A0A061IDB4_CRIGR Loading...

Transmembrane protein 14C

Required for normal heme biosynthesis.

AlphaFold DB , UniProt , Accession A0A061IDB4, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Tmem14c, Length 114 aa.

						>A0A061IDB4_CRIGR|A0A061IDB4|Tmem14c
MQKDSGPLVPLHYLGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGSLAGYGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVVKLGISMLSSPQP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40	Very low	47.6	Very low	237 Å²	237	130.2 Å²	130.2	100%	1.167	72%	0.724	S	S	*	*				0	119.8	0	-72.9	143.1	164	0	0	105.6
2	Q	38.6	Very low	48	Very low	144 Å²	144	130 Å²	130	67%	0.673	71%	0.713	S	S	*	*			cis	-155.5	129.4	33.7	-176.2	74.2	23.8	0	0	108.3	D4	Q2-D4 WeakPolarHBondContact CG-OD2 3.27Å; Q2-D4 PolarHBondContact NE2-OD1 2.89Å; Q2-D4 PolarHBondContact NE2-OD2 2.88Å
3	K	49.3	Very low	48.7	Very low	197 Å²	197	134.8 Å²	134.8	86%	0.857	72%	0.717	S	S	*	*			trans	-86.3	116.4	164.6	-104.2	167	158.9	163.1	0	105.4
4	D	41.4	Very low	49.5	Very low	124 Å²	124	134.1 Å²	134.1	66%	0.663	71%	0.712	S	S	*	*			trans	-137.3	101.7	163.2	-71.6	-50.7	0	0	0	106.4	Q2	Q2-D4 WeakPolarHBondContact CG-OD2 3.27Å; Q2-D4 PolarHBondContact NE2-OD1 2.89Å; Q2-D4 PolarHBondContact NE2-OD2 2.88Å
5	S	55.5	Low	50.4	Low	114 Å²	114	127.7 Å²	127.7	80%	0.797	69%	0.691	S	S	*	*				74.8	80	70.6	-59.7	0	0	0	0	112.8
6	G	44.9	Very low	51.4	Low	50 Å²	50	130.1 Å²	130.1	52%	0.515	69%	0.694	S	S	.	*			trans	-145.5	143.4	159.5	0	0	0	0	0	108.4	L8	G6-L8 WeakPolarHBondContact O-CG 3.31Å; G6-L8 PolarHBondContact O-N 3.39Å
7	P	44.7	Very low	53	Low	118 Å²	118	124.6 Å²	124.6	77%	0.766	68%	0.675	S	S	*	*			trans	-62.8	100.8	-139.2	24.8	-34.1	0	0	0	115.3	V9 P10	P7-V9 PolarHBondContact O-N 3.4Å; P7-P10 VanDerWaalsContact O-CD 3.25Å; P7-P10 WeakPolarHBondContact O-CD 3.14Å
8	L	48.9	Very low	53.1	Low	128 Å²	128	126.9 Å²	126.9	67%	0.67	67%	0.674	S	S	*	*			trans	-79.3	39.8	-179	-64.4	168.5	0	0	0	114	G6 H12	G6-L8 WeakPolarHBondContact O-CG 3.31Å; G6-L8 PolarHBondContact O-N 3.39Å; L8-H12 PolarHBondContact O-CD2 3.47Å; L8-H12 VanDerWaalsContact O-CD2 3.23Å
9	V	52.7	Low	53.5	Low	106 Å²	106	123.3 Å²	123.3	64%	0.642	66%	0.663	S	S	*	*	S	Bend	trans	-111.2	-34.5	-179.6	-66.2	0	0	0	0	115.4	P7	P7-V9 PolarHBondContact O-N 3.4Å
10	P	52.8	Low	54.7	Low	77 Å²	77	119.4 Å²	119.4	50%	0.5	65%	0.649	S	S	.	*	H	α-helix	trans	-80	-35.7	-177	-11.9	28.7	0	0	0	113.5	P7 Y13 L14	P7-P10 VanDerWaalsContact O-CD 3.25Å; P7-P10 WeakPolarHBondContact O-CD 3.14Å; P10-Y13 PolarHBondContact O-N 2.89Å; P10-L14 WeakPolarHBondContact O-CG 2.89Å; P10-L14 PolarHBondContact O-N 3.39Å
11	L	55.2	Low	55.7	Low	137 Å²	137	119.5 Å²	119.5	72%	0.717	65%	0.648	S	S	*	*	H	α-helix	trans	-72.7	-33.3	-175.3	-89.7	157.4	0	0	0	113	G15	L11-G15 PolarHBondContact O-N 2.84Å
12	H	52.3	Low	57.1	Low	128 Å²	128	112.1 Å²	112.1	59%	0.593	62%	0.616	S	S	*	*	H	α-helix	trans	-70.3	-39	175.9	-74.2	-83.3	0	0	0	111.6	L8 G15 F16	L8-H12 PolarHBondContact O-CD2 3.47Å; L8-H12 VanDerWaalsContact O-CD2 3.23Å; H12-G15 PolarHBondContact O-N 2.89Å; H12-F16 VanDerWaalsContact O-CB 3.32Å; H12-F16 WeakPolarHBondContact O-CB 3.19Å; H12-F16 PolarHBondContact O-N 3.46Å
13	Y	56.5	Low	58.8	Low	193 Å²	193	107.8 Å²	107.8	76%	0.757	61%	0.605	S	S	*	*	H	α-helix	trans	-66.3	-42	174	-102.7	-86.4	0	0	0	112.3	P10 F16 G17	P10-Y13 PolarHBondContact O-N 2.89Å; Y13-F16 PolarHBondContact O-N 2.78Å; Y13-G17 PolarHBondContact O-N 3.19Å
14	L	59.6	Low	59.8	Low	124 Å²	124	101.8 Å²	101.8	65%	0.649	59%	0.585	S	S	*	*	H	α-helix	trans	-65.4	-40.4	174.2	-75.6	172.2	0	0	0	111.9	P10 G17 Y18	P10-L14 WeakPolarHBondContact O-CG 2.89Å; P10-L14 PolarHBondContact O-N 3.39Å; L14-G17 PolarHBondContact O-N 2.88Å; L14-Y18 VanDerWaalsContact O-CB 3.28Å; L14-Y18 WeakPolarHBondContact O-CB 3.48Å; L14-Y18 PolarHBondContact O-N 3.48Å
15	G	63.7	Low	61	Low	39 Å²	39	98 Å²	98	40%	0.402	58%	0.575	S	S	.	*	H	α-helix	trans	-64.4	-41.3	174.6	0	0	0	0	0	112.6	L11 H12 Y18 A19	L11-G15 PolarHBondContact O-N 2.84Å; H12-G15 PolarHBondContact O-N 2.89Å; G15-Y18 PolarHBondContact O-N 2.66Å; G15-A19 VanDerWaalsContact O-CB 3.27Å; G15-A19 WeakPolarHBondContact O-CB 3.43Å; G15-A19 PolarHBondContact O-N 3.05Å
16	F	66.9	Low	61.2	Low	166 Å²	166	94.6 Å²	94.6	73%	0.728	56%	0.558	S	S	*	*	H	α-helix	trans	-70.1	-39.1	176.7	-142	-89.1	0	0	0	111.7	H12 Y13 A19 A20	H12-F16 VanDerWaalsContact O-CB 3.32Å; H12-F16 WeakPolarHBondContact O-CB 3.19Å; H12-F16 PolarHBondContact O-N 3.46Å; Y13-F16 PolarHBondContact O-N 2.78Å; F16-A19 PolarHBondContact O-N 2.77Å; F16-A20 WeakPolarHBondContact O-CB 3.27Å; F16-A20 PolarHBondContact O-N 2.97Å
17	G	77.2	Confident	62.1	Low	36 Å²	36	97.9 Å²	97.9	37%	0.371	56%	0.562	S	S	.	*	H	α-helix	trans	-64.1	-40.9	173.6	0	0	0	0	0	112.2	Y13 L14 A20 L21	Y13-G17 PolarHBondContact O-N 3.19Å; L14-G17 PolarHBondContact O-N 2.88Å; G17-A20 PolarHBondContact O-N 3.37Å; G17-L21 WeakPolarHBondContact O-CB 3.04Å; G17-L21 PolarHBondContact O-N 2.79Å
