A0A061IDZ5_CRIGR Loading...

Short coiled-coil protein

Positive regulator of amino acid starvation-induced autophagy.

AlphaFold DB , UniProt , Accession A0A061IDZ5, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene n/a, Length 124 aa.

						>A0A061IDZ5_CRIGR|A0A061IDZ5
MNKMDGLSTEEEDGMFTSISLANDTDHSSKSVHPRAESLFPKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.6	Very low	46.4	Very low	225 Å²	225	151.9 Å²	151.9	100%	1.108	81%	0.811	S	S	*	*				0	126.1	0	-85.6	87.9	117	0	0	108.1
2	N	43.2	Very low	46.9	Very low	140 Å²	140	154.2 Å²	154.2	75%	0.749	81%	0.813	S	S	*	*			cis	-152.3	122.2	1.5	-73	-27.1	0	0	0	104.9
3	K	44.4	Very low	47.2	Very low	188 Å²	188	153.7 Å²	153.7	82%	0.817	81%	0.811	S	S	*	*				26.6	105.9	108.8	-85.7	-178.5	167.8	-169.6	0	113.6
4	M	53.1	Low	47.7	Very low	194 Å²	194	147.6 Å²	147.6	96%	0.956	80%	0.803	S	S	*	*			trans	-97.8	110.1	150.8	-77.3	-145.3	-124.1	0	0	107.2
5	D	44.5	Very low	48	Very low	138 Å²	138	149.1 Å²	149.1	74%	0.738	81%	0.806	S	S	*	*			trans	-59.6	135	162.4	-55.9	-56.8	0	0	0	107.8
6	G	50.3	Low	48	Very low	68 Å²	68	152 Å²	152	70%	0.701	81%	0.809	S	S	*	*				82.4	91.1	80.4	0	0	0	0	0	109.4
7	L	43.8	Very low	48.2	Very low	166 Å²	166	149.9 Å²	149.9	87%	0.869	80%	0.804	S	S	*	*			trans	-149.3	103.8	163.5	-140.9	73.8	0	0	0	111.3
8	S	46.2	Very low	48.8	Very low	89 Å²	89	147.3 Å²	147.3	62%	0.622	80%	0.799	S	S	*	*			trans	54.5	99.9	140.3	-49.2	0	0	0	0	119.2	E10	S8-E10 PolarHBondContact O-N 3.4Å
9	T	43.7	Very low	49.2	Very low	132 Å²	132	147.8 Å²	147.8	81%	0.81	80%	0.799	S	S	*	*			trans	-53.4	105.9	145.1	-6.6	0	0	0	0	108.5	E11	T9-E11 PolarHBondContact O-N 3.37Å
10	E	49.6	Very low	49.5	Very low	164 Å²	164	146.1 Å²	146.1	77%	0.766	80%	0.799	S	S	*	*			trans	-92.6	91.6	161.9	-69.5	-173.9	174.3	0	0	106.4	S8 E12	S8-E10 PolarHBondContact O-N 3.4Å; E10-E12 VanDerWaalsContact C-N 3.3Å; E10-E12 PolarHBondContact O-N 2.92Å
11	E	48.6	Very low	49.7	Very low	167 Å²	167	147.3 Å²	147.3	78%	0.78	80%	0.804	S	S	*	*			trans	-63.8	96.5	160.5	-65.9	-176.2	170.9	0	0	106.5	T9 D13	T9-E11 PolarHBondContact O-N 3.37Å; E11-D13 PolarHBondContact O-N 3.06Å
12	E	52.6	Low	50.1	Low	179 Å²	179	140.9 Å²	140.9	84%	0.836	79%	0.786	S	S	*	*			trans	-67.9	84.3	165.1	-80.2	-91.8	148.9	0	0	107.1	E10 G14	E10-E12 VanDerWaalsContact C-N 3.3Å; E10-E12 PolarHBondContact O-N 2.92Å; E12-G14 PolarHBondContact O-N 3.36Å; E12-G14 VanDerWaalsContact O-N 3.14Å
13	D	50.6	Low	50.5	Low	148 Å²	148	140.6 Å²	140.6	79%	0.791	79%	0.785	S	S	*	*			trans	-53.5	112.2	171.3	-144.8	6.5	0	0	0	107.5	E11 M15	E11-D13 PolarHBondContact O-N 3.06Å; D13-M15 PolarHBondContact O-N 3.38Å
14	G	54.9	Low	50.8	Low	68 Å²	68	139.3 Å²	139.3	70%	0.701	79%	0.787	S	S	*	*			trans	-59	98	-178.9	0	0	0	0	0	109.7	E12 F16	E12-G14 PolarHBondContact O-N 3.36Å; E12-G14 VanDerWaalsContact O-N 3.14Å; G14-F16 PolarHBondContact O-N 2.93Å
15	M	51.8	Low	50.9	Low	171 Å²	171	134 Å²	134	84%	0.842	77%	0.766	S	S	*	*			trans	-68.6	79	173.6	-172.2	155.6	75.6	0	0	108.7	D13 T17	D13-M15 PolarHBondContact O-N 3.38Å; M15-T17 PolarHBondContact O-N 3.4Å
16	F	47.4	Very low	51.1	Low	195 Å²	195	134.7 Å²	134.7	86%	0.855	77%	0.769	S	S	*	*			trans	-63.8	107.2	171.1	-151.1	-92.3	0	0	0	106.6	G14 S18	G14-F16 PolarHBondContact O-N 2.93Å; F16-S18 PolarHBondContact O-N 2.89Å
17	T	52.3	Low	51.1	Low	117 Å²	117	139.1 Å²	139.1	72%	0.718	77%	0.771	S	S	*	*			trans	-68.7	100.7	-179.3	-4.7	0	0	0	0	107.6	M15 I19	M15-T17 PolarHBondContact O-N 3.4Å; T17-I19 PolarHBondContact O-N 3.36Å
18	S	58.7	Low	51.5	Low	103 Å²	103	136.1 Å²	136.1	72%	0.72	76%	0.764	S	S	*	*			trans	-70	95.4	173.5	59.2	0	0	0	0	109.2	F16 S20	F16-S18 PolarHBondContact O-N 2.89Å; S18-S20 PolarHBondContact O-N 3.47Å; S18-S20 VanDerWaalsContact O-N 3.16Å
19	I	56.7	Low	51.7	Low	156 Å²	156	137 Å²	137	80%	0.8	77%	0.77	S	S	*	*			trans	-65.5	108.8	169.6	36.5	169.7	0	0	0	109.4	T17 L21	T17-I19 PolarHBondContact O-N 3.36Å; I19-L21 PolarHBondContact O-N 3Å
20	S	55.5	Low	52.2	Low	114 Å²	114	140.9 Å²	140.9	80%	0.797	78%	0.776	S	S	*	*			trans	-75.7	116.7	174.8	-68.8	0	0	0	0	110	S18 A22	S18-S20 PolarHBondContact O-N 3.47Å; S18-S20 VanDerWaalsContact O-N 3.16Å; S20-A22 PolarHBondContact O-N 3.49Å
21	L	52.4	Low	52.1	Low	172 Å²	172	138.3 Å²	138.3	90%	0.901	78%	0.776	S	S	*	*			trans	-80.2	94.3	171	-70.2	167.2	0	0	0	108.9	I19 N23	I19-L21 PolarHBondContact O-N 3Å; L21-N23 PolarHBondContact O-N 3.18Å
22	A	52.3	Low	51.7	Low	90 Å²	90	136.3 Å²	136.3	74%	0.744	78%	0.775	S	S	*	*			trans	-73.2	116.4	168	0	0	0	0	0	109.1	S20 D24	S20-A22 PolarHBondContact O-N 3.49Å; A22-D24 PolarHBondContact O-N 3.45Å
23	N	50.2	Low	51	Low	134 Å²	134	136.4 Å²	136.4	72%	0.717	78%	0.775	S	S	*	*			trans	-75.9	95.7	174.7	178.8	75.8	0	0	0	109.3	L21 T25	L21-N23 PolarHBondContact O-N 3.18Å; N23-T25 VanDerWaalsContact C-N 3.31Å; N23-T25 PolarHBondContact ND2-OG1 3.09Å; N23-T25 PolarHBondContact O-N 3.49Å
24	D	51.1	Low	50.8	Low	161 Å²	161	135.1 Å²	135.1	86%	0.861	78%	0.775	S	S	*	*			trans	-72.9	87.4	170.1	-88.2	-20.4	0	0	0	109.5	A22	A22-D24 PolarHBondContact O-N 3.45Å
25	T	55.5	Low	50	Low	83 Å²	83	143.5 Å²	143.5	51%	0.509	79%	0.785	S	S	.	*			trans	-101.4	92.9	159.3	-59.9	0	0	0	0	107	N23 H27	N23-T25 VanDerWaalsContact C-N 3.31Å; N23-T25 PolarHBondContact ND2-OG1 3.09Å; N23-T25 PolarHBondContact O-N 3.49Å; T25-H27 WeakPolarHBondContact CG2-NE2 3.24Å
26	D	48.7	Very low	49.4	Very low	151 Å²	151	139.5 Å²	139.5	81%	0.807	78%	0.779	S	S	*	*			trans	-105.9	121.8	167.6	-154.7	0.6	0	0	0	110.8
