102.1 Å²	102.1	50%	0.503	53%	0.533	S	S	.	.	H	α-helix	trans	-63.7	-39.5	177.2	-56	0	0	0	0	112	G72 Y73 K80	G72-T76 PolarHBondContact O-N 2.86Å; G72-T76 VanDerWaalsContact O-N 3.16Å; G72-T76 PolarHBondContact O-OG1 3.4Å; Y73-T76 PolarHBondContact O-N 3.3Å; T76-K80 WeakPolarHBondContact O-CB 3.23Å; T76-K80 WeakPolarHBondContact O-CG 3.49Å; T76-K80 PolarHBondContact O-N 3.35Å
77	F	81.5	Confident	74.1	Confident	119 Å²	119	104.6 Å²	104.6	52%	0.522	55%	0.547	S	S	.	.	H	α-helix	trans	-65.2	-45.5	176.6	-179.1	-97	0	0	0	111.6	Y73 W74 S75 K80 F81	Y73-F77 VanDerWaalsContact O-CB 3.27Å; Y73-F77 WeakPolarHBondContact O-CB 3.22Å; Y73-F77 PolarHBondContact O-N 2.83Å; W74-F77 HydrophobicContact CE3-CD1 4.42Å; W74-F77 HydrophobicContact CZ3-CD1 4.31Å; W74-F77 PolarHBondContact O-N 2.91Å; S75-F77 VanDerWaalsContact C-N 3.33Å; S75-F77 PolarHBondContact O-N 2.83Å; F77-K80 PolarHBondContact O-N 3.22Å; F77-F81 VanDerWaalsContact O-CB 3.26Å; F77-F81 WeakPolarHBondContact O-CB 3.35Å; F77-F81 PolarHBondContact O-N 3.23Å
78	T	81.8	Confident	73.8	Confident	60 Å²	60	104.6 Å²	104.6	37%	0.368	56%	0.555	S	S	.	*	H	α-helix	trans	-68	-37.9	178.5	-55.8	0	0	0	0	111.2	W74 S75 F81 S82	W74-T78 PolarHBondContact NE1-OG1 3.45Å; W74-T78 WeakPolarHBondContact O-CB 3.2Å; W74-T78 PolarHBondContact O-N 3.42Å; W74-T78 PolarHBondContact O-OG1 2.77Å; S75-T78 PolarHBondContact O-N 3.43Å; T78-F81 PolarHBondContact O-N 3.37Å; T78-S82 WeakPolarHBondContact O-CA 3.48Å; T78-S82 WeakPolarHBondContact O-CB 3.31Å; T78-S82 PolarHBondContact O-N 3.44Å
79	D	82.4	Confident	73.5	Confident	114 Å²	114	105.2 Å²	105.2	61%	0.61	56%	0.559	S	S	*	*	H	α-helix	trans	-61.9	-48.1	176	-173.2	-96	0	0	0	111.2	S75 F81 S82 S83	S75-D79 WeakPolarHBondContact O-CB 3.3Å; S75-D79 PolarHBondContact O-N 2.89Å; D79-F81 PolarHBondContact O-N 3.2Å; D79-S82 PolarHBondContact O-N 3.08Å; D79-S83 WeakPolarHBondContact O-CB 3.28Å; D79-S83 PolarHBondContact O-N 3.29Å
80	K	81.9	Confident	72.9	Confident	139 Å²	139	108.7 Å²	108.7	60%	0.604	57%	0.566	S	S	*	*	H	α-helix	trans	-63.6	-42.5	174	-72.8	-171.4	174.1	-162.5	0	112.6	T76 F77 S82 S83 L84	T76-K80 WeakPolarHBondContact O-CB 3.23Å; T76-K80 WeakPolarHBondContact O-CG 3.49Å; T76-K80 PolarHBondContact O-N 3.35Å; F77-K80 PolarHBondContact O-N 3.22Å; K80-S82 VanDerWaalsContact C-N 3.35Å; K80-S83 PolarHBondContact O-N 2.77Å; K80-L84 WeakPolarHBondContact O-CB 3.24Å; K80-L84 VanDerWaalsContact O-CG 3.23Å; K80-L84 WeakPolarHBondContact O-CG 3.23Å; K80-L84 PolarHBondContact O-N 3.43Å