18	Y	55.7	Low	63	Low	167 Å²	167	96.8 Å²	96.8	66%	0.655	55%	0.549	S	S	*	.	H	α-helix	trans	-67.7	-44.3	174.7	-168.6	-102.9	0	0	0	111.6	L14 G15 A20 L21 V22	L14-Y18 VanDerWaalsContact O-CB 3.28Å; L14-Y18 WeakPolarHBondContact O-CB 3.48Å; L14-Y18 PolarHBondContact O-N 3.48Å; G15-Y18 PolarHBondContact O-N 2.66Å; Y18-A20 VanDerWaalsContact C-N 3.34Å; Y18-A20 PolarHBondContact O-N 2.86Å; Y18-L21 PolarHBondContact O-N 2.86Å; Y18-V22 HydrophobicContact CD1-CG2 4.02Å; Y18-V22 HydrophobicContact CE1-CG2 3.78Å; Y18-V22 HydrophobicContact CG-CG2 4.48Å; Y18-V22 WeakPolarHBondContact O-CB 3.28Å; Y18-V22 WeakPolarHBondContact O-CG2 3.19Å; Y18-V22 PolarHBondContact O-N 3.47Å
19	A	60.8	Low	63.4	Low	57 Å²	57	92.4 Å²	92.4	47%	0.471	54%	0.535	S	S	.	.	H	α-helix	trans	-62.1	-41	175.2	0	0	0	0	0	111.9	G15 F16 V22 A23	G15-A19 VanDerWaalsContact O-CB 3.27Å; G15-A19 WeakPolarHBondContact O-CB 3.43Å; G15-A19 PolarHBondContact O-N 3.05Å; F16-A19 PolarHBondContact O-N 2.77Å; A19-V22 PolarHBondContact O-N 2.82Å; A19-A23 WeakPolarHBondContact O-CB 3.41Å; A19-A23 PolarHBondContact O-N 3.34Å
20	A	76.7	Confident	63.3	Low	46 Å²	46	95.1 Å²	95.1	38%	0.38	54%	0.535	S	S	.	.	H	α-helix	trans	-66.6	-39.8	175.7	0	0	0	0	0	111.9	F16 G17 Y18 A23 T24	F16-A20 WeakPolarHBondContact O-CB 3.27Å; F16-A20 PolarHBondContact O-N 2.97Å; G17-A20 PolarHBondContact O-N 3.37Å; Y18-A20 VanDerWaalsContact C-N 3.34Å; Y18-A20 PolarHBondContact O-N 2.86Å; A20-A23 PolarHBondContact O-N 2.78Å; A20-T24 WeakPolarHBondContact O-CB 3.08Å; A20-T24 PolarHBondContact O-N 3.37Å; A20-T24 PolarHBondContact O-OG1 2.81Å
21	L	76	Confident	63.5	Low	122 Å²	122	95.4 Å²	95.4	64%	0.639	54%	0.544	S	S	*	.	H	α-helix	trans	-66.6	-39.5	174.7	-105.7	162.8	0	0	0	112.5	G17 Y18 T24 G25	G17-L21 WeakPolarHBondContact O-CB 3.04Å; G17-L21 PolarHBondContact O-N 2.79Å; Y18-L21 PolarHBondContact O-N 2.86Å; L21-T24 WeakPolarHBondContact CA-OG1 3.47Å; L21-T24 PolarHBondContact O-OG1 2.9Å; L21-G25 WeakPolarHBondContact O-CA 3.43Å; L21-G25 PolarHBondContact O-N 2.82Å
22	V	70.4	Confident	63.3	Low	81 Å²	81	97.1 Å²	97.1	49%	0.491	55%	0.545	S	S	.	.	H	α-helix	trans	-70.9	-39.2	176.4	173.9	0	0	0	0	110.2	Y18 A19 G26	Y18-V22 HydrophobicContact CD1-CG2 4.02Å; Y18-V22 HydrophobicContact CE1-CG2 3.78Å; Y18-V22 HydrophobicContact CG-CG2 4.48Å; Y18-V22 WeakPolarHBondContact O-CB 3.28Å; Y18-V22 WeakPolarHBondContact O-CG2 3.19Å; Y18-V22 PolarHBondContact O-N 3.47Å; A19-V22 PolarHBondContact O-N 2.82Å; V22-G26 WeakPolarHBondContact O-CA 3.38Å; V22-G26 PolarHBondContact O-N 3.33Å
23	A	72.9	Confident	63.2	Low	54 Å²	54	93.5 Å²	93.5	45%	0.446	54%	0.538	S	S	.	.	H	α-helix	trans	-66.9	-47	175.4	0	0	0	0	0	111.6	A19 A20 G26 I27	A19-A23 WeakPolarHBondContact O-CB 3.41Å; A19-A23 PolarHBondContact O-N 3.34Å; A20-A23 PolarHBondContact O-N 2.78Å; A23-G26 PolarHBondContact O-N 2.88Å; A23-I27 WeakPolarHBondContact O-CD1 3.11Å; A23-I27 WeakPolarHBondContact O-CG1 3.34Å; A23-I27 PolarHBondContact O-N 2.8Å
24	T	71.8	Confident	62.9	Low	71 Å²	71	88 Å²	88	44%	0.436	54%	0.539	S	S	.	.	H	α-helix	trans	-67.4	-41.1	175.6	42.1	0	0	0	0	111.7	A20 L21 G26 I27 I28	A20-T24 WeakPolarHBondContact O-CB 3.08Å; A20-T24 PolarHBondContact O-N 3.37Å; A20-T24 PolarHBondContact O-OG1 2.81Å; L21-T24 WeakPolarHBondContact CA-OG1 3.47Å; L21-T24 PolarHBondContact O-OG1 2.9Å; T24-G26 VanDerWaalsContact C-N 3.28Å; T24-G26 PolarHBondContact O-N 3.38Å; T24-I27 PolarHBondContact O-N 3.4Å; T24-I28 VanDerWaalsContact O-CB 3.25Å; T24-I28 WeakPolarHBondContact O-CB 3.29Å; T24-I28 WeakPolarHBondContact O-CD1 3.23Å; T24-I28 WeakPolarHBondContact O-CG1 3.15Å; T24-I28 PolarHBondContact O-N 3.49Å
25	G	66.4	Low	62.6	Low	43 Å²	43	84.6 Å²	84.6	44%	0.443	53%	0.526	S	S	.	.	H	α-helix	trans	-62.3	-35.2	173.2	0	0	0	0	0	112.8	L21 G29	L21-G25 WeakPolarHBondContact O-CA 3.43Å; L21-G25 PolarHBondContact O-N 2.82Å; G25-G29 WeakPolarHBondContact O-CA 3.39Å; G25-G29 PolarHBondContact O-N 2.98Å
26	G	58.7	Low	62.1	Low	43 Å²	43	88.5 Å²	88.5	44%	0.443	54%	0.542	S	S	.	.	H	α-helix	trans	-68.9	-46.4	173.5	0	0	0	0	0	112.5	V22 A23 T24 G29 Y30	V22-G26 WeakPolarHBondContact O-CA 3.38Å; V22-G26 PolarHBondContact O-N 3.33Å; A23-G26 PolarHBondContact O-N 2.88Å; T24-G26 VanDerWaalsContact C-N 3.28Å; T24-G26 PolarHBondContact O-N 3.38Å; G26-G29 PolarHBondContact O-N 3.46Å; G26-Y30 WeakPolarHBondContact O-CB 3.44Å; G26-Y30 PolarHBondContact O-N 3.3Å
27	I	65	Low	61.4	Low	119 Å²	119	84.8 Å²	84.8	61%	0.61	54%	0.535	S	S	*	.	H	α-helix	trans	-66.2	-44.2	177.8	-65.5	161.6	0	0	0	110.8	A23 T24 Y30 A31	A23-I27 WeakPolarHBondContact O-CD1 3.11Å; A23-I27 WeakPolarHBondContact O-CG1 3.34Å; A23-I27 PolarHBondContact O-N 2.8Å; T24-I27 PolarHBondContact O-N 3.4Å; I27-Y30 PolarHBondContact O-N 2.84Å; I27-A31 WeakPolarHBondContact O-CB 3.2Å; I27-A31 PolarHBondContact O-N 3.46Å
28	I	63.3	Low	59.9	Low	96 Å²	96	86.5 Å²	86.5	49%	0.492	54%	0.541	S	S	.	.	H	α-helix	trans	-67.8	-38.9	176.7	-65.9	165.7	0	0	0	110.3	T24 Y30 A31 K32	T24-I28 VanDerWaalsContact O-CB 3.25Å; T24-I28 WeakPolarHBondContact O-CB 3.29Å; T24-I28 WeakPolarHBondContact O-CD1 3.23Å; T24-I28 WeakPolarHBondContact O-CG1 3.15Å; T24-I28 PolarHBondContact O-N 3.49Å; I28-Y30 VanDerWaalsContact C-N 3.33Å; I28-A31 PolarHBondContact O-N 2.79Å; I28-K32 WeakPolarHBondContact O-CB 3.21Å; I28-K32 PolarHBondContact O-N 3.31Å