27	H	51.1	Low	49.5	Very low	162 Å²	162	139.3 Å²	139.3	75%	0.75	78%	0.781	S	S	*	*			trans	-96.3	102.7	-179.9	-67.7	-75.6	0	0	0	108.7	T25	T25-H27 WeakPolarHBondContact CG2-NE2 3.24Å
28	S	51.8	Low	49.3	Very low	103 Å²	103	137.9 Å²	137.9	72%	0.72	78%	0.776	S	S	*	*			trans	-166.7	125.7	167.7	-155.2	0	0	0	0	108.4
29	S	50.6	Low	48.9	Very low	106 Å²	106	141.2 Å²	141.2	74%	0.741	79%	0.785	S	S	*	*			cis	-160.7	147.2	31.7	-92.5	0	0	0	0	110
30	K	53.7	Low	48.6	Very low	214 Å²	214	141.9 Å²	141.9	93%	0.93	78%	0.782	S	S	*	*			trans	-68.6	123	161.8	-71	170.5	176.4	170.7	0	108.9
31	S	47.3	Very low	48	Very low	110 Å²	110	141.8 Å²	141.8	77%	0.769	78%	0.779	S	S	*	*			trans	-135.5	129.8	155	96.2	0	0	0	0	109.5
32	V	41.3	Very low	48	Very low	126 Å²	126	142 Å²	142	76%	0.764	77%	0.772	S	S	*	*			trans	-108.4	114.6	-178.7	-179.9	0	0	0	0	106.5
33	H	37.2	Very low	48	Very low	181 Å²	181	146.1 Å²	146.1	84%	0.838	78%	0.779	S	S	*	*			trans	-147.9	129	158.7	-78	-50.7	0	0	0	110.1
34	P	46.6	Very low	48.2	Very low	120 Å²	120	145.9 Å²	145.9	78%	0.779	78%	0.775	S	S	*	*			trans	-98.7	124.2	172.4	34.1	-24.3	0	0	0	109.6
35	R	37.8	Very low	48.3	Very low	244 Å²	244	144.6 Å²	144.6	92%	0.921	77%	0.768	S	S	*	*			trans	-163.2	119.3	158.2	-159.6	156.7	171.4	166.9	-4.2	115.2
36	A	39.1	Very low	48.1	Very low	87 Å²	87	145.2 Å²	145.2	72%	0.719	78%	0.781	S	S	*	*			trans	64	118.1	145.5	0	0	0	0	0	119.4	S38	A36-S38 PolarHBondContact O-N 3.04Å
37	E	49.6	Very low	48.2	Very low	191 Å²	191	144.4 Å²	144.4	89%	0.893	78%	0.777	S	S	*	*			trans	-49.8	128.6	159.4	-56.5	-160.1	158.1	0	0	111.9
38	S	47.2	Very low	48.4	Very low	88 Å²	88	143 Å²	143	62%	0.615	77%	0.772	S	S	*	*			trans	-136.1	116.5	149.6	66.6	0	0	0	0	107.2	A36 F40	A36-S38 PolarHBondContact O-N 3.04Å; S38-F40 PolarHBondContact O-N 3.01Å; S38-F40 VanDerWaalsContact O-N 3.09Å
39	L	51.6	Low	48.6	Very low	172 Å²	172	144.4 Å²	144.4	90%	0.901	77%	0.772	S	S	*	*			trans	-56.1	105.4	168	-73.9	154.7	0	0	0	108.6
40	F	49.3	Very low	49	Very low	170 Å²	170	141.9 Å²	141.9	75%	0.746	76%	0.757	S	S	*	*			trans	-131.9	139.2	159.8	-74.7	-77.1	0	0	0	109.9	S38	S38-F40 PolarHBondContact O-N 3.01Å; S38-F40 VanDerWaalsContact O-N 3.09Å
41	P	44.1	Very low	49.4	Very low	112 Å²	112	134.9 Å²	134.9	73%	0.727	73%	0.732	S	S	*	*			trans	-65.4	139.9	-162.4	-19.2	32.7	0	0	0	112.6	M43	P41-M43 VanDerWaalsContact C-N 3.3Å; P41-M43 PolarHBondContact O-N 3.35Å
42	K	52.5	Low	50.4	Low	176 Å²	176	134.9 Å²	134.9	77%	0.765	72%	0.724	S	S	*	*			trans	-52.8	90.2	163.3	-176.7	76.2	170.3	178.6	0	109.6	M44	K42-M44 HydrophobicContact CD-CB 4.33Å; K42-M44 HydrophobicContact CD-SD 4.42Å
43	M	51.2	Low	51.8	Low	178 Å²	178	131.5 Å²	131.5	88%	0.877	71%	0.709	S	S	*	*			trans	-111.2	74.8	161.6	-68.4	-160.7	68.8	0	0	107.3	P41	P41-M43 VanDerWaalsContact C-N 3.3Å; P41-M43 PolarHBondContact O-N 3.35Å
44	M	54.9	Low	53.5	Low	129 Å²	129	129.7 Å²	129.7	64%	0.635	70%	0.701	S	S	*	*			trans	-124.5	109.1	175.4	-74.8	178	171.4	0	0	108.1	K42	K42-M44 HydrophobicContact CD-CB 4.33Å; K42-M44 HydrophobicContact CD-SD 4.42Å
45	N	52.8	Low	55.2	Low	133 Å²	133	128.1 Å²	128.1	71%	0.711	69%	0.685	S	S	*	*			trans	70.4	71.3	141.9	-43.2	-24.8	0	0	0	116.8	M48	N45-M48 HydrophobicContact CB-CB 4.48Å
46	A	51.8	Low	57.5	Low	96 Å²	96	121 Å²	121	79%	0.793	66%	0.663	S	S	*	*	S	Bend	trans	-98.4	-9.4	158.9	0	0	0	0	0	112.8
47	D	50.1	Low	59.7	Low	134 Å²	134	121.1 Å²	121.1	72%	0.717	66%	0.655	S	S	*	*	S	Bend	trans	-96.6	-11.9	-176.3	-151.7	25.7	0	0	0	112.7
48	M	56.3	Low	61.6	Low	133 Å²	133	118.4 Å²	118.4	66%	0.655	64%	0.642	S	S	*	*	H	α-helix	trans	-83.4	-22.9	179.6	-151	59.9	177.4	0	0	113.1	N45 D52	N45-M48 HydrophobicContact CB-CB 4.48Å; M48-D52 PolarHBondContact O-N 2.75Å
49	D	56.6	Low	63.7	Low	133 Å²	133	118.6 Å²	118.6	71%	0.711	64%	0.635	S	S	*	*	H	α-helix	trans	-73	-29.2	177.4	-113.2	2.8	0	0	0	112.2	A53	D49-A53 WeakPolarHBondContact O-CB 3.39Å; D49-A53 PolarHBondContact O-N 2.88Å
50	A	59.2	Low	65.6	Low	52 Å²	52	114.6 Å²	114.6	43%	0.43	61%	0.612	S	S	.	*	H	α-helix	trans	-75.7	-39.7	178.7	0	0	0	0	0	112	A53 E54	A50-A53 PolarHBondContact O-N 2.73Å; A50-E54 PolarHBondContact O-N 2.82Å
51	V	60.9	Low	67.8	Low	68 Å²	68	112.3 Å²	112.3	41%	0.412	60%	0.604	S	S	.	*	H	α-helix	trans	-67.6	-36.6	176.5	178.5	0	0	0	0	111.2	N55	V51-N55 WeakPolarHBondContact O-CB 3.21Å; V51-N55 VanDerWaalsContact O-CG 3.29Å; V51-N55 PolarHBondContact O-N 2.94Å; V51-N55 VanDerWaalsContact O-N 3.13Å; V51-N55 PolarHBondContact O-ND2 3.14Å
52	D	67.7	Low	70.3	Confident	110 Å²	110	113.2 Å²	113.2	59%	0.588	60%	0.596	S	S	*	*	H	α-helix	trans	-69.9	-34.5	176.4	-152.3	32.2	0	0	0	111.8	M48 Q56	M48-D52 PolarHBondContact O-N 2.75Å; D52-Q56 WeakPolarHBondContact O-CB 3.38Å; D52-Q56 PolarHBondContact O-N 3.3Å
53	A	70.6	Confident	72.3	Confident	54 Å²	54	107.9 Å²	107.9	45%	0.446	58%	0.579	S	S	.	*	H	α-helix	trans	-69	-40.7	174.5	0	0	0	0	0	113.1	D49 A50 Q56 V57	D49-A53 WeakPolarHBondContact O-CB 3.39Å; D49-A53 PolarHBondContact O-N 2.88Å; A50-A53 PolarHBondContact O-N 2.73Å; A53-Q56 PolarHBondContact O-N 3.34Å; A53-V57 WeakPolarHBondContact O-CG2 3.4Å; A53-V57 PolarHBondContact O-N 2.78Å; A53-V57 VanDerWaalsContact O-N 3.13Å
54	E	74.1	Confident	74.6	Confident	144 Å²	144	108.2 Å²	108.2	67%	0.673	57%	0.57	S	S	*	*	H	α-helix	trans	-65.8	-42.9	175.8	-73.9	-173.8	177.9	0	0	111.9	A50 Q56 V57 E58	A50-E54 PolarHBondContact O-N 2.82Å; E54-Q56 VanDerWaalsContact C-N 3.3Å; E54-Q56 PolarHBondContact O-N 2.93Å; E54-V57 PolarHBondContact O-N 2.9Å; E54-E58 PolarHBondContact O-N 3.4Å