81	F	80.5	Confident	71.9	Confident	110 Å²	110	106.8 Å²	106.8	48%	0.482	57%	0.566	S	S	.	*	H	α-helix	trans	-66.3	-39.1	177.9	-171.7	-94.4	0	0	0	111.6	F77 T78 D79 L84 W85	F77-F81 VanDerWaalsContact O-CB 3.26Å; F77-F81 WeakPolarHBondContact O-CB 3.35Å; F77-F81 PolarHBondContact O-N 3.23Å; T78-F81 PolarHBondContact O-N 3.37Å; D79-F81 PolarHBondContact O-N 3.2Å; F81-L84 PolarHBondContact O-N 3.31Å; F81-W85 HydrophobicContact CE1-CE3 4.35Å; F81-W85 HydrophobicContact CZ-CE3 4.27Å; F81-W85 VanDerWaalsContact O-CB 3.31Å; F81-W85 WeakPolarHBondContact O-CB 3.44Å; F81-W85 PolarHBondContact O-N 3.41Å
82	S	77.7	Confident	70.8	Confident	65 Å²	65	103.6 Å²	103.6	46%	0.455	56%	0.561	S	S	.	*	H	α-helix	trans	-66	-45	175.5	-163.5	0	0	0	0	110.5	T78 D79 K80 L84 W85 D86	T78-S82 WeakPolarHBondContact O-CA 3.48Å; T78-S82 WeakPolarHBondContact O-CB 3.31Å; T78-S82 PolarHBondContact O-N 3.44Å; D79-S82 PolarHBondContact O-N 3.08Å; K80-S82 VanDerWaalsContact C-N 3.35Å; S82-L84 VanDerWaalsContact C-N 3.33Å; S82-L84 PolarHBondContact O-N 3.17Å; S82-W85 PolarHBondContact O-N 2.94Å; S82-D86 VanDerWaalsContact O-CB 3.26Å; S82-D86 WeakPolarHBondContact O-CB 3.26Å; S82-D86 PolarHBondContact O-N 2.88Å
83	S	73.9	Confident	69.4	Low	67 Å²	67	107.2 Å²	107.2	47%	0.469	58%	0.577	S	S	.	*	H	α-helix	trans	-60.7	-40.1	175.1	174.3	0	0	0	0	112.4	D79 K80 S87	D79-S83 WeakPolarHBondContact O-CB 3.28Å; D79-S83 PolarHBondContact O-N 3.29Å; K80-S83 PolarHBondContact O-N 2.77Å; S83-S87 VanDerWaalsContact O-CB 3.24Å; S83-S87 WeakPolarHBondContact O-CB 3.43Å; S83-S87 PolarHBondContact O-N 2.73Å; S83-S87 PolarHBondContact O-OG 2.88Å
84	L	77.8	Confident	68.2	Low	122 Å²	122	104.1 Å²	104.1	64%	0.639	58%	0.577	S	S	*	*	H	α-helix	trans	-66.7	-39	174.1	-73	170.5	0	0	0	112.2	K80 F81 S82 S88	K80-L84 WeakPolarHBondContact O-CB 3.24Å; K80-L84 VanDerWaalsContact O-CG 3.23Å; K80-L84 WeakPolarHBondContact O-CG 3.23Å; K80-L84 PolarHBondContact O-N 3.43Å; F81-L84 PolarHBondContact O-N 3.31Å; S82-L84 VanDerWaalsContact C-N 3.33Å; S82-L84 PolarHBondContact O-N 3.17Å; L84-S88 WeakPolarHBondContact O-CB 3.24Å; L84-S88 PolarHBondContact O-N 2.91Å