29	G	56.9	Low	60.1	Low	36 Å²	36	82 Å²	82	37%	0.371	53%	0.527	S	S	.	.	H	α-helix	trans	-62.9	-40.3	173.9	0	0	0	0	0	112.1	G25 G26 K32 A33	G25-G29 WeakPolarHBondContact O-CA 3.39Å; G25-G29 PolarHBondContact O-N 2.98Å; G26-G29 PolarHBondContact O-N 3.46Å; G29-K32 PolarHBondContact O-N 2.79Å; G29-A33 WeakPolarHBondContact O-CB 3.48Å; G29-A33 PolarHBondContact O-N 2.81Å
30	Y	50.7	Low	60.5	Low	163 Å²	163	81.7 Å²	81.7	64%	0.639	53%	0.525	S	S	*	.	H	α-helix	trans	-69.3	-42.2	177.1	-162.6	-85.7	0	0	0	112.1	G26 I27 I28 K32 L39	G26-Y30 WeakPolarHBondContact O-CB 3.44Å; G26-Y30 PolarHBondContact O-N 3.3Å; I27-Y30 PolarHBondContact O-N 2.84Å; I28-Y30 VanDerWaalsContact C-N 3.33Å; Y30-K32 VanDerWaalsContact C-N 3.31Å; Y30-K32 PolarHBondContact O-N 3.03Å; Y30-L39 HydrophobicContact CD2-CD1 4.41Å; Y30-L39 HydrophobicContact CE2-CD1 3.19Å; Y30-L39 WeakPolarHBondContact OH-CD1 3.41Å
31	A	56.3	Low	59.9	Low	83 Å²	83	82.2 Å²	82.2	69%	0.686	53%	0.529	S	S	*	.	H	α-helix	trans	-66.7	-31.8	174.7	0	0	0	0	0	112.5	I27 I28	I27-A31 WeakPolarHBondContact O-CB 3.2Å; I27-A31 PolarHBondContact O-N 3.46Å; I28-A31 PolarHBondContact O-N 2.79Å
32	K	51	Low	59	Low	172 Å²	172	78.4 Å²	78.4	75%	0.748	52%	0.52	S	S	*	.	H	α-helix	trans	-88.9	-26.5	-176.8	-159.7	178.7	-62.5	-165.3	0	113.5	I28 G29 Y30	I28-K32 WeakPolarHBondContact O-CB 3.21Å; I28-K32 PolarHBondContact O-N 3.31Å; G29-K32 PolarHBondContact O-N 2.79Å; Y30-K32 VanDerWaalsContact C-N 3.31Å; Y30-K32 PolarHBondContact O-N 3.03Å
33	A	50	Low	59.3	Low	52 Å²	52	80.1 Å²	80.1	43%	0.43	53%	0.526	S	S	.	.	H	α-helix	trans	-76.5	-24.9	-177.9	0	0	0	0	0	113.8	G29 S35	G29-A33 WeakPolarHBondContact O-CB 3.48Å; G29-A33 PolarHBondContact O-N 2.81Å; A33-S35 WeakPolarHBondContact O-CB 3.48Å; A33-S35 PolarHBondContact O-N 2.64Å
34	G	50.2	Low	59.5	Low	77 Å²	77	84.1 Å²	84.1	79%	0.794	53%	0.533	S	S	*	.			trans	46.4	35.4	166.3	0	0	0	0	0	115.6
35	S	53.2	Low	59.1	Low	53 Å²	53	88.3 Å²	88.3	37%	0.371	55%	0.546	S	S	.	.			trans	-147.2	105.6	-164.1	174.3	0	0	0	0	110.9	A33 P37 S38 L39	A33-S35 WeakPolarHBondContact O-CB 3.48Å; A33-S35 PolarHBondContact O-N 2.64Å; S35-P37 WeakPolarHBondContact OG-CD 3.15Å; S35-P37 VanDerWaalsContact OG-CG 3.31Å; S35-P37 WeakPolarHBondContact OG-CG 3.17Å; S35-S38 PolarHBondContact O-N 2.81Å; S35-L39 PolarHBondContact O-N 2.62Å
36	V	53.6	Low	59.1	Low	121 Å²	121	88.3 Å²	88.3	73%	0.733	55%	0.545	S	S	*	.	H	α-helix	trans	-42.9	-38.5	167.5	179.9	0	0	0	0	112.6	S38 L39 A40	V36-S38 PolarHBondContact O-N 3.37Å; V36-L39 PolarHBondContact O-N 2.84Å; V36-A40 VanDerWaalsContact O-CB 3.27Å; V36-A40 WeakPolarHBondContact O-CB 3.11Å; V36-A40 PolarHBondContact O-N 3.43Å
37	P	53.3	Low	60	Low	89 Å²	89	89.7 Å²	89.7	58%	0.578	55%	0.548	S	S	*	.	H	α-helix	trans	-56	-39.6	171.1	-25.5	25.3	0	0	0	115.5	S35 A41	S35-P37 WeakPolarHBondContact OG-CD 3.15Å; S35-P37 VanDerWaalsContact OG-CG 3.31Å; S35-P37 WeakPolarHBondContact OG-CG 3.17Å; P37-A41 WeakPolarHBondContact O-CB 3.2Å; P37-A41 PolarHBondContact O-N 3.31Å
38	S	45.8	Very low	60.2	Low	72 Å²	72	88.7 Å²	88.7	50%	0.503	54%	0.544	S	S	.	.	H	α-helix	trans	-77.4	-31.5	-177.5	-165.6	0	0	0	0	111.9	S35 V36 G42	S35-S38 PolarHBondContact O-N 2.81Å; V36-S38 PolarHBondContact O-N 3.37Å; S38-G42 PolarHBondContact O-N 2.87Å
39	L	59.9	Low	60	Low	71 Å²	71	87 Å²	87	37%	0.372	54%	0.544	S	S	.	.	H	α-helix	trans	-66.5	-48.1	168.7	-168.1	86.8	0	0	0	111.1	Y30 S35 V36 A41 G42 L43	Y30-L39 HydrophobicContact CD2-CD1 4.41Å; Y30-L39 HydrophobicContact CE2-CD1 3.19Å; Y30-L39 WeakPolarHBondContact OH-CD1 3.41Å; S35-L39 PolarHBondContact O-N 2.62Å; V36-L39 PolarHBondContact O-N 2.84Å; L39-A41 VanDerWaalsContact C-N 3.33Å; L39-A41 PolarHBondContact O-N 2.8Å; L39-G42 PolarHBondContact O-N 2.88Å; L39-L43 HydrophobicContact CD2-CD1 4.09Å; L39-L43 HydrophobicContact CG-CD1 4.15Å; L39-L43 WeakPolarHBondContact O-CB 3.26Å; L39-L43 WeakPolarHBondContact O-CG 3.17Å; L39-L43 PolarHBondContact O-N 3.37Å
40	A	68.7	Low	60.8	Low	52 Å²	52	87.2 Å²	87.2	43%	0.43	55%	0.547	S	S	.	.	H	α-helix	trans	-62	-43.8	179	0	0	0	0	0	110.6	V36 L43 F44	V36-A40 VanDerWaalsContact O-CB 3.27Å; V36-A40 WeakPolarHBondContact O-CB 3.11Å; V36-A40 PolarHBondContact O-N 3.43Å; A40-L43 PolarHBondContact O-N 2.84Å; A40-F44 WeakPolarHBondContact O-CB 3.21Å; A40-F44 PolarHBondContact O-N 2.71Å
41	A	62.8	Low	61.5	Low	56 Å²	56	87.9 Å²	87.9	46%	0.463	55%	0.549	S	S	.	.	H	α-helix	trans	-63.7	-41.9	173.7	0	0	0	0	0	111.5	P37 L39 F44 F45	P37-A41 WeakPolarHBondContact O-CB 3.2Å; P37-A41 PolarHBondContact O-N 3.31Å; L39-A41 VanDerWaalsContact C-N 3.33Å; L39-A41 PolarHBondContact O-N 2.8Å; A41-F44 PolarHBondContact O-N 2.82Å; A41-F45 VanDerWaalsContact O-CB 3.29Å; A41-F45 WeakPolarHBondContact O-CB 3.19Å; A41-F45 PolarHBondContact O-N 2.88Å
42	G	58.2	Low	61.5	Low	43 Å²	43	85.5 Å²	85.5	44%	0.443	53%	0.533	S	S	.	.	H	α-helix	trans	-65.1	-40.9	176.6	0	0	0	0	0	113.4	S38 L39 G46	S38-G42 PolarHBondContact O-N 2.87Å; L39-G42 PolarHBondContact O-N 2.88Å; G42-G46 VanDerWaalsContact O-CA 3.27Å; G42-G46 WeakPolarHBondContact O-CA 3.17Å; G42-G46 PolarHBondContact O-N 3.03Å