55	N	82.1	Confident	76.6	Confident	86 Å²	86	106.5 Å²	106.5	46%	0.46	56%	0.563	S	S	.	*	H	α-helix	trans	-63.6	-35	175.6	-73.2	-17.8	0	0	0	112.5	V51 E58 L59	V51-N55 WeakPolarHBondContact O-CB 3.21Å; V51-N55 VanDerWaalsContact O-CG 3.29Å; V51-N55 PolarHBondContact O-N 2.94Å; V51-N55 VanDerWaalsContact O-N 3.13Å; V51-N55 PolarHBondContact O-ND2 3.14Å; N55-E58 PolarHBondContact O-N 2.68Å; N55-L59 WeakPolarHBondContact O-CB 3.31Å; N55-L59 PolarHBondContact O-N 3.12Å
56	Q	85.6	Confident	78.8	Confident	95 Å²	95	104 Å²	104	44%	0.444	55%	0.549	S	S	.	.	H	α-helix	trans	-66	-41.3	175.2	-179.9	60.3	35.1	0	0	111.7	D52 A53 E54 L59 E60	D52-Q56 WeakPolarHBondContact O-CB 3.38Å; D52-Q56 PolarHBondContact O-N 3.3Å; A53-Q56 PolarHBondContact O-N 3.34Å; E54-Q56 VanDerWaalsContact C-N 3.3Å; E54-Q56 PolarHBondContact O-N 2.93Å; Q56-L59 PolarHBondContact O-N 3.38Å; Q56-E60 PolarHBondContact NE2-OE1 3.23Å; Q56-E60 WeakPolarHBondContact O-CG 3.47Å; Q56-E60 PolarHBondContact O-N 2.91Å
57	V	85.6	Confident	81	Confident	90 Å²	90	103.3 Å²	103.3	55%	0.545	53%	0.532	S	S	.	.	H	α-helix	trans	-64.3	-43.4	175.5	172	0	0	0	0	111.1	A53 E54 L59 E60 E61	A53-V57 WeakPolarHBondContact O-CG2 3.4Å; A53-V57 PolarHBondContact O-N 2.78Å; A53-V57 VanDerWaalsContact O-N 3.13Å; E54-V57 PolarHBondContact O-N 2.9Å; V57-L59 VanDerWaalsContact C-N 3.32Å; V57-L59 PolarHBondContact O-N 2.81Å; V57-E60 PolarHBondContact O-N 2.96Å; V57-E61 PolarHBondContact O-N 3.39Å
58	E	90.4	Very high	83.3	Confident	133 Å²	133	102.4 Å²	102.4	62%	0.621	52%	0.523	S	S	*	.	H	α-helix	trans	-61.5	-41.3	175.8	-172.2	-179.3	175.9	0	0	111.6	E54 N55 E60 E61 K62	E54-E58 PolarHBondContact O-N 3.4Å; N55-E58 PolarHBondContact O-N 2.68Å; E58-E60 PolarHBondContact O-N 3.23Å; E58-E61 PolarHBondContact O-N 3Å; E58-K62 WeakPolarHBondContact O-CB 3.45Å; E58-K62 PolarHBondContact O-N 3.5Å
59	L	90.4	Very high	85.3	Confident	92 Å²	92	99.6 Å²	99.6	48%	0.482	51%	0.513	S	S	.	.	H	α-helix	trans	-64.4	-39.7	177.1	-176.8	61.9	0	0	0	112.2	N55 Q56 V57 T63	N55-L59 WeakPolarHBondContact O-CB 3.31Å; N55-L59 PolarHBondContact O-N 3.12Å; Q56-L59 PolarHBondContact O-N 3.38Å; V57-L59 VanDerWaalsContact C-N 3.32Å; V57-L59 PolarHBondContact O-N 2.81Å; L59-T63 WeakPolarHBondContact O-CB 3.36Å; L59-T63 PolarHBondContact O-N 3.02Å; L59-T63 PolarHBondContact O-OG1 3.21Å
60	E	92.4	Very high	87.3	Confident	88 Å²	88	97.5 Å²	97.5	41%	0.411	50%	0.502	S	S	.	.	H	α-helix	trans	-66	-42.9	175.2	-75.6	176.4	-160.3	0	0	111.9	Q56 V57 E58 T63 R64	Q56-E60 PolarHBondContact NE2-OE1 3.23Å; Q56-E60 WeakPolarHBondContact O-CG 3.47Å; Q56-E60 PolarHBondContact O-N 2.91Å; V57-E60 PolarHBondContact O-N 2.96Å; E58-E60 PolarHBondContact O-N 3.23Å; E60-T63 PolarHBondContact O-N 2.95Å; E60-R64 WeakPolarHBondContact O-CG 3.43Å; E60-R64 PolarHBondContact O-N 3.15Å
61	E	94.9	Very high	89.1	Confident	122 Å²	122	101.5 Å²	101.5	57%	0.57	51%	0.511	S	S	*	.	H	α-helix	trans	-62.8	-45.8	175.9	-174.6	171.4	-170.8	0	0	111.2	V57 E58 T63 R64 L65	V57-E61 PolarHBondContact O-N 3.39Å; E58-E61 PolarHBondContact O-N 3Å; E61-T63 VanDerWaalsContact C-N 3.29Å; E61-T63 PolarHBondContact O-N 3.19Å; E61-R64 WeakPolarHBondContact O-CB 3.37Å; E61-R64 PolarHBondContact O-N 2.98Å; E61-R64 VanDerWaalsContact O-N 3.15Å; E61-L65 HydrophobicContact CG-CD1 4.35Å; E61-L65 WeakPolarHBondContact O-CG 3.48Å; E61-L65 PolarHBondContact O-N 3.16Å
62	K	96	Very high	90.9	Very high	131 Å²	131	103.5 Å²	103.5	57%	0.57	52%	0.519	S	S	*	.	H	α-helix	trans	-58	-43.1	174.1	-175.5	177.3	178.9	176.1	0	111.5	E58 L65 I66	E58-K62 WeakPolarHBondContact O-CB 3.45Å; E58-K62 PolarHBondContact O-N 3.5Å; K62-L65 PolarHBondContact O-N 3.08Å; K62-I66 HydrophobicContact CG-CD1 3.99Å; K62-I66 WeakPolarHBondContact O-CD1 3.31Å; K62-I66 VanDerWaalsContact O-CG1 3.22Å; K62-I66 WeakPolarHBondContact O-CG1 3.47Å; K62-I66 PolarHBondContact O-N 3.49Å
63	T	95.6	Very high	92.4	Very high	65 Å²	65	103.4 Å²	103.4	40%	0.399	52%	0.515	S	S	.	.	H	α-helix	trans	-63.4	-41.6	177.1	-58.8	0	0	0	0	111.4	L59 E60 E61 I66 N67	L59-T63 WeakPolarHBondContact O-CB 3.36Å; L59-T63 PolarHBondContact O-N 3.02Å; L59-T63 PolarHBondContact O-OG1 3.21Å; E60-T63 PolarHBondContact O-N 2.95Å; E61-T63 VanDerWaalsContact C-N 3.29Å; E61-T63 PolarHBondContact O-N 3.19Å; T63-I66 PolarHBondContact O-N 2.73Å; T63-N67 PolarHBondContact O-N 3.38Å; T63-N67 PolarHBondContact O-ND2 3.01Å
64	R	97.9	Very high	93.7	Very high	184 Å²	184	106 Å²	106	69%	0.694	52%	0.518	S	S	*	.	H	α-helix	trans	-63	-43.7	175.7	-73.2	178.5	-173.8	-171.5	5.6	112.2	E60 E61 N67 Q68	E60-R64 WeakPolarHBondContact O-CG 3.43Å; E60-R64 PolarHBondContact O-N 3.15Å; E61-R64 WeakPolarHBondContact O-CB 3.37Å; E61-R64 PolarHBondContact O-N 2.98Å; E61-R64 VanDerWaalsContact O-N 3.15Å; R64-N67 PolarHBondContact O-N 2.94Å; R64-Q68 PolarHBondContact O-N 3.25Å
65	L	98.3	Very high	94.9	Very high	93 Å²	93	103.4 Å²	103.4	49%	0.487	51%	0.512	S	S	.	.	H	α-helix	trans	-63.8	-42.2	176.7	-71.8	171.6	0	0	0	111.6	E61 K62 N67 Q68 V69	E61-L65 HydrophobicContact CG-CD1 4.35Å; E61-L65 WeakPolarHBondContact O-CG 3.48Å; E61-L65 PolarHBondContact O-N 3.16Å; K62-L65 PolarHBondContact O-N 3.08Å; L65-N67 VanDerWaalsContact C-N 3.33Å; L65-N67 PolarHBondContact O-N 3.46Å; L65-Q68 PolarHBondContact O-N 3.43Å; L65-V69 WeakPolarHBondContact O-CG2 3.41Å; L65-V69 PolarHBondContact O-N 3.4Å
