A0A061IH64_CRIGR Loading...

cAMP-dependent protein kinase inhibitor

Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

AlphaFold DB , UniProt , Accession A0A061IH64, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Pkia, Length 76 aa.

						>A0A061IH64_CRIGR|A0A061IH64|Pkia
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEDNGQRSSTEQSGEAQGEAAKSES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.3	Low	68.8	Low	246 Å²	246	120.3 Å²	120.3	100%	1.212	64%	0.635	S	S	*	*				0	105.8	0	-161	154.1	-178.4	0	0	105.4
2	T	63.1	Low	69.2	Low	117 Å²	117	118.3 Å²	118.3	72%	0.718	62%	0.624	S	S	*	*			trans	-71.9	132.4	-178.2	47.3	0	0	0	0	108.5	V4	T2-V4 PolarHBondContact O-N 3.15Å
3	D	73.6	Confident	69.4	Low	84 Å²	84	115.5 Å²	115.5	45%	0.449	63%	0.628	S	S	.	*			trans	-62	118.4	175.6	175.5	28.2	0	0	0	109.5	E5 T6 T7	D3-E5 PolarHBondContact O-N 2.95Å; D3-E5 PolarHBondContact OD1-N 3.31Å; D3-T6 PolarHBondContact O-N 3.39Å; D3-T6 PolarHBondContact OD2-N 2.99Å; D3-T6 PolarHBondContact OD2-OG1 3.39Å; D3-T7 PolarHBondContact O-N 3.17Å; D3-T7 PolarHBondContact O-OG1 3.41Å
4	V	68.2	Low	69.4	Low	115 Å²	115	110.6 Å²	110.6	70%	0.697	61%	0.606	S	S	*	*	H	α-helix	trans	-66.1	-30.5	-175.1	176.5	0	0	0	0	110	T2 T7 Y8	T2-V4 PolarHBondContact O-N 3.15Å; V4-T7 PolarHBondContact O-N 3.26Å; V4-Y8 PolarHBondContact O-N 3.39Å
5	E	70.6	Confident	69.2	Low	156 Å²	156	106.1 Å²	106.1	73%	0.729	60%	0.596	S	S	*	*	H	α-helix	trans	-72.3	-43.7	-178.1	-59.9	-169.4	160	0	0	111.6	D3 T7 Y8 A9	D3-E5 PolarHBondContact O-N 2.95Å; D3-E5 PolarHBondContact OD1-N 3.31Å; E5-T7 VanDerWaalsContact C-N 3.32Å; E5-T7 PolarHBondContact O-N 3.3Å; E5-Y8 WeakPolarHBondContact O-CB 3.29Å; E5-Y8 PolarHBondContact O-N 2.91Å; E5-A9 PolarHBondContact O-N 3.45Å
6	T	67.4	Low	68.8	Low	82 Å²	82	112.4 Å²	112.4	50%	0.503	61%	0.607	S	S	.	*	H	α-helix	trans	-62.6	-40.8	174.7	-57.1	0	0	0	0	111.4	D3 Y8 A9 D10	D3-T6 PolarHBondContact O-N 3.39Å; D3-T6 PolarHBondContact OD2-N 2.99Å; D3-T6 PolarHBondContact OD2-OG1 3.39Å; T6-Y8 VanDerWaalsContact C-N 3.28Å; T6-Y8 PolarHBondContact O-N 3.44Å; T6-A9 PolarHBondContact O-N 3.23Å; T6-D10 PolarHBondContact O-N 3.35Å
7	T	69.8	Low	67.9	Low	76 Å²	76	109.9 Å²	109.9	47%	0.466	60%	0.597	S	S	.	*	H	α-helix	trans	-66.3	-31.5	178.3	-49.8	0	0	0	0	111.9	D3 V4 E5 F11	D3-T7 PolarHBondContact O-N 3.17Å; D3-T7 PolarHBondContact O-OG1 3.41Å; V4-T7 PolarHBondContact O-N 3.26Å; E5-T7 VanDerWaalsContact C-N 3.32Å; E5-T7 PolarHBondContact O-N 3.3Å; T7-F11 VanDerWaalsContact O-CB 3.32Å; T7-F11 WeakPolarHBondContact O-CB 3.16Å; T7-F11 PolarHBondContact O-N 2.89Å
8	Y	69.6	Low	67.4	Low	160 Å²	160	105.9 Å²	105.9	63%	0.627	59%	0.585	S	S	*	*	H	α-helix	trans	-67.2	-43.3	175.5	-170.8	-98.3	0	0	0	111.6	V4 E5 T6 D10 F11 I12	V4-Y8 PolarHBondContact O-N 3.39Å; E5-Y8 WeakPolarHBondContact O-CB 3.29Å; E5-Y8 PolarHBondContact O-N 2.91Å; T6-Y8 VanDerWaalsContact C-N 3.28Å; T6-Y8