43	L	75.6	Confident	61.5	Low	116 Å²	116	80 Å²	80	61%	0.607	52%	0.519	S	S	*	.	H	α-helix	trans	-69.6	-38	173.7	-75.8	173.5	0	0	0	111.6	L39 A40 S47	L39-L43 HydrophobicContact CD2-CD1 4.09Å; L39-L43 HydrophobicContact CG-CD1 4.15Å; L39-L43 WeakPolarHBondContact O-CB 3.26Å; L39-L43 WeakPolarHBondContact O-CG 3.17Å; L39-L43 PolarHBondContact O-N 3.37Å; A40-L43 PolarHBondContact O-N 2.84Å; L43-S47 WeakPolarHBondContact O-CB 3.24Å; L43-S47 PolarHBondContact O-N 3.1Å; L43-S47 PolarHBondContact O-OG 3.49Å
44	F	77.4	Confident	61.6	Low	138 Å²	138	85.9 Å²	85.9	61%	0.605	53%	0.531	S	S	*	.	H	α-helix	trans	-70.5	-47.9	178.9	-165.2	-96.8	0	0	0	111.7	A40 A41 S47 L48	A40-F44 WeakPolarHBondContact O-CB 3.21Å; A40-F44 PolarHBondContact O-N 2.71Å; A41-F44 PolarHBondContact O-N 2.82Å; F44-S47 PolarHBondContact O-OG 3.31Å; F44-L48 HydrophobicContact CD1-CD1 3.75Å; F44-L48 HydrophobicContact CE1-CD1 3.54Å; F44-L48 HydrophobicContact CZ-CD1 4.24Å; F44-L48 WeakPolarHBondContact O-CB 3.36Å; F44-L48 WeakPolarHBondContact O-CG 3.24Å; F44-L48 PolarHBondContact O-N 2.81Å
45	F	63.6	Low	61.6	Low	160 Å²	160	88.9 Å²	88.9	70%	0.702	53%	0.525	S	S	*	.	H	α-helix	trans	-70.1	-34.8	174.8	-120.6	-95.3	0	0	0	112	A41 A49	A41-F45 VanDerWaalsContact O-CB 3.29Å; A41-F45 WeakPolarHBondContact O-CB 3.19Å; A41-F45 PolarHBondContact O-N 2.88Å; F45-A49 WeakPolarHBondContact O-CB 3.32Å; F45-A49 PolarHBondContact O-N 2.79Å
46	G	67.6	Low	61.1	Low	42 Å²	42	92 Å²	92	43%	0.433	54%	0.537	S	S	.	.	H	α-helix	trans	-69.9	-39.7	177.5	0	0	0	0	0	112.9	G42 A49 G50	G42-G46 VanDerWaalsContact O-CA 3.27Å; G42-G46 WeakPolarHBondContact O-CA 3.17Å; G42-G46 PolarHBondContact O-N 3.03Å; G46-A49 PolarHBondContact O-N 3.42Å; G46-G50 PolarHBondContact O-N 2.74Å
47	S	75.9	Confident	60.7	Low	72 Å²	72	91.5 Å²	91.5	50%	0.503	54%	0.538	S	S	.	.	H	α-helix	trans	-67.6	-43.1	172.8	52.8	0	0	0	0	111.5	L43 F44 G50 Y51	L43-S47 WeakPolarHBondContact O-CB 3.24Å; L43-S47 PolarHBondContact O-N 3.1Å; L43-S47 PolarHBondContact O-OG 3.49Å; F44-S47 PolarHBondContact O-OG 3.31Å; S47-G50 PolarHBondContact O-N 3.21Å; S47-Y51 VanDerWaalsContact O-CB 3.28Å; S47-Y51 WeakPolarHBondContact O-CB 3.17Å; S47-Y51 PolarHBondContact O-N 3.5Å
48	L	70.7	Confident	60.4	Low	99 Å²	99	94 Å²	94	52%	0.518	54%	0.542	S	S	.	.	H	α-helix	trans	-63.1	-40.6	173.4	-80.8	166.2	0	0	0	112.7	F44 G52	F44-L48 HydrophobicContact CD1-CD1 3.75Å; F44-L48 HydrophobicContact CE1-CD1 3.54Å; F44-L48 HydrophobicContact CZ-CD1 4.24Å; F44-L48 WeakPolarHBondContact O-CB 3.36Å; F44-L48 WeakPolarHBondContact O-CG 3.24Å; F44-L48 PolarHBondContact O-N 2.81Å; L48-G52 WeakPolarHBondContact O-CA 3.39Å; L48-G52 PolarHBondContact O-N 3.41Å
49	A	58	Low	60.4	Low	60 Å²	60	95.9 Å²	95.9	50%	0.496	55%	0.547	S	S	.	.	H	α-helix	trans	-70.1	-37.6	176.8	0	0	0	0	0	111.9	F45 G46 A53	F45-A49 WeakPolarHBondContact O-CB 3.32Å; F45-A49 PolarHBondContact O-N 2.79Å; G46-A49 PolarHBondContact O-N 3.42Å; A49-A53 WeakPolarHBondContact O-CB 3.38Å; A49-A53 PolarHBondContact O-N 2.76Å
50	G	73.3	Confident	59.8	Low	41 Å²	41	98.7 Å²	98.7	42%	0.423	57%	0.569	S	S	.	*	H	α-helix	trans	-65.9	-43.5	174.1	0	0	0	0	0	112.1	G46 S47 A53 Y54	G46-G50 PolarHBondContact O-N 2.74Å; S47-G50 PolarHBondContact O-N 3.21Å; G50-A53 PolarHBondContact O-N 3.05Å; G50-Y54 PolarHBondContact O-N 3.47Å
51	Y	66.8	Low	58.8	Low	176 Å²	176	106.6 Å²	106.6	69%	0.69	59%	0.588	S	S	*	*	H	α-helix	trans	-67.6	-41.7	175.8	-151.7	-93.2	0	0	0	111.5	S47 Y54 Q55	S47-Y51 VanDerWaalsContact O-CB 3.28Å; S47-Y51 WeakPolarHBondContact O-CB 3.17Å; S47-Y51 PolarHBondContact O-N 3.5Å; Y51-Y54 WeakPolarHBondContact O-CB 3.43Å; Y51-Y54 PolarHBondContact O-N 2.81Å; Y51-Q55 WeakPolarHBondContact O-CB 3.5Å; Y51-Q55 PolarHBondContact O-N 3.45Å
52	G	55.3	Low	58.1	Low	34 Å²	34	108.9 Å²	108.9	35%	0.351	59%	0.592	S	S	.	*	H	α-helix	trans	-65	-38.7	174.7	0	0	0	0	0	113.1	L48 Y54 Q55 L56	L48-G52 WeakPolarHBondContact O-CA 3.39Å; L48-G52 PolarHBondContact O-N 3.41Å; G52-Y54 VanDerWaalsContact C-N 3.34Å; G52-Q55 PolarHBondContact O-N 3.29Å; G52-L56 WeakPolarHBondContact O-CB 3.15Å; G52-L56 PolarHBondContact O-N 3.25Å
53	A	51.8	Low	57.9	Low	55 Å²	55	111.9 Å²	111.9	46%	0.455	60%	0.602	S	S	.	*	H	α-helix	trans	-68.3	-34.4	174.7	0	0	0	0	0	112	A49 G50 L56 S57	A49-A53 WeakPolarHBondContact O-CB 3.38Å; A49-A53 PolarHBondContact O-N 2.76Å; G50-A53 PolarHBondContact O-N 3.05Å; A53-L56 PolarHBondContact O-N 3.14Å; A53-S57 PolarHBondContact O-N 2.97Å
54	Y	52.8	Low	56.8	Low	176 Å²	176	116.3 Å²	116.3	69%	0.69	61%	0.611	S	S	*	*	H	α-helix	trans	-65.5	-40.5	172.6	-134.6	-94.8	0	0	0	111.5	G50 Y51 G52 S57	G50-Y54 PolarHBondContact O-N 3.47Å; Y51-Y54 WeakPolarHBondContact O-CB 3.43Å; Y51-Y54 PolarHBondContact O-N 2.81Å; G52-Y54 VanDerWaalsContact C-N 3.34Å; Y54-S57 PolarHBondContact O-N 2.87Å
55	Q	48.3	Very low	55.8	Low	140 Å²	140	113.3 Å²	113.3	65%	0.654	60%	0.604	S	S	*	*	H	α-helix	trans	-74.8	-29.8	178.2	-154	152.5	30.7	0	0	112.6	Y51 G52	Y51-Q55 WeakPolarHBondContact O-CB 3.5Å; Y51-Q55 PolarHBondContact O-N 3.45Å; G52-Q55 PolarHBondContact O-N 3.29Å