66	I	97.7	Very high	95.7	Very high	82 Å²	82	104.5 Å²	104.5	42%	0.421	52%	0.517	S	S	.	.	H	α-helix	trans	-57.7	-47.7	175	-71.1	164.1	0	0	0	110.3	K62 T63 Q68 V69 L70	K62-I66 HydrophobicContact CG-CD1 3.99Å; K62-I66 WeakPolarHBondContact O-CD1 3.31Å; K62-I66 VanDerWaalsContact O-CG1 3.22Å; K62-I66 WeakPolarHBondContact O-CG1 3.47Å; K62-I66 PolarHBondContact O-N 3.49Å; T63-I66 PolarHBondContact O-N 2.73Å; I66-Q68 PolarHBondContact O-N 2.96Å; I66-V69 PolarHBondContact O-N 3.31Å; I66-L70 HydrophobicContact CG2-CD1 3.97Å; I66-L70 HydrophobicContact CG2-CG 4.35Å; I66-L70 WeakPolarHBondContact O-CG 3.5Å; I66-L70 PolarHBondContact O-N 3.48Å
67	N	98	Very high	96.3	Very high	80 Å²	80	106.3 Å²	106.3	43%	0.428	53%	0.526	S	S	.	.	H	α-helix	trans	-61.7	-42.7	179.3	-70.8	-28.2	0	0	0	112.3	T63 R64 L65 V69 L70 E71	T63-N67 PolarHBondContact O-N 3.38Å; T63-N67 PolarHBondContact O-ND2 3.01Å; R64-N67 PolarHBondContact O-N 2.94Å; L65-N67 VanDerWaalsContact C-N 3.33Å; L65-N67 PolarHBondContact O-N 3.46Å; N67-V69 VanDerWaalsContact C-N 3.32Å; N67-V69 PolarHBondContact O-N 2.94Å; N67-L70 PolarHBondContact O-N 3Å; N67-E71 WeakPolarHBondContact O-CG 3.34Å; N67-E71 PolarHBondContact O-N 3.41Å
68	Q	98.5	Very high	96.9	Very high	116 Å²	116	105.9 Å²	105.9	54%	0.542	52%	0.521	S	S	.	.	H	α-helix	trans	-61.1	-42.1	175.8	179.5	173.8	73.2	0	0	111.8	R64 L65 I66 L70 E71 L72	R64-Q68 PolarHBondContact O-N 3.25Å; L65-Q68 PolarHBondContact O-N 3.43Å; I66-Q68 PolarHBondContact O-N 2.96Å; Q68-L70 VanDerWaalsContact C-N 3.34Å; Q68-E71 PolarHBondContact O-N 3.33Å; Q68-L72 HydrophobicContact CG-CD1 4.17Å; Q68-L72 WeakPolarHBondContact O-CB 3.43Å; Q68-L72 VanDerWaalsContact O-CG 3.29Å; Q68-L72 WeakPolarHBondContact O-CG 3.41Å; Q68-L72 PolarHBondContact O-N 2.8Å
69	V	98.4	Very high	97.3	Very high	73 Å²	73	103.9 Å²	103.9	44%	0.442	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-43.1	176.1	170.8	0	0	0	0	110.8	L65 I66 N67 L72 Q73	L65-V69 WeakPolarHBondContact O-CG2 3.41Å; L65-V69 PolarHBondContact O-N 3.4Å; I66-V69 PolarHBondContact O-N 3.31Å; N67-V69 VanDerWaalsContact C-N 3.32Å; N67-V69 PolarHBondContact O-N 2.94Å; V69-L72 PolarHBondContact O-N 2.83Å; V69-Q73 HydrophobicContact CG1-CG 4.33Å; V69-Q73 WeakPolarHBondContact O-CB 3.4Å; V69-Q73 VanDerWaalsContact O-CG 3.28Å; V69-Q73 WeakPolarHBondContact O-CG 3.47Å; V69-Q73 PolarHBondContact O-N 3.07Å
70	L	98.3	Very high	97.7	Very high	90 Å²	90	102.2 Å²	102.2	47%	0.471	51%	0.51	S	S	.	.	H	α-helix	trans	-63.2	-42.9	178.4	-70.1	173.8	0	0	0	112.2	I66 N67 Q68 L72 Q73 H74	I66-L70 HydrophobicContact CG2-CD1 3.97Å; I66-L70 HydrophobicContact CG2-CG 4.35Å; I66-L70 WeakPolarHBondContact O-CG 3.5Å; I66-L70 PolarHBondContact O-N 3.48Å; N67-L70 PolarHBondContact O-N 3Å; Q68-L70 VanDerWaalsContact C-N 3.34Å; L70-L72 PolarHBondContact O-N 3.14Å; L70-Q73 PolarHBondContact O-N 2.9Å; L70-H74 PolarHBondContact O-N 3.41Å
71	E	98.3	Very high	98	Very high	135 Å²	135	101 Å²	101	63%	0.631	51%	0.514	S	S	*	.	H	α-helix	trans	-62.6	-42.5	176.2	-72.9	173.8	-173.1	0	0	112	N67 Q68 H74 T75	N67-E71 WeakPolarHBondContact O-CG 3.34Å; N67-E71 PolarHBondContact O-N 3.41Å; Q68-E71 PolarHBondContact O-N 3.33Å; E71-H74 PolarHBondContact O-N 2.94Å; E71-T75 PolarHBondContact O-N 3.04Å; E71-T75 PolarHBondContact O-OG1 3.28Å
72	L	98.6	Very high	98.1	Very high	110 Å²	110	103.5 Å²	103.5	58%	0.576	52%	0.519	S	S	*	.	H	α-helix	trans	-65.7	-41.2	176.6	-72.5	173.4	0	0	0	111.9	Q68 V69 L70 T75 L76	Q68-L72 HydrophobicContact CG-CD1 4.17Å; Q68-L72 WeakPolarHBondContact O-CB 3.43Å; Q68-L72 VanDerWaalsContact O-CG 3.29Å; Q68-L72 WeakPolarHBondContact O-CG 3.41Å; Q68-L72 PolarHBondContact O-N 2.8Å; V69-L72 PolarHBondContact O-N 2.83Å; L70-L72 PolarHBondContact O-N 3.14Å; L72-T75 PolarHBondContact O-N 3.34Å; L72-L76 VanDerWaalsContact O-CB 3.31Å; L72-L76 WeakPolarHBondContact O-CB 3.17Å; L72-L76 PolarHBondContact O-N 2.95Å
73	Q	98.6	Very high	98.3	Very high	109 Å²	109	100.3 Å²	100.3	51%	0.509	51%	0.51	S	S	.	.	H	α-helix	trans	-60.5	-46.5	175.7	-77.7	175.2	-20	0	0	111.3	V69 L70 T75 L76 E77	V69-Q73 HydrophobicContact CG1-CG 4.33Å; V69-Q73 WeakPolarHBondContact O-CB 3.4Å; V69-Q73 VanDerWaalsContact O-CG 3.28Å; V69-Q73 WeakPolarHBondContact O-CG 3.47Å; V69-Q73 PolarHBondContact O-N 3.07Å; L70-Q73 PolarHBondContact O-N 2.9Å; Q73-T75 PolarHBondContact O-N 3.47Å; Q73-L76 PolarHBondContact O-N 3.02Å; Q73-E77 PolarHBondContact O-N 2.96Å
74	H	98.1	Very high	98.4	Very high	109 Å²	109	101.4 Å²	101.4	51%	0.505	51%	0.514	S	S	.	.	H	α-helix	trans	-61.3	-45.4	177.2	-175.1	43.6	0	0	0	111.9	L70 E71 L76 E77 D78	L70-H74 PolarHBondContact O-N 3.41Å; E71-H74 PolarHBondContact O-N 2.94Å; H74-L76 VanDerWaalsContact C-N 3.28Å; H74-L76 PolarHBondContact O-N 3.21Å; H74-E77 PolarHBondContact O-N 2.92Å; H74-D78 IonicContact CE1-OD1 3.71Å; H74-D78 IonicContact CE1-OD2 3.9Å; H74-D78 IonicContact NE2-OD2 3.88Å; H74-D78 PolarHBondContact O-N 2.73Å
75	T	98.5	Very high	98.5	Very high	89 Å²	89	95.4 Å²	95.4	55%	0.546	50%	0.503	S	S	.	.	H	α-helix	trans	-61.4	-37.9	176.7	-55.7	0	0	0	0	112	E71 L72 Q73 L79	E71-T75 PolarHBondContact O-N 3.04Å; E71-T75 PolarHBondContact O-OG1 3.28Å; L72-T75 PolarHBondContact O-N 3.34Å; Q73-T75 PolarHBondContact O-N 3.47Å; T75-L79 WeakPolarHBondContact O-CB 3.42Å; T75-L79 PolarHBondContact O-N 3.03Å