85	W	75.1	Confident	66.9	Low	153 Å²	153	101.1 Å²	101.1	58%	0.58	58%	0.58	S	S	*	*	H	α-helix	trans	-70.3	-39.5	177.8	-165.4	-90.7	0	0	0	112.2	L6 F81 S82 S88 S89	L6-W85 HydrophobicContact CD1-CH2 4.3Å; F81-W85 HydrophobicContact CE1-CE3 4.35Å; F81-W85 HydrophobicContact CZ-CE3 4.27Å; F81-W85 VanDerWaalsContact O-CB 3.31Å; F81-W85 WeakPolarHBondContact O-CB 3.44Å; F81-W85 PolarHBondContact O-N 3.41Å; S82-W85 PolarHBondContact O-N 2.94Å; W85-S88 PolarHBondContact O-N 3.15Å; W85-S89 PolarHBondContact O-N 3.31Å; W85-S89 VanDerWaalsContact O-N 3.15Å
86	D	68.6	Low	65.6	Low	95 Å²	95	101.7 Å²	101.7	51%	0.508	59%	0.589	S	S	.	*	H	α-helix	trans	-67.6	-43.3	176	-148.6	-85.9	0	0	0	110.6	S82 S88 S89 E90	S82-D86 VanDerWaalsContact O-CB 3.26Å; S82-D86 WeakPolarHBondContact O-CB 3.26Å; S82-D86 PolarHBondContact O-N 2.88Å; D86-S88 VanDerWaalsContact C-N 3.27Å; D86-S88 PolarHBondContact O-N 3.3Å; D86-S89 CarbonylContact O-C 3.51Å; D86-S89 WeakPolarHBondContact O-CA 3.48Å; D86-S89 WeakPolarHBondContact O-CB 3.5Å; D86-S89 PolarHBondContact O-N 3.03Å; D86-E90 WeakPolarHBondContact O-CB 3.42Å; D86-E90 PolarHBondContact O-N 2.83Å
87	S	63	Low	64.7	Low	70 Å²	70	104 Å²	104	49%	0.49	60%	0.603	S	S	.	*	H	α-helix	trans	-61.8	-32.7	172.5	-60.5	0	0	0	0	112.9	S83 S89 A91	S83-S87 VanDerWaalsContact O-CB 3.24Å; S83-S87 WeakPolarHBondContact O-CB 3.43Å; S83-S87 PolarHBondContact O-N 2.73Å; S83-S87 PolarHBondContact O-OG 2.88Å; S87-S89 VanDerWaalsContact C-N 3.29Å; S87-A91 PolarHBondContact O-N 3.13Å; S87-A91 VanDerWaalsContact O-N 3.13Å
88	S	55.6	Low	62.6	Low	93 Å²	93	107 Å²	107	65%	0.65	62%	0.619	S	S	*	*	H	α-helix	trans	-73.5	-20.6	173.1	-171.8	0	0	0	0	113	L84 W85 D86	L84-S88 WeakPolarHBondContact O-CB 3.24Å; L84-S88 PolarHBondContact O-N 2.91Å; W85-S88 PolarHBondContact O-N 3.15Å; D86-S88 VanDerWaalsContact C-N 3.27Å; D86-S88 PolarHBondContact O-N 3.3Å
89	S	53.9	Low	60.9	Low	102 Å²	102	113.4 Å²	113.4	71%	0.713	66%	0.662	S	S	*	*	H	α-helix	trans	-91.2	-26.6	175.5	-167.2	0	0	0	0	112.5	W85 D86 S87	W85-S89 PolarHBondContact O-N 3.31Å; W85-S89 VanDerWaalsContact O-N 3.15Å; D86-S89 CarbonylContact O-C 3.51Å; D86-S89 WeakPolarHBondContact O-CA 3.48Å; D86-S89 WeakPolarHBondContact O-CB 3.5Å; D86-S89 PolarHBondContact O-N 3.03Å; S87-S89 VanDerWaalsContact C-N 3.29Å