56	L	43.8	Very low	55.1	Low	120 Å²	120	112.8 Å²	112.8	63%	0.628	60%	0.601	S	S	*	*	H	α-helix	trans	-74.7	-25.2	174.9	-163.2	67.3	0	0	0	112.5	G52 A53 F66	G52-L56 WeakPolarHBondContact O-CB 3.15Å; G52-L56 PolarHBondContact O-N 3.25Å; A53-L56 PolarHBondContact O-N 3.14Å; L56-F66 HydrophobicContact CD1-CE2 4.22Å
57	S	44.1	Very low	54.8	Low	109 Å²	109	116.6 Å²	116.6	76%	0.762	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76	-16.2	175.4	-101.3	0	0	0	0	114.5	A53 Y54	A53-S57 PolarHBondContact O-N 2.97Å; Y54-S57 PolarHBondContact O-N 2.87Å
58	Q	47.3	Very low	54.4	Low	141 Å²	141	115.7 Å²	115.7	66%	0.659	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.5	-29.5	-174.7	-72.6	-162.3	-3.8	0	0	115.6
59	D	47.1	Very low	53.8	Low	112 Å²	112	115 Å²	115	60%	0.599	61%	0.608	S	S	*	*			trans	-145.6	95.6	-174.6	-94.1	-64.9	0	0	0	114.5	R61	D59-R61 PolarHBondContact O-N 3.35Å
60	P	46.9	Very low	53.8	Low	130 Å²	130	115.6 Å²	115.6	84%	0.844	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.9	43.8	172.4	31.9	-34.2	0	0	0	112.6
61	R	46.9	Very low	54	Low	219 Å²	219	115.8 Å²	115.8	83%	0.826	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-133.5	2	-175.4	-115.5	-174.9	-165.5	-161.7	4.7	116.8	D59	D59-R61 PolarHBondContact O-N 3.35Å
62	N	48.2	Very low	54.3	Low	103 Å²	103	111.5 Å²	111.5	55%	0.551	60%	0.603	S	S	*	*			trans	-110.5	57.4	-178.8	-109.6	-8.1	0	0	0	113.5	W64 V65 F66	N62-W64 PolarHBondContact O-N 3.41Å; N62-W64 VanDerWaalsContact O-N 3.14Å; N62-V65 HydrophobicContact CB-CB 4.16Å; N62-V65 HydrophobicContact CB-CG2 3.8Å; N62-V65 WeakPolarHBondContact ND2-CG2 3.25Å; N62-V65 PolarHBondContact O-N 2.8Å; N62-F66 PolarHBondContact O-N 3.4Å
63	V	53.9	Low	54.5	Low	107 Å²	107	114.9 Å²	114.9	65%	0.648	61%	0.612	S	S	*	*	H	α-helix	trans	-51	-31.6	165.5	-178.2	0	0	0	0	110.9	F66 L67	V63-F66 PolarHBondContact O-N 2.76Å; V63-L67 WeakPolarHBondContact O-CB 3.22Å; V63-L67 PolarHBondContact O-N 2.78Å
64	W	53.6	Low	55.3	Low	209 Å²	209	115.1 Å²	115.1	79%	0.792	62%	0.615	S	S	*	*	H	α-helix	trans	-63.7	-36.2	174.4	-94.5	84.2	0	0	0	114.4	N62 L67 A68	N62-W64 PolarHBondContact O-N 3.41Å; N62-W64 VanDerWaalsContact O-N 3.14Å; W64-L67 PolarHBondContact O-N 2.76Å; W64-A68 WeakPolarHBondContact O-CB 3.02Å; W64-A68 PolarHBondContact O-N 3.46Å
65	V	56.1	Low	56.3	Low	75 Å²	75	108.8 Å²	108.8	46%	0.455	60%	0.603	S	S	.	*	H	α-helix	trans	-74.1	-37.8	178.5	178.3	0	0	0	0	109.8	N62 T69	N62-V65 HydrophobicContact CB-CB 4.16Å; N62-V65 HydrophobicContact CB-CG2 3.8Å; N62-V65 WeakPolarHBondContact ND2-CG2 3.25Å; N62-V65 PolarHBondContact O-N 2.8Å; V65-T69 WeakPolarHBondContact O-CB 3.48Å; V65-T69 PolarHBondContact O-N 2.87Å; V65-T69 PolarHBondContact O-OG1 2.8Å
66	F	48.4	Very low	57.2	Low	149 Å²	149	107.1 Å²	107.1	65%	0.654	60%	0.597	S	S	*	*	H	α-helix	trans	-64.9	-38.7	170.6	-106.8	-95.3	0	0	0	112.1	L56 N62 V63 S70	L56-F66 HydrophobicContact CD1-CE2 4.22Å; N62-F66 PolarHBondContact O-N 3.4Å; V63-F66 PolarHBondContact O-N 2.76Å; F66-S70 WeakPolarHBondContact O-CA 3.07Å; F66-S70 WeakPolarHBondContact O-CB 3.21Å; F66-S70 PolarHBondContact O-N 2.81Å
67	L	62.2	Low	57.8	Low	121 Å²	121	106.2 Å²	106.2	63%	0.634	59%	0.591	S	S	*	*	H	α-helix	trans	-68.8	-44.2	176.6	-129.9	77.3	0	0	0	112.1	V63 W64 G71	V63-L67 WeakPolarHBondContact O-CB 3.22Å; V63-L67 PolarHBondContact O-N 2.78Å; W64-L67 PolarHBondContact O-N 2.76Å; L67-G71 WeakPolarHBondContact O-CA 3.42Å; L67-G71 PolarHBondContact O-N 3.5Å
68	A	67.8	Low	58.5	Low	53 Å²	53	102.9 Å²	102.9	44%	0.438	57%	0.573	S	S	.	*	H	α-helix	trans	-65.9	-42.2	176.7	0	0	0	0	0	110.6	W64 T72	W64-A68 WeakPolarHBondContact O-CB 3.02Å; W64-A68 PolarHBondContact O-N 3.46Å; A68-T72 WeakPolarHBondContact O-CB 3.27Å; A68-T72 PolarHBondContact O-N 3.46Å; A68-T72 PolarHBondContact O-OG1 2.9Å
69	T	58.1	Low	58.6	Low	84 Å²	84	103 Å²	103	52%	0.515	58%	0.576	S	S	.	*	H	α-helix	trans	-69.2	-45.6	178.6	-55.8	0	0	0	0	110.9	V65 T72 L73	V65-T69 WeakPolarHBondContact O-CB 3.48Å; V65-T69 PolarHBondContact O-N 2.87Å; V65-T69 PolarHBondContact O-OG1 2.8Å; T69-T72 PolarHBondContact O-N 3.43Å; T69-L73 WeakPolarHBondContact O-CB 3.43Å; T69-L73 PolarHBondContact O-N 2.61Å
70	S	57.8	Low	58.7	Low	73 Å²	73	105.6 Å²	105.6	51%	0.51	58%	0.577	S	S	.	*	H	α-helix	trans	-67.5	-39.5	178	-166.4	0	0	0	0	111.6	F66 L73 A74	F66-S70 WeakPolarHBondContact O-CA 3.07Å; F66-S70 WeakPolarHBondContact O-CB 3.21Å; F66-S70 PolarHBondContact O-N 2.81Å; S70-L73 PolarHBondContact O-N 2.84Å; S70-A74 WeakPolarHBondContact O-CB 3.4Å; S70-A74 PolarHBondContact O-N 3.31Å
71	G	76.1	Confident	58.7	Low	46 Å²	46	107.9 Å²	107.9	47%	0.474	57%	0.574	S	S	.	*	H	α-helix	trans	-65.9	-39.9	173.7	0	0	0	0	0	112.6	L67 G75	L67-G71 WeakPolarHBondContact O-CA 3.42Å; L67-G71 PolarHBondContact O-N 3.5Å; G71-G75 PolarHBondContact O-N 2.89Å
72	T	73.3	Confident	58.8	Low	86 Å²	86	107.8 Å²	107.8	53%	0.528	58%	0.575	S	S	.	*	H	α-helix	trans	-68.5	-42.3	175	-55.2	0	0	0	0	110.9	A68 T69 G75 I76	A68-T72 WeakPolarHBondContact O-CB 3.27Å; A68-T72 PolarHBondContact O-N 3.46Å; A68-T72 PolarHBondContact O-OG1 2.9Å; T69-T72 PolarHBondContact O-N 3.43Å; T72-G75 PolarHBondContact O-N 2.83Å; T72-I76 HydrophobicContact CG2-CD1 3.84Å; T72-I76 HydrophobicContact CG2-CG1 4.49Å; T72-I76 WeakPolarHBondContact O-CB 3.19Å; T72-I76 VanDerWaalsContact O-CG1 3.23Å; T72-I76 WeakPolarHBondContact O-CG1 3.34Å; T72-I76 PolarHBondContact O-N 3.27Å