76	L	98.6	Very high	98.5	Very high	109 Å²	109	95.5 Å²	95.5	57%	0.571	51%	0.507	S	S	*	.	H	α-helix	trans	-69.7	-39.5	178.5	-178.8	63.3	0	0	0	112	L72 Q73 H74 L79 S80	L72-L76 VanDerWaalsContact O-CB 3.31Å; L72-L76 WeakPolarHBondContact O-CB 3.17Å; L72-L76 PolarHBondContact O-N 2.95Å; Q73-L76 PolarHBondContact O-N 3.02Å; H74-L76 VanDerWaalsContact C-N 3.28Å; H74-L76 PolarHBondContact O-N 3.21Å; L76-L79 PolarHBondContact O-N 3.37Å; L76-S80 WeakPolarHBondContact O-CB 3.31Å; L76-S80 PolarHBondContact O-N 3.32Å; L76-S80 PolarHBondContact O-OG 3.01Å
77	E	98.5	Very high	98.5	Very high	132 Å²	132	97 Å²	97	62%	0.617	51%	0.511	S	S	*	.	H	α-helix	trans	-61.2	-50	174.7	-175.6	177.2	-169.8	0	0	110.9	Q73 H74 L79 S80 A81	Q73-E77 PolarHBondContact O-N 2.96Å; H74-E77 PolarHBondContact O-N 2.92Å; E77-L79 VanDerWaalsContact C-N 3.3Å; E77-L79 PolarHBondContact O-N 2.86Å; E77-S80 WeakPolarHBondContact O-CB 3.46Å; E77-S80 PolarHBondContact O-N 2.95Å; E77-S80 VanDerWaalsContact O-N 3.08Å; E77-A81 PolarHBondContact O-N 3.13Å
78	D	98.6	Very high	98.6	Very high	82 Å²	82	100 Å²	100	44%	0.439	52%	0.522	S	S	.	.	H	α-helix	trans	-57.3	-43.3	176.2	-79	-7.9	0	0	0	112.2	H74 S80 R82	H74-D78 IonicContact CE1-OD1 3.71Å; H74-D78 IonicContact CE1-OD2 3.9Å; H74-D78 IonicContact NE2-OD2 3.88Å; H74-D78 PolarHBondContact O-N 2.73Å; D78-S80 VanDerWaalsContact C-N 3.34Å; D78-R82 VanDerWaalsContact O-CG 3.27Å; D78-R82 WeakPolarHBondContact O-CG 3.43Å; D78-R82 PolarHBondContact O-N 3.08Å
79	L	98.6	Very high	98.6	Very high	91 Å²	91	100.3 Å²	100.3	48%	0.476	52%	0.524	S	S	.	.	H	α-helix	trans	-65.4	-40.4	177.3	-177.2	60.6	0	0	0	111.3	T75 L76 E77 R82 V83	T75-L79 WeakPolarHBondContact O-CB 3.42Å; T75-L79 PolarHBondContact O-N 3.03Å; L76-L79 PolarHBondContact O-N 3.37Å; E77-L79 VanDerWaalsContact C-N 3.3Å; E77-L79 PolarHBondContact O-N 2.86Å; L79-R82 PolarHBondContact O-N 3.34Å; L79-V83 WeakPolarHBondContact O-CG2 3.37Å; L79-V83 PolarHBondContact O-N 2.92Å
80	S	98.6	Very high	98.6	Very high	57 Å²	57	100.2 Å²	100.2	40%	0.399	52%	0.521	S	S	.	.	H	α-helix	trans	-62.8	-46.8	178.2	-59.6	0	0	0	0	111.1	L76 E77 D78 R82 V83 D84	L76-S80 WeakPolarHBondContact O-CB 3.31Å; L76-S80 PolarHBondContact O-N 3.32Å; L76-S80 PolarHBondContact O-OG 3.01Å; E77-S80 WeakPolarHBondContact O-CB 3.46Å; E77-S80 PolarHBondContact O-N 2.95Å; E77-S80 VanDerWaalsContact O-N 3.08Å; D78-S80 VanDerWaalsContact C-N 3.34Å; S80-R82 VanDerWaalsContact C-N 3.31Å; S80-R82 PolarHBondContact O-N 3.34Å; S80-V83 WeakPolarHBondContact O-CB 3.38Å; S80-V83 PolarHBondContact O-N 3.06Å; S80-V83 VanDerWaalsContact O-N 3.13Å; S80-D84 PolarHBondContact O-N 2.92Å
81	A	98.6	Very high	98.6	Very high	62 Å²	62	101.4 Å²	101.4	51%	0.512	53%	0.527	S	S	.	.	H	α-helix	trans	-59.8	-41.6	175.9	0	0	0	0	0	112.1	E77 D84 A85	E77-A81 PolarHBondContact O-N 3.13Å; A81-D84 PolarHBondContact O-N 3.24Å; A81-A85 PolarHBondContact O-N 3.16Å
82	R	98.8	Very high	98.6	Very high	175 Å²	175	101.9 Å²	101.9	66%	0.66	53%	0.527	S	S	*	.	H	α-helix	trans	-64.2	-39.9	175.3	-73	172.7	63	-167.9	-1.2	112.5	D78 L79 S80 D84 A85 V86	D78-R82 VanDerWaalsContact O-CG 3.27Å; D78-R82 WeakPolarHBondContact O-CG 3.43Å; D78-R82 PolarHBondContact O-N 3.08Å; L79-R82 PolarHBondContact O-N 3.34Å; S80-R82 VanDerWaalsContact C-N 3.31Å; S80-R82 PolarHBondContact O-N 3.34Å; R82-D84 VanDerWaalsContact C-N 3.33Å; R82-A85 PolarHBondContact O-N 3Å; R82-V86 VanDerWaalsContact O-CG2 3.31Å; R82-V86 WeakPolarHBondContact O-CG2 3.27Å; R82-V86 PolarHBondContact O-N 3.31Å
83	V	98.9	Very high	98.6	Very high	63 Å²	63	100.4 Å²	100.4	38%	0.382	52%	0.519	S	S	.	.	H	α-helix	trans	-62	-43.2	176.4	164.1	0	0	0	0	110.7	L79 S80 V86 K87	L79-V83 WeakPolarHBondContact O-CG2 3.37Å; L79-V83 PolarHBondContact O-N 2.92Å; S80-V83 WeakPolarHBondContact O-CB 3.38Å; S80-V83 PolarHBondContact O-N 3.06Å; S80-V83 VanDerWaalsContact O-N 3.13Å; V83-V86 PolarHBondContact O-N 3.05Å; V83-K87 HydrophobicContact CG1-CD 4.3Å; V83-K87 VanDerWaalsContact CG1-CE 3.48Å; V83-K87 WeakPolarHBondContact O-CG 3.34Å; V83-K87 PolarHBondContact O-N 3.02Å
84	D	98.6	Very high	98.6	Very high	89 Å²	89	101.1 Å²	101.1	48%	0.476	52%	0.521	S	S	.	.	H	α-helix	trans	-68.5	-39.1	-179.9	-68.6	-23	0	0	0	112.2	S80 A81 R82 V86 K87 E88	S80-D84 PolarHBondContact O-N 2.92Å; A81-D84 PolarHBondContact O-N 3.24Å; R82-D84 VanDerWaalsContact C-N 3.33Å; D84-V86 VanDerWaalsContact C-N 3.34Å; D84-V86 PolarHBondContact O-N 3.37Å; D84-K87 PolarHBondContact O-N 3.44Å; D84-K87 IonicContact OD1-NZ 2.92Å; D84-K87 PolarHBondContact OD1-NZ 2.92Å; D84-E88 PolarHBondContact O-N 2.75Å
85	A	98.7	Very high	98.6	Very high	58 Å²	58	99 Å²	99	48%	0.479	52%	0.518	S	S	.	.	H	α-helix	trans	-58.5	-43.8	171.4	0	0	0	0	0	112.4	A81 R82 E88 E89	A81-A85 PolarHBondContact O-N 3.16Å; R82-A85 PolarHBondContact O-N 3Å; A85-E88 PolarHBondContact O-N 3.34Å; A85-E89 PolarHBondContact O-N 3.04Å
86	V	98.8	Very high	98.6	Very high	94 Å²	94	99.8 Å²	99.8	57%	0.57	52%	0.515	S	S	*	.	H	α-helix	trans	-66	-38.6	177.3	170.9	0	0	0	0	111.6	R82 V83 D84 N90	R82-V86 VanDerWaalsContact O-CG2 3.31Å; R82-V86 WeakPolarHBondContact O-CG2 3.27Å; R82-V86 PolarHBondContact O-N 3.31Å; V83-V86 PolarHBondContact O-N 3.05Å; D84-V86 VanDerWaalsContact C-N 3.34Å; D84-V86 PolarHBondContact O-N 3.37Å; V86-N90 WeakPolarHBondContact O-CB 3.41Å; V86-N90 PolarHBondContact O-N 2.9Å