90	E	51.6	Low	59.9	Low	153 Å²	153	113.4 Å²	113.4	72%	0.715	66%	0.664	S	S	*	*	H	α-helix	trans	-94	-6.5	180	-161.8	168.9	91.1	0	0	113.1	D86 P92	D86-E90 WeakPolarHBondContact O-CB 3.42Å; D86-E90 PolarHBondContact O-N 2.83Å; E90-P92 WeakPolarHBondContact O-CD 2.9Å; E90-P92 VanDerWaalsContact O-N 3.15Å
91	A	48.2	Very low	58.7	Low	64 Å²	64	112.1 Å²	112.1	53%	0.529	67%	0.668	S	S	.	*			trans	-70	104.3	165.9	0	0	0	0	0	109.1	S87	S87-A91 PolarHBondContact O-N 3.13Å; S87-A91 VanDerWaalsContact O-N 3.13Å
92	P	50.2	Low	57.5	Low	93 Å²	93	112.2 Å²	112.2	60%	0.604	68%	0.678	S	S	*	*			trans	-59.1	144.9	166	28.3	-34.7	0	0	0	107.6	E90 T94	E90-P92 WeakPolarHBondContact O-CD 2.9Å; E90-P92 VanDerWaalsContact O-N 3.15Å; P92-T94 PolarHBondContact O-N 2.99Å
93	P	47.8	Very low	56.3	Low	119 Å²	119	114.9 Å²	114.9	77%	0.773	69%	0.691	S	S	*	*			trans	-56.6	119.6	160.1	27.4	-30.3	0	0	0	105.1	P95	P93-P95 WeakPolarHBondContact O-CD 2.83Å
94	T	46.9	Very low	55.2	Low	117 Å²	117	117.9 Å²	117.9	72%	0.718	71%	0.705	S	S	*	*			trans	-84.5	94.7	163.5	-59.1	0	0	0	0	106.3	P92 A96	P92-T94 PolarHBondContact O-N 2.99Å; T94-A96 VanDerWaalsContact C-N 3.28Å; T94-A96 HydrophobicContact CG2-CB 3.8Å; T94-A96 PolarHBondContact O-N 3.3Å
95	P	53	Low	53.7	Low	110 Å²	110	117.7 Å²	117.7	71%	0.714	71%	0.709	S	S	*	*			trans	-82.3	87.3	152.9	34.7	-29.6	0	0	0	106.1	P93 T97	P93-P95 WeakPolarHBondContact O-CD 2.83Å; P95-T97 PolarHBondContact O-N 3.49Å
96	A	46	Very low	52.1	Low	88 Å²	88	115.1 Å²	115.1	73%	0.727	72%	0.719	S	S	*	*			trans	-96.9	65.5	158.4	0	0	0	0	0	107.2	T94	T94-A96 VanDerWaalsContact C-N 3.28Å; T94-A96 HydrophobicContact CG2-CB 3.8Å; T94-A96 PolarHBondContact O-N 3.3Å
97	T	60.5	Low	50.9	Low	130 Å²	130	116.7 Å²	116.7	80%	0.798	74%	0.735	S	S	*	*			trans	-105.4	96.6	156.6	-64.3	0	0	0	0	105.8	P95	P95-T97 PolarHBondContact O-N 3.49Å
98	E	38.1	Very low	49.9	Very low	183 Å²	183	120.6 Å²	120.6	86%	0.855	76%	0.755	S	S	*	*			trans	-158.5	157.5	156.1	-71.7	-161.9	105.9	0	0	108.2
99	P	46.8	Very low	49.4	Very low	195 Å²	195	123.1 Å²	123.1	100%	1.266	77%	0.765	S	S	*	*			cis	-116	0	-44.2	34.8	-24.2	0	0	0	113

Retrieved 99 of 99 residues in 78.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).