73	L	60.7	Low	58.6	Low	104 Å²	104	109.5 Å²	109.5	55%	0.545	59%	0.585	S	S	.	*	H	α-helix	trans	-68.6	-40	178.6	-162.8	71.5	0	0	0	111.6	T69 S70 M77	T69-L73 WeakPolarHBondContact O-CB 3.43Å; T69-L73 PolarHBondContact O-N 2.61Å; S70-L73 PolarHBondContact O-N 2.84Å; L73-M77 VanDerWaalsContact O-CB 3.24Å; L73-M77 WeakPolarHBondContact O-CB 3.25Å; L73-M77 VanDerWaalsContact O-CG 3.26Å; L73-M77 WeakPolarHBondContact O-CG 3.19Å; L73-M77 PolarHBondContact O-N 2.78Å
74	A	68.6	Low	58.2	Low	61 Å²	61	107.6 Å²	107.6	50%	0.504	58%	0.576	S	S	.	*	H	α-helix	trans	-67.6	-35.6	172.9	0	0	0	0	0	111.7	S70 G78	S70-A74 WeakPolarHBondContact O-CB 3.4Å; S70-A74 PolarHBondContact O-N 3.31Å; A74-G78 VanDerWaalsContact O-CA 3.32Å; A74-G78 WeakPolarHBondContact O-CA 3.32Å; A74-G78 PolarHBondContact O-N 2.84Å
75	G	74	Confident	58.1	Low	42 Å²	42	101.7 Å²	101.7	43%	0.433	58%	0.58	S	S	.	*	H	α-helix	trans	-66.4	-47.1	173.5	0	0	0	0	0	112.3	G71 T72 G78 M79	G71-G75 PolarHBondContact O-N 2.89Å; T72-G75 PolarHBondContact O-N 2.83Å; G75-G78 PolarHBondContact O-N 3.42Å; G75-M79 WeakPolarHBondContact O-CB 3.28Å; G75-M79 PolarHBondContact O-N 3.42Å
76	I	66.3	Low	57.6	Low	105 Å²	105	106.5 Å²	106.5	54%	0.538	60%	0.595	S	S	.	*	H	α-helix	trans	-65.7	-43.8	177.9	-66.6	165.5	0	0	0	110.6	T72 R80	T72-I76 HydrophobicContact CG2-CD1 3.84Å; T72-I76 HydrophobicContact CG2-CG1 4.49Å; T72-I76 WeakPolarHBondContact O-CB 3.19Å; T72-I76 VanDerWaalsContact O-CG1 3.23Å; T72-I76 WeakPolarHBondContact O-CG1 3.34Å; T72-I76 PolarHBondContact O-N 3.27Å; I76-R80 WeakPolarHBondContact O-CB 3.37Å; I76-R80 PolarHBondContact O-N 3.46Å
77	M	56.1	Low	57.7	Low	102 Å²	102	109.1 Å²	109.1	50%	0.502	61%	0.606	S	S	.	*	H	α-helix	trans	-72.9	-31.8	177.5	-70.6	-69.1	-179.7	0	0	112.7	L73 R80 F81	L73-M77 VanDerWaalsContact O-CB 3.24Å; L73-M77 WeakPolarHBondContact O-CB 3.25Å; L73-M77 VanDerWaalsContact O-CG 3.26Å; L73-M77 WeakPolarHBondContact O-CG 3.19Å; L73-M77 PolarHBondContact O-N 2.78Å; M77-R80 CarbonylContact O-C 3.59Å; M77-R80 PolarHBondContact O-N 3.46Å; M77-F81 VanDerWaalsContact O-CB 3.24Å; M77-F81 WeakPolarHBondContact O-CB 3.15Å; M77-F81 PolarHBondContact O-N 2.89Å
78	G	58.7	Low	57	Low	38 Å²	38	111.9 Å²	111.9	39%	0.392	62%	0.618	S	S	.	*	H	α-helix	trans	-71.8	-41.9	176.2	0	0	0	0	0	112.4	A74 G75 R80 F81 Y82	A74-G78 VanDerWaalsContact O-CA 3.32Å; A74-G78 WeakPolarHBondContact O-CA 3.32Å; A74-G78 PolarHBondContact O-N 2.84Å; G75-G78 PolarHBondContact O-N 3.42Å; G78-R80 VanDerWaalsContact C-N 3.31Å; G78-R80 PolarHBondContact O-N 2.83Å; G78-F81 PolarHBondContact O-N 3.43Å; G78-Y82 PolarHBondContact O-N 3.46Å; G78-Y82 VanDerWaalsContact O-N 3.1Å
79	M	50.6	Low	56.1	Low	143 Å²	143	113.6 Å²	113.6	70%	0.704	62%	0.624	S	S	*	*	H	α-helix	trans	-68.4	-33.6	173.5	-153	-149.8	-80.6	0	0	111.2	G75	G75-M79 WeakPolarHBondContact O-CB 3.28Å; G75-M79 PolarHBondContact O-N 3.42Å
80	R	48	Very low	55.8	Low	168 Å²	168	112.9 Å²	112.9	63%	0.634	63%	0.627	S	S	*	*	H	α-helix	trans	-71.6	-27.2	172	-171.3	-179.3	167.3	-177.3	-3.1	113.1	I76 M77 G78 S84	I76-R80 WeakPolarHBondContact O-CB 3.37Å; I76-R80 PolarHBondContact O-N 3.46Å; M77-R80 CarbonylContact O-C 3.59Å; M77-R80 PolarHBondContact O-N 3.46Å; G78-R80 VanDerWaalsContact C-N 3.31Å; G78-R80 PolarHBondContact O-N 2.83Å; R80-S84 WeakPolarHBondContact O-CB 3.49Å; R80-S84 PolarHBondContact O-N 3.46Å
81	F	47	Very low	55.5	Low	178 Å²	178	112.2 Å²	112.2	78%	0.781	63%	0.632	S	S	*	*	H	α-helix	trans	-77.7	-31.1	177.1	-168.7	-103.5	0	0	0	112.5	M77 G78	M77-F81 VanDerWaalsContact O-CB 3.24Å; M77-F81 WeakPolarHBondContact O-CB 3.15Å; M77-F81 PolarHBondContact O-N 2.89Å; G78-F81 PolarHBondContact O-N 3.43Å
82	Y	49.4	Very low	54.5	Low	216 Å²	216	116.9 Å²	116.9	85%	0.847	65%	0.645	S	S	*	*	H	α-helix	trans	-75.2	-27.5	177.6	-134.7	-87.3	0	0	0	113.4	G78	G78-Y82 PolarHBondContact O-N 3.46Å; G78-Y82 VanDerWaalsContact O-N 3.1Å
83	N	44.7	Very low	53.7	Low	140 Å²	140	118.3 Å²	118.3	75%	0.749	65%	0.648	S	S	*	*	H	α-helix	trans	-103.3	-7.5	-174.6	-96.8	-51.2	0	0	0	115.4
84	S	44.3	Very low	53.5	Low	66 Å²	66	116.2 Å²	116.2	46%	0.462	65%	0.646	S	S	.	*			trans	-122	73.7	-172.6	-160.9	0	0	0	0	110.3	R80 K86	R80-S84 WeakPolarHBondContact O-CB 3.49Å; R80-S84 PolarHBondContact O-N 3.46Å; S84-K86 PolarHBondContact O-N 2.86Å
85	G	51.6	Low	53.5	Low	85 Å²	85	115.2 Å²	115.2	88%	0.876	64%	0.642	S	S	*	*			trans	-62.8	62.4	168.4	0	0	0	0	0	112.7
86	K	45.5	Very low	53	Low	176 Å²	176	116.1 Å²	116.1	77%	0.765	65%	0.645	S	S	*	*			trans	-142.4	98.1	-179.6	-144.5	85	170	-172.4	0	109.8	S84	S84-K86 PolarHBondContact O-N 2.86Å
87	F	52	Low	52.5	Low	204 Å²	204	114.3 Å²	114.3	90%	0.895	64%	0.641	S	S	*	*			trans	-50.1	132.7	160.7	-85.7	-103.6	0	0	0	111
88	M	47.3	Very low	53.1	Low	179 Å²	179	115.4 Å²	115.4	88%	0.882	65%	0.649	S	S	*	*			trans	123.5	115.1	168.1	-74.3	175.7	175.1	0	0	110.6
89	P	48.5	Very low	53.7	Low	89 Å²	89	119.3 Å²	119.3	58%	0.578	66%	0.66	S	S	*	*	S	Bend	cis	-127.3	24.4	38.8	39	-21.7	0	0	0	113.2	G91 L92 I93	P89-G91 PolarHBondContact O-N 3.14Å; P89-L92 PolarHBondContact O-N 3.5Å; P89-I93 PolarHBondContact O-N 2.96Å