87	K	98.8	Very high	98.6	Very high	114 Å²	114	99.5 Å²	99.5	50%	0.496	52%	0.515	S	S	.	.	H	α-helix	trans	-63.2	-43.5	175.1	-73.3	172.9	-168.9	154.4	0	111.3	V83 D84 N90 L91	V83-K87 HydrophobicContact CG1-CD 4.3Å; V83-K87 VanDerWaalsContact CG1-CE 3.48Å; V83-K87 WeakPolarHBondContact O-CG 3.34Å; V83-K87 PolarHBondContact O-N 3.02Å; D84-K87 PolarHBondContact O-N 3.44Å; D84-K87 IonicContact OD1-NZ 2.92Å; D84-K87 PolarHBondContact OD1-NZ 2.92Å; K87-N90 WeakPolarHBondContact O-CB 3.28Å; K87-N90 PolarHBondContact O-N 3.26Å; K87-L91 WeakPolarHBondContact O-CG 3.44Å; K87-L91 PolarHBondContact O-N 3.41Å
88	E	98.6	Very high	98.6	Very high	144 Å²	144	100.4 Å²	100.4	67%	0.673	52%	0.519	S	S	*	.	H	α-helix	trans	-61.5	-47.8	178.4	-173.6	178.5	-179.3	0	0	111.4	D84 A85 N90 L91 K92	D84-E88 PolarHBondContact O-N 2.75Å; A85-E88 PolarHBondContact O-N 3.34Å; E88-N90 VanDerWaalsContact C-N 3.3Å; E88-N90 PolarHBondContact O-N 3.21Å; E88-L91 PolarHBondContact O-N 3.48Å; E88-K92 PolarHBondContact O-N 2.9Å
89	E	98.6	Very high	98.6	Very high	121 Å²	121	101.4 Å²	101.4	57%	0.565	53%	0.528	S	S	*	.	H	α-helix	trans	-59.5	-42.2	175.2	-174.1	180	-171.2	0	0	111.5	A85 L91 K92 L93	A85-E89 PolarHBondContact O-N 3.04Å; E89-L91 VanDerWaalsContact C-N 3.35Å; E89-L91 PolarHBondContact O-N 2.96Å; E89-K92 WeakPolarHBondContact O-CB 3.48Å; E89-K92 PolarHBondContact O-N 3.23Å; E89-L93 HydrophobicContact CG-CD1 4.26Å; E89-L93 WeakPolarHBondContact O-CG 3.41Å; E89-L93 PolarHBondContact O-N 3.44Å
90	N	98.6	Very high	98.6	Very high	72 Å²	72	101 Å²	101	39%	0.385	53%	0.525	S	S	.	.	H	α-helix	trans	-62.2	-41	177.6	-169.3	-99.5	0	0	0	112.5	V86 K87 E88 L93 K94	V86-N90 WeakPolarHBondContact O-CB 3.41Å; V86-N90 PolarHBondContact O-N 2.9Å; K87-N90 WeakPolarHBondContact O-CB 3.28Å; K87-N90 PolarHBondContact O-N 3.26Å; E88-N90 VanDerWaalsContact C-N 3.3Å; E88-N90 PolarHBondContact O-N 3.21Å; N90-L93 PolarHBondContact O-N 3.49Å; N90-K94 WeakPolarHBondContact O-CB 3.31Å; N90-K94 WeakPolarHBondContact O-CG 3.35Å; N90-K94 PolarHBondContact O-N 3.34Å; N90-K94 WeakPolarHBondContact OD1-CE 3.22Å; N90-K94 PolarHBondContact OD1-NZ 3.34Å
91	L	98.7	Very high	98.6	Very high	115 Å²	115	99.5 Å²	99.5	60%	0.602	52%	0.519	S	S	*	.	H	α-helix	trans	-63.9	-42.8	176	-73.4	175.6	0	0	0	111.3	K87 E88 E89 K94 S95	K87-L91 WeakPolarHBondContact O-CG 3.44Å; K87-L91 PolarHBondContact O-N 3.41Å; E88-L91 PolarHBondContact O-N 3.48Å; E89-L91 VanDerWaalsContact C-N 3.35Å; E89-L91 PolarHBondContact O-N 2.96Å; L91-K94 PolarHBondContact O-N 2.95Å; L91-S95 PolarHBondContact O-N 2.9Å
92	K	98.7	Very high	98.5	Very high	145 Å²	145	101.1 Å²	101.1	63%	0.63	52%	0.516	S	S	*	.	H	α-helix	trans	-58.6	-50.6	175.4	-173.8	-180	177.7	-175.5	0	111.1	E88 E89 K94 S95 E96	E88-K92 PolarHBondContact O-N 2.9Å; E89-K92 WeakPolarHBondContact O-CB 3.48Å; E89-K92 PolarHBondContact O-N 3.23Å; K92-K94 VanDerWaalsContact C-N 3.34Å; K92-K94 PolarHBondContact O-N 3.45Å; K92-S95 PolarHBondContact O-N 2.91Å; K92-S95 VanDerWaalsContact O-N 3.15Å; K92-S95 PolarHBondContact O-OG 3Å; K92-E96 PolarHBondContact O-N 2.99Å
93	L	98.7	Very high	98.5	Very high	78 Å²	78	99.6 Å²	99.6	41%	0.408	51%	0.511	S	S	.	.	H	α-helix	trans	-61.1	-39.7	177.9	-71.6	172.3	0	0	0	112.6	E89 N90 S95 E96 N97	E89-L93 HydrophobicContact CG-CD1 4.26Å; E89-L93 WeakPolarHBondContact O-CG 3.41Å; E89-L93 PolarHBondContact O-N 3.44Å; N90-L93 PolarHBondContact O-N 3.49Å; L93-S95 VanDerWaalsContact C-N 3.35Å; L93-E96 PolarHBondContact O-N 3.38Å; L93-N97 VanDerWaalsContact O-CB 3.31Å; L93-N97 WeakPolarHBondContact O-CB 3.29Å; L93-N97 PolarHBondContact O-N 2.92Å; L93-N97 PolarHBondContact O-ND2 3.04Å
94	K	98.6	Very high	98.3	Very high	125 Å²	125	101.1 Å²	101.1	54%	0.543	52%	0.516	S	S	.	.	H	α-helix	trans	-61.2	-43.2	174.4	-81.4	173.1	172.5	156.6	0	112	N90 L91 K92 N97 Q98	N90-K94 WeakPolarHBondContact O-CB 3.31Å; N90-K94 WeakPolarHBondContact O-CG 3.35Å; N90-K94 PolarHBondContact O-N 3.34Å; N90-K94 WeakPolarHBondContact OD1-CE 3.22Å; N90-K94 PolarHBondContact OD1-NZ 3.34Å; L91-K94 PolarHBondContact O-N 2.95Å; K92-K94 VanDerWaalsContact C-N 3.34Å; K92-K94 PolarHBondContact O-N 3.45Å; K94-N97 PolarHBondContact O-N 2.76Å; K94-Q98 WeakPolarHBondContact O-CB 3.48Å; K94-Q98 PolarHBondContact O-N 3.39Å
95	S	98.5	Very high	98.1	Very high	63 Å²	63	101.7 Å²	101.7	44%	0.441	52%	0.516	S	S	.	.	H	α-helix	trans	-65	-41.4	178.2	74.4	0	0	0	0	112.2	L91 K92 L93 Q98 V99	L91-S95 PolarHBondContact O-N 2.9Å; K92-S95 PolarHBondContact O-N 2.91Å; K92-S95 VanDerWaalsContact O-N 3.15Å; K92-S95 PolarHBondContact O-OG 3Å; L93-S95 VanDerWaalsContact C-N 3.35Å; S95-Q98 WeakPolarHBondContact O-CB 3.36Å; S95-Q98 PolarHBondContact O-N 3.31Å; S95-V99 WeakPolarHBondContact O-CG2 3.38Å; S95-V99 PolarHBondContact O-N 3.03Å; S95-V99 VanDerWaalsContact O-N 3.14Å
96	E	98.4	Very high	97.8	Very high	106 Å²	106	103.2 Å²	103.2	50%	0.495	52%	0.516	S	S	.	.	H	α-helix	trans	-65	-47.2	176.5	-175.9	174.6	172.2	0	0	111.2	K92 L93 Q98 V99 L100	K92-E96 PolarHBondContact O-N 2.99Å; L93-E96 PolarHBondContact O-N 3.38Å; E96-Q98 VanDerWaalsContact C-N 3.25Å; E96-Q98 PolarHBondContact O-N 3.03Å; E96-V99 PolarHBondContact O-N 3.43Å; E96-V99 VanDerWaalsContact O-N 3.12Å; E96-L100 HydrophobicContact CG-CD1 4.11Å; E96-L100 HydrophobicContact CG-CG 4.46Å; E96-L100 WeakPolarHBondContact O-CG 3.37Å; E96-L100 PolarHBondContact O-N 2.88Å
97	N	98.4	Very high	97.5	Very high	104 Å²	104	103 Å²	103	56%	0.556	51%	0.511	S	S	*	.	H	α-helix	trans	-61.2	-34.5	176.6	-78.2	-25.9	0	0	0	112.5	L93 K94 G101	L93-N97 VanDerWaalsContact O-CB 3.31Å; L93-N97 WeakPolarHBondContact O-CB 3.29Å; L93-N97 PolarHBondContact O-N 2.92Å; L93-N97 PolarHBondContact O-ND2 3.04Å; K94-N97 PolarHBondContact O-N 2.76Å; N97-G101 PolarHBondContact O-N 3.33Å