90	A	50.8	Low	54.2	Low	70 Å²	70	119 Å²	119	58%	0.579	66%	0.658	S	S	*	*	H	α-helix	trans	-62.3	-25.2	179.4	0	0	0	0	0	113	I93 A94	A90-I93 PolarHBondContact O-N 3.42Å; A90-A94 WeakPolarHBondContact O-CB 3.4Å; A90-A94 PolarHBondContact O-N 3.43Å
91	G	51.4	Low	55.1	Low	58 Å²	58	115.4 Å²	115.4	60%	0.598	66%	0.655	S	S	*	*	H	α-helix	trans	-69.7	-34.2	176.7	0	0	0	0	0	114.4	P89 G95	P89-G91 PolarHBondContact O-N 3.14Å; G91-G95 PolarHBondContact O-N 2.85Å
92	L	55.4	Low	56.5	Low	144 Å²	144	110.9 Å²	110.9	75%	0.754	64%	0.642	S	S	*	*	H	α-helix	trans	-71.9	-38	173.9	-86.4	166.3	0	0	0	111.2	P89 A96	P89-L92 PolarHBondContact O-N 3.5Å; L92-A96 VanDerWaalsContact O-CB 3.25Å; L92-A96 WeakPolarHBondContact O-CB 3.32Å; L92-A96 PolarHBondContact O-N 3.48Å
93	I	57.3	Low	57.1	Low	117 Å²	117	107.8 Å²	107.8	60%	0.6	63%	0.633	S	S	*	*	H	α-helix	trans	-71.9	-40.3	177.1	-61.6	170.5	0	0	0	110.5	P89 A90 A96 S97	P89-I93 PolarHBondContact O-N 2.96Å; A90-I93 PolarHBondContact O-N 3.42Å; I93-A96 PolarHBondContact O-N 3.38Å; I93-S97 WeakPolarHBondContact O-CB 3.31Å; I93-S97 PolarHBondContact O-N 2.83Å
94	A	55.8	Low	57.8	Low	60 Å²	60	106.1 Å²	106.1	50%	0.496	62%	0.623	S	S	.	*	H	α-helix	trans	-65.3	-42.1	173.8	0	0	0	0	0	111.6	A90 S97 L98	A90-A94 WeakPolarHBondContact O-CB 3.4Å; A90-A94 PolarHBondContact O-N 3.43Å; A94-S97 PolarHBondContact O-N 3.46Å; A94-L98 WeakPolarHBondContact O-CB 3.31Å; A94-L98 PolarHBondContact O-N 3.05Å
95	G	69.6	Low	59	Low	40 Å²	40	105 Å²	105	41%	0.412	62%	0.622	S	S	.	*	H	α-helix	trans	-62.4	-46.2	174	0	0	0	0	0	112.4	G91 S97 L98 L99	G91-G95 PolarHBondContact O-N 2.85Å; G95-S97 PolarHBondContact O-N 2.87Å; G95-L98 PolarHBondContact O-N 3.04Å; G95-L99 WeakPolarHBondContact O-CB 3.36Å; G95-L99 PolarHBondContact O-N 2.84Å
96	A	61.8	Low	59.7	Low	60 Å²	60	105.8 Å²	105.8	50%	0.496	61%	0.605	S	S	.	*	H	α-helix	trans	-63.3	-39.8	175.7	0	0	0	0	0	112.3	L92 I93 L99 M100	L92-A96 VanDerWaalsContact O-CB 3.25Å; L92-A96 WeakPolarHBondContact O-CB 3.32Å; L92-A96 PolarHBondContact O-N 3.48Å; I93-A96 PolarHBondContact O-N 3.38Å; A96-L99 PolarHBondContact O-N 2.83Å; A96-M100 PolarHBondContact O-N 3.48Å
97	S	55.9	Low	60.1	Low	67 Å²	67	100.8 Å²	100.8	47%	0.469	59%	0.592	S	S	.	*	H	α-helix	trans	-68.9	-42.1	178.8	-159.3	0	0	0	0	111.8	I93 A94 G95 L99 M100 V101	I93-S97 WeakPolarHBondContact O-CB 3.31Å; I93-S97 PolarHBondContact O-N 2.83Å; A94-S97 PolarHBondContact O-N 3.46Å; G95-S97 PolarHBondContact O-N 2.87Å; S97-L99 VanDerWaalsContact C-N 3.31Å; S97-L99 PolarHBondContact O-N 3.23Å; S97-M100 WeakPolarHBondContact O-CB 3.27Å; S97-M100 PolarHBondContact O-N 3.38Å; S97-M100 VanDerWaalsContact O-N 3.14Å; S97-V101 VanDerWaalsContact O-CG2 3.31Å; S97-V101 WeakPolarHBondContact O-CG2 3.41Å; S97-V101 PolarHBondContact O-N 3.5Å
98	L	69.1	Low	60.1	Low	125 Å²	125	98.1 Å²	98.1	65%	0.654	58%	0.584	S	S	*	*	H	α-helix	trans	-62.8	-39.5	175.1	-163.5	123.6	0	0	0	111.4	A94 G95 M100 V101 V102	A94-L98 WeakPolarHBondContact O-CB 3.31Å; A94-L98 PolarHBondContact O-N 3.05Å; G95-L98 PolarHBondContact O-N 3.04Å; L98-M100 VanDerWaalsContact C-N 3.34Å; L98-M100 PolarHBondContact O-N 3.32Å; L98-V101 PolarHBondContact O-N 3Å; L98-V102 WeakPolarHBondContact O-CB 3.48Å; L98-V102 VanDerWaalsContact O-CG2 3.27Å; L98-V102 WeakPolarHBondContact O-CG2 3.45Å; L98-V102 PolarHBondContact O-N 2.94Å
99	L	70.7	Confident	60.7	Low	121 Å²	121	97 Å²	97	63%	0.634	58%	0.581	S	S	*	*	H	α-helix	trans	-64.8	-38.8	174.7	-144.7	160	0	0	0	111.3	G95 A96 S97 K103	G95-L99 WeakPolarHBondContact O-CB 3.36Å; G95-L99 PolarHBondContact O-N 2.84Å; A96-L99 PolarHBondContact O-N 2.83Å; S97-L99 VanDerWaalsContact C-N 3.31Å; S97-L99 PolarHBondContact O-N 3.23Å; L99-K103 VanDerWaalsContact O-CB 3.31Å; L99-K103 WeakPolarHBondContact O-CB 3.25Å; L99-K103 PolarHBondContact O-N 3.39Å
100	M	61.2	Low	61.1	Low	135 Å²	135	96.7 Å²	96.7	67%	0.665	58%	0.581	S	S	*	*	H	α-helix	trans	-67.8	-41.5	175.8	-125.6	-177.3	-170.4	0	0	112.4	A96 S97 L98 K103 L104	A96-M100 PolarHBondContact O-N 3.48Å; S97-M100 WeakPolarHBondContact O-CB 3.27Å; S97-M100 PolarHBondContact O-N 3.38Å; S97-M100 VanDerWaalsContact O-N 3.14Å; L98-M100 VanDerWaalsContact C-N 3.34Å; L98-M100 PolarHBondContact O-N 3.32Å; M100-K103 PolarHBondContact O-N 3.06Å; M100-L104 WeakPolarHBondContact O-CB 3.26Å; M100-L104 PolarHBondContact O-N 3.05Å
101	V	67.4	Low	61	Low	94 Å²	94	97.1 Å²	97.1	57%	0.57	58%	0.58	S	S	*	*	H	α-helix	trans	-66.7	-41.2	177.8	171.2	0	0	0	0	111.1	S97 L98 K103 L104 G105	S97-V101 VanDerWaalsContact O-CG2 3.31Å; S97-V101 WeakPolarHBondContact O-CG2 3.41Å; S97-V101 PolarHBondContact O-N 3.5Å; L98-V101 PolarHBondContact O-N 3Å; V101-K103 VanDerWaalsContact C-N 3.35Å; V101-L104 PolarHBondContact O-N 3.45Å; V101-G105 PolarHBondContact O-N 2.8Å
102	V	76.1	Confident	60.6	Low	82 Å²	82	99.4 Å²	99.4	50%	0.497	58%	0.584	S	S	.	*	H	α-helix	trans	-63.5	-43.4	173.9	170.5	0	0	0	0	110.4	L98 L104 G105 I106	L98-V102 WeakPolarHBondContact O-CB 3.48Å; L98-V102 VanDerWaalsContact O-CG2 3.27Å; L98-V102 WeakPolarHBondContact O-CG2 3.45Å; L98-V102 PolarHBondContact O-N 2.94Å; V102-L104 PolarHBondContact O-N 3.41Å; V102-G105 PolarHBondContact O-N 2.99Å; V102-I106 HydrophobicContact CG1-CD1 3.7Å; V102-I106 HydrophobicContact CG1-CG1 4.4Å; V102-I106 WeakPolarHBondContact O-CD1 3.48Å; V102-I106 WeakPolarHBondContact O-CG1 3.21Å; V102-I106 PolarHBondContact O-N 3.29Å
103	K	63	Low	60.2	Low	152 Å²	152	100.9 Å²	100.9	66%	0.661	59%	0.587	S	S	*	*	H	α-helix	trans	-64.8	-39.3	177.6	-163.4	176	176.6	-177.1	0	112.2	L99 M100 V101 S107	L99-K103 VanDerWaalsContact O-CB 3.31Å; L99-K103 WeakPolarHBondContact O-CB 3.25Å; L99-K103 PolarHBondContact O-N 3.39Å; M100-K103 PolarHBondContact O-N 3.06Å; V101-K103 VanDerWaalsContact C-N 3.35Å; K103-S107 VanDerWaalsContact O-CB 3.26Å; K103-S107 WeakPolarHBondContact O-CB 3.4Å; K103-S107 PolarHBondContact O-N 2.92Å
104	L	59.1	Low	59.8	Low	105 Å²	105	104.2 Å²	104.2	55%	0.55	62%	0.616	S	S	.	*	H	α-helix	trans	-66.8	-41.2	173.3	-106.1	153	0	0	0	112.2	M100 V101 V102 S107 M108	M100-L104 WeakPolarHBondContact O-CB 3.26Å; M100-L104 PolarHBondContact O-N 3.05Å; V101-L104 PolarHBondContact O-N 3.45Å; V102-L104 PolarHBondContact O-N 3.41Å; L104-S107 PolarHBondContact O-N 3.29Å; L104-M108 WeakPolarHBondContact O-CB 3.45Å; L104-M108 WeakPolarHBondContact O-CG 2.9Å; L104-M108 PolarHBondContact O-N 2.79Å
105	G	69.8	Low	60	Low	42 Å²	42	106.4 Å²	106.4	43%	0.433	62%	0.622	S	S	.	*	H	α-helix	trans	-65.5	-43.6	178.1	0	0	0	0	0	112.4	V101 V102 S107 M108 L109	V101-G105 PolarHBondContact O-N 2.8Å; V102-G105 PolarHBondContact O-N 2.99Å; G105-S107 VanDerWaalsContact C-N 3.34Å; G105-M108 PolarHBondContact O-N 3.37Å; G105-L109 WeakPolarHBondContact O-CB 3.21Å; G105-L109 PolarHBondContact O-N 3.06Å
106	I	65.1	Low	59.5	Low	102 Å²	102	109.9 Å²	109.9	52%	0.523	63%	0.633	S	S	.	*	H	α-helix	trans	-64.8	-42.4	173.4	-59.5	160.3	0	0	0	109.6	V102 M108 L109 S110	V102-I106 HydrophobicContact CG1-CD1 3.7Å; V102-I106 HydrophobicContact CG1-CG1 4.4Å; V102-I106 WeakPolarHBondContact O-CD1 3.48Å; V102-I106 WeakPolarHBondContact O-CG1 3.21Å; V102-I106 PolarHBondContact O-N 3.29Å; I106-M108 PolarHBondContact O-N 3.47Å; I106-L109 PolarHBondContact O-N 3.36Å; I106-S110 VanDerWaalsContact O-CB 3.28Å; I106-S110 WeakPolarHBondContact O-CB 3.43Å; I106-S110 PolarHBondContact O-N 3.27Å; I106-S110 PolarHBondContact O-OG 3.5Å
107	S	55.7	Low	59.4	Low	70 Å²	70	112.7 Å²	112.7	49%	0.49	64%	0.641	S	S	.	*	H	α-helix	trans	-65.4	-34.9	178.3	-164.3	0	0	0	0	113.3	K103 L104 G105 S111	K103-S107 VanDerWaalsContact O-CB 3.26Å; K103-S107 WeakPolarHBondContact O-CB 3.4Å; K103-S107 PolarHBondContact O-N 2.92Å; L104-S107 PolarHBondContact O-N 3.29Å; G105-S107 VanDerWaalsContact C-N 3.34Å; S107-S111 WeakPolarHBondContact O-CB 3.35Å; S107-S111 PolarHBondContact O-N 2.6Å; S107-S111 PolarHBondContact O-OG 2.92Å
108	M	51.9	Low	59.6	Low	148 Å²	148	115.4 Å²	115.4	73%	0.729	65%	0.651	S	S	*	*	H	α-helix	trans	-75.2	-36.9	175.5	-81.4	-156.4	148.8	0	0	112.3	L104 G105 I106 S110 S111	L104-M108 WeakPolarHBondContact O-CB 3.45Å; L104-M108 WeakPolarHBondContact O-CG 2.9Å; L104-M108 PolarHBondContact O-N 2.79Å; G105-M108 PolarHBondContact O-N 3.37Å; I106-M108 PolarHBondContact O-N 3.47Å; M108-S110 VanDerWaalsContact C-N 3.29Å; M108-S110 PolarHBondContact O-N 2.8Å; M108-S111 PolarHBondContact O-N 2.89Å
109	L	59.5	Low	59	Low	155 Å²	155	114.8 Å²	114.8	81%	0.812	65%	0.651	S	S	*	*	H	α-helix	trans	-71.3	-27.3	174.6	-166.5	63.3	0	0	0	112.1	G105 I106 S111	G105-L109 WeakPolarHBondContact O-CB 3.21Å; G105-L109 PolarHBondContact O-N 3.06Å; I106-L109 PolarHBondContact O-N 3.36Å; L109-S111 VanDerWaalsContact C-N 3.35Å
110	S	55.6	Low	58.2	Low	83 Å²	83	114.3 Å²	114.3	58%	0.58	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.7	-7.5	176.3	-48.8	0	0	0	0	113.8	I106 M108 P112	I106-S110 VanDerWaalsContact O-CB 3.28Å; I106-S110 WeakPolarHBondContact O-CB 3.43Å; I106-S110 PolarHBondContact O-N 3.27Å; I106-S110 PolarHBondContact O-OG 3.5Å; M108-S110 VanDerWaalsContact C-N 3.29Å; M108-S110 PolarHBondContact O-N 2.8Å; S110-P112 WeakPolarHBondContact O-CD 3.28Å
111	S	48.9	Very low	58	Low	80 Å²	80	112.9 Å²	112.9	56%	0.559	65%	0.651	S	S	*	*			trans	-114.2	64.5	179	-52	0	0	0	0	111.7	S107 M108 L109 Q113	S107-S111 WeakPolarHBondContact O-CB 3.35Å; S107-S111 PolarHBondContact O-N 2.6Å; S107-S111 PolarHBondContact O-OG 2.92Å; M108-S111 PolarHBondContact O-N 2.89Å; L109-S111 VanDerWaalsContact C-N 3.35Å; S111-Q113 VanDerWaalsContact C-N 3.32Å; S111-Q113 PolarHBondContact O-N 3.36Å
112	P	44.8	Very low	57.3	Low	105 Å²	105	114.3 Å²	114.3	68%	0.682	66%	0.657	S	S	*	*			trans	-73.9	90.6	160.9	31.5	-28.3	0	0	0	109.3	S110	S110-P112 WeakPolarHBondContact O-CD 3.28Å
113	Q	46.8	Very low	55.7	Low	176 Å²	176	117 Å²	117	82%	0.822	67%	0.671	S	S	*	*			trans	59.5	163.5	145.8	-74.4	-150.5	28	0	0	118.6	S111	S111-Q113 VanDerWaalsContact C-N 3.32Å; S111-Q113 PolarHBondContact O-N 3.36Å
114	P	48.8	Very low	55.1	Low	186 Å²	186	113.8 Å²	113.8	100%	1.208	67%	0.672	S	S	*	*			cis	-96.5	0	28.6	38.1	-34.9	0	0	0	116.7

Retrieved 114 of 114 residues in 19 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).