98	Q	98.6	Very high	97.1	Very high	151 Å²	151	101.7 Å²	101.7	71%	0.706	51%	0.508	S	S	*	.	H	α-helix	trans	-63.6	-46.5	174.3	-177.3	-178.4	-2.5	0	0	111.3	K94 S95 E96 G101 Q102	K94-Q98 WeakPolarHBondContact O-CB 3.48Å; K94-Q98 PolarHBondContact O-N 3.39Å; S95-Q98 WeakPolarHBondContact O-CB 3.36Å; S95-Q98 PolarHBondContact O-N 3.31Å; E96-Q98 VanDerWaalsContact C-N 3.25Å; E96-Q98 PolarHBondContact O-N 3.03Å; Q98-G101 PolarHBondContact O-N 3.44Å; Q98-Q102 PolarHBondContact O-N 3.43Å
99	V	98.5	Very high	96.5	Very high	103 Å²	103	99 Å²	99	62%	0.624	51%	0.505	S	S	*	.	H	α-helix	trans	-63.2	-45.1	178.1	173.8	0	0	0	0	110.9	S95 E96 Q102 Y103	S95-V99 WeakPolarHBondContact O-CG2 3.38Å; S95-V99 PolarHBondContact O-N 3.03Å; S95-V99 VanDerWaalsContact O-N 3.14Å; E96-V99 PolarHBondContact O-N 3.43Å; E96-V99 VanDerWaalsContact O-N 3.12Å; V99-Q102 PolarHBondContact O-N 3.22Å; V99-Y103 PolarHBondContact O-N 3.29Å
100	L	98.5	Very high	96.1	Very high	81 Å²	81	97.4 Å²	97.4	42%	0.424	51%	0.512	S	S	.	.	H	α-helix	trans	-63.5	-42.2	176.8	-68.1	175.8	0	0	0	112	E96 Q102 Y103 I104	E96-L100 HydrophobicContact CG-CD1 4.11Å; E96-L100 HydrophobicContact CG-CG 4.46Å; E96-L100 WeakPolarHBondContact O-CG 3.37Å; E96-L100 PolarHBondContact O-N 2.88Å; L100-Q102 PolarHBondContact O-N 3.36Å; L100-Y103 WeakPolarHBondContact O-CB 3.38Å; L100-Y103 PolarHBondContact O-N 3.48Å; L100-I104 WeakPolarHBondContact O-CG1 3.35Å; L100-I104 PolarHBondContact O-N 3.28Å
101	G	97.6	Very high	95.3	Very high	26 Å²	26	96 Å²	96	27%	0.268	51%	0.508	S	S	.	.	H	α-helix	trans	-57.9	-48.6	175.7	0	0	0	0	0	111.7	N97 Q98 Y103 I104 E105	N97-G101 PolarHBondContact O-N 3.33Å; Q98-G101 PolarHBondContact O-N 3.44Å; G101-Y103 VanDerWaalsContact C-N 3.32Å; G101-Y103 PolarHBondContact O-N 2.97Å; G101-I104 PolarHBondContact O-N 2.98Å; G101-E105 WeakPolarHBondContact O-CG 3.45Å; G101-E105 PolarHBondContact O-N 2.91Å
102	Q	97.8	Very high	94.2	Very high	96 Å²	96	95 Å²	95	45%	0.449	51%	0.511	S	S	.	.	H	α-helix	trans	-62.1	-40	176.7	-171.9	63.5	75.7	0	0	112.3	Q98 V99 L100 I104 E105 N106	Q98-Q102 PolarHBondContact O-N 3.43Å; V99-Q102 PolarHBondContact O-N 3.22Å; L100-Q102 PolarHBondContact O-N 3.36Å; Q102-I104 VanDerWaalsContact C-N 3.35Å; Q102-E105 PolarHBondContact NE2-OE2 2.96Å; Q102-E105 PolarHBondContact O-N 2.93Å; Q102-N106 PolarHBondContact NE2-OD1 2.89Å; Q102-N106 WeakPolarHBondContact O-CB 3.49Å; Q102-N106 PolarHBondContact O-N 3.45Å; Q102-N106 PolarHBondContact O-ND2 3.15Å; Q102-N106 PolarHBondContact O-OD1 3.19Å
103	Y	97.3	Very high	93	Very high	144 Å²	144	94 Å²	94	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-61	-45.1	176.6	178.2	-109.5	0	0	0	111.5	V99 L100 G101 N106 L107	V99-Y103 PolarHBondContact O-N 3.29Å; L100-Y103 WeakPolarHBondContact O-CB 3.38Å; L100-Y103 PolarHBondContact O-N 3.48Å; G101-Y103 VanDerWaalsContact C-N 3.32Å; G101-Y103 PolarHBondContact O-N 2.97Å; Y103-N106 PolarHBondContact O-N 3.35Å; Y103-L107 HydrophobicContact CD1-CD1 4.07Å; Y103-L107 HydrophobicContact CE1-CD1 3.49Å; Y103-L107 VanDerWaalsContact CE1-CD1 3.49Å; Y103-L107 HydrophobicContact CE1-CG 4.32Å; Y103-L107 HydrophobicContact CE2-CD1 4.3Å; Y103-L107 HydrophobicContact CE2-CD2 4.49Å; Y103-L107 HydrophobicContact CE2-CG 4.34Å; Y103-L107 WeakPolarHBondContact O-CG 3.33Å; Y103-L107 PolarHBondContact O-N 3.49Å
104	I	95.1	Very high	91.5	Very high	94 Å²	94	96.8 Å²	96.8	48%	0.482	53%	0.526	S	S	.	.	H	α-helix	trans	-62.8	-47	176.2	-67.5	160	0	0	0	110.7	L100 G101 Q102 N106 L107 M108	L100-I104 WeakPolarHBondContact O-CG1 3.35Å; L100-I104 PolarHBondContact O-N 3.28Å; G101-I104 PolarHBondContact O-N 2.98Å; Q102-I104 VanDerWaalsContact C-N 3.35Å; I104-N106 VanDerWaalsContact C-N 3.3Å; I104-N106 PolarHBondContact O-N 2.89Å; I104-L107 PolarHBondContact O-N 3.36Å; I104-M108 HydrophobicContact CG2-CE 3.96Å; I104-M108 HydrophobicContact CG2-CG 4.28Å; I104-M108 HydrophobicContact CG2-SD 4.15Å; I104-M108 WeakPolarHBondContact O-CG 3.41Å; I104-M108 PolarHBondContact O-N 3.02Å
105	E	94.3	Very high	90.2	Very high	102 Å²	102	96.7 Å²	96.7	48%	0.477	53%	0.527	S	S	.	.	H	α-helix	trans	-57.1	-43	176.9	-76.1	176.5	-172.4	0	0	112.4	G101 Q102 L107 M108 S109	G101-E105 WeakPolarHBondContact O-CG 3.45Å; G101-E105 PolarHBondContact O-N 2.91Å; Q102-E105 PolarHBondContact NE2-OE2 2.96Å; Q102-E105 PolarHBondContact O-N 2.93Å; E105-L107 PolarHBondContact O-N 3.26Å; E105-M108 HydrophobicContact CG-CE 4.43Å; E105-M108 PolarHBondContact O-N 3.27Å; E105-S109 VanDerWaalsContact O-CB 3.31Å; E105-S109 WeakPolarHBondContact O-CB 3.49Å; E105-S109 PolarHBondContact O-N 3.4Å; E105-S109 PolarHBondContact O-OG 3.03Å
106	N	93.2	Very high	88.6	Confident	89 Å²	89	98.9 Å²	98.9	48%	0.476	54%	0.538	S	S	.	.	H	α-helix	trans	-63.8	-41.9	178.2	-70.7	-11.3	0	0	0	111.5	Q102 Y103 I104 S109 A110	Q102-N106 PolarHBondContact NE2-OD1 2.89Å; Q102-N106 WeakPolarHBondContact O-CB 3.49Å; Q102-N106 PolarHBondContact O-N 3.45Å; Q102-N106 PolarHBondContact O-ND2 3.15Å; Q102-N106 PolarHBondContact O-OD1 3.19Å; Y103-N106 PolarHBondContact O-N 3.35Å; I104-N106 VanDerWaalsContact C-N 3.3Å; I104-N106 PolarHBondContact O-N 2.89Å; N106-S109 PolarHBondContact O-N 3.35Å; N106-A110 VanDerWaalsContact O-CB 3.24Å; N106-A110 WeakPolarHBondContact O-CB 3.4Å; N106-A110 PolarHBondContact O-N 3.4Å
107	L	92.3	Very high	86.9	Confident	90 Å²	90	99.8 Å²	99.8	47%	0.471	55%	0.551	S	S	.	*	H	α-helix	trans	-65.3	-44.2	176	-71	-179.7	0	0	0	112.1	Y103 I104 E105 S109 S111	Y103-L107 HydrophobicContact CD1-CD1 4.07Å; Y103-L107 HydrophobicContact CE1-CD1 3.49Å; Y103-L107 VanDerWaalsContact CE1-CD1 3.49Å; Y103-L107 HydrophobicContact CE1-CG 4.32Å; Y103-L107 HydrophobicContact CE2-CD1 4.3Å; Y103-L107 HydrophobicContact CE2-CD2 4.49Å; Y103-L107 HydrophobicContact CE2-CG 4.34Å; Y103-L107 WeakPolarHBondContact O-CG 3.33Å; Y103-L107 PolarHBondContact O-N 3.49Å; I104-L107 PolarHBondContact O-N 3.36Å; E105-L107 PolarHBondContact O-N 3.26Å; L107-S109 VanDerWaalsContact C-N 3.31Å; L107-S109 PolarHBondContact O-N 2.91Å; L107-S111 WeakPolarHBondContact O-CB 3.38Å; L107-S111 PolarHBondContact O-N 2.95Å
108	M	90.1	Very high	85	Confident	87 Å²	87	101.2 Å²	101.2	43%	0.429	56%	0.559	S	S	.	*	H	α-helix	trans	-62.7	-40.1	177.3	-69.5	-169	-56.8	0	0	111.4	I104 E105 F114	I104-M108 HydrophobicContact CG2-CE 3.96Å; I104-M108 HydrophobicContact CG2-CG 4.28Å; I104-M108 HydrophobicContact CG2-SD 4.15Å; I104-M108 WeakPolarHBondContact O-CG 3.41Å; I104-M108 PolarHBondContact O-N 3.02Å; E105-M108 HydrophobicContact CG-CE 4.43Å; E105-M108 PolarHBondContact O-N 3.27Å; M108-F114 HydrophobicContact CB-CB 4.34Å
109	S	87	Confident	82.9	Confident	86 Å²	86	99.8 Å²	99.8	60%	0.601	56%	0.56	S	S	*	*	H	α-helix	trans	-73.8	-37	-179.1	-55.5	0	0	0	0	113	E105 N106 L107	E105-S109 VanDerWaalsContact O-CB 3.31Å; E105-S109 WeakPolarHBondContact O-CB 3.49Å; E105-S109 PolarHBondContact O-N 3.4Å; E105-S109 PolarHBondContact O-OG 3.03Å; N106-S109 PolarHBondContact O-N 3.35Å; L107-S109 VanDerWaalsContact C-N 3.31Å; L107-S109 PolarHBondContact O-N 2.91Å
110	A	88.2	Confident	80.8	Confident	88 Å²	88	103.3 Å²	103.3	73%	0.727	57%	0.568	S	S	*	*	H	α-helix	trans	-78.5	-23.9	179	0	0	0	0	0	113	N106	N106-A110 VanDerWaalsContact O-CB 3.24Å; N106-A110 WeakPolarHBondContact O-CB 3.4Å; N106-A110 PolarHBondContact O-N 3.4Å
111	S	83.8	Confident	78.5	Confident	42 Å²	42	106 Å²	106	29%	0.294	59%	0.593	S	S	.	*			trans	-85.8	116.5	178.3	179.9	0	0	0	0	111.4	L107 V113 F114	L107-S111 WeakPolarHBondContact O-CB 3.38Å; L107-S111 PolarHBondContact O-N 2.95Å; S111-V113 PolarHBondContact O-N 3.13Å; S111-V113 PolarHBondContact OG-N 3.18Å; S111-F114 PolarHBondContact O-N 3.36Å; S111-F114 VanDerWaalsContact O-N 3.09Å
112	S	74.6	Confident	76.4	Confident	96 Å²	96	113.2 Å²	113.2	67%	0.671	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.5	-18.9	175.8	-177	0	0	0	0	113.9	F114	S112-F114 VanDerWaalsContact C-N 3.33Å
113	V	73.3	Confident	74.3	Confident	124 Å²	124	120.4 Å²	120.4	75%	0.752	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.1	-26.3	179	171.4	0	0	0	0	112.1	S111	S111-V113 PolarHBondContact O-N 3.13Å; S111-V113 PolarHBondContact OG-N 3.18Å
114	F	68.2	Low	72.2	Confident	136 Å²	136	127 Å²	127	60%	0.596	67%	0.672	S	S	*	*	S	Bend	trans	-103.6	3.2	-178	-65.6	-75	0	0	0	113.5	M108 S111 S112 T116	M108-F114 HydrophobicContact CB-CB 4.34Å; S111-F114 PolarHBondContact O-N 3.36Å; S111-F114 VanDerWaalsContact O-N 3.09Å; S112-F114 VanDerWaalsContact C-N 3.33Å; F114-T116 PolarHBondContact O-N 3.02Å; F114-T116 VanDerWaalsContact O-N 3.16Å
115	Q	70.2	Confident	71	Confident	122 Å²	122	128.7 Å²	128.7	57%	0.57	68%	0.681	S	S	*	*	S	Bend	trans	-65.4	118.9	171.1	-68.2	-167.6	29.7	0	0	108.6	T117	Q115-T117 PolarHBondContact O-N 3.24Å; Q115-T117 VanDerWaalsContact O-N 3.08Å
116	T	65.8	Low	69.8	Low	109 Å²	109	130.1 Å²	130.1	67%	0.669	69%	0.692	S	S	*	*			trans	-52.3	121.3	165.5	44.7	0	0	0	0	106.7	F114 D118	F114-T116 PolarHBondContact O-N 3.02Å; F114-T116 VanDerWaalsContact O-N 3.16Å; T116-D118 PolarHBondContact O-N 3.36Å; T116-D118 PolarHBondContact OG1-OD2 3.13Å
117	T	62.2	Low	68.5	Low	126 Å²	126	132.4 Å²	132.4	77%	0.773	70%	0.704	S	S	*	*			trans	-67.9	80	163.9	54.6	0	0	0	0	106.1	Q115 T119	Q115-T117 PolarHBondContact O-N 3.24Å; Q115-T117 VanDerWaalsContact O-N 3.08Å; T117-T119 PolarHBondContact O-N 3.46Å
118	D	58.4	Low	67.1	Low	134 Å²	134	134.9 Å²	134.9	72%	0.717	72%	0.718	S	S	*	*			trans	-62.4	82.1	160.6	-76.4	-64.4	0	0	0	105.9	T116 K120	T116-D118 PolarHBondContact O-N 3.36Å; T116-D118 PolarHBondContact OG1-OD2 3.13Å; D118-K120 PolarHBondContact O-N 3.05Å
119	T	55.2	Low	65.7	Low	120 Å²	120	137.9 Å²	137.9	74%	0.736	74%	0.736	S	S	*	*			trans	-63.6	92.4	165.9	54.4	0	0	0	0	105.4	T117 S121	T117-T119 PolarHBondContact O-N 3.46Å; T119-S121 PolarHBondContact O-N 3.09Å
120	K	53	Low	64.3	Low	178 Å²	178	141.3 Å²	141.3	77%	0.774	75%	0.745	S	S	*	*			trans	-18.9	100.6	170.7	-79.5	171.5	179	164.7	0	111.9	D118 K122	D118-K120 PolarHBondContact O-N 3.05Å; K120-K122 HydrophobicContact CB-CB 4.17Å; K120-K122 PolarHBondContact O-N 2.81Å
121	S	50.5	Low	62.6	Low	137 Å²	137	145.1 Å²	145.1	96%	0.958	75%	0.746	S	S	*	*			trans	-68.7	74.8	151.5	-78.3	0	0	0	0	107.5	T119	T119-S121 PolarHBondContact O-N 3.09Å
122	K	54	Low	60.9	Low	178 Å²	178	153.1 Å²	153.1	77%	0.774	78%	0.781	S	S	*	*			trans	-119.3	85.7	169.8	-152.3	174.5	-167	172.4	0	105.8	K120	K120-K122 HydrophobicContact CB-CB 4.17Å; K120-K122 PolarHBondContact O-N 2.81Å
123	R	54.8	Low	59.8	Low	247 Å²	247	157.8 Å²	157.8	93%	0.932	79%	0.79	S	S	*	*			trans	-121.6	128.7	159.4	-80	-167.1	-120.8	119.8	0.8	108.7
124	K	52	Low	58.6	Low	283 Å²	283	160.9 Å²	160.9	100%	1.23	79%	0.794	S	S	*	*			trans	-52.3	0	176.5	-77.1	172.8	134.3	-173.3	0	112.6

Retrieved 124 of 124 residues in 19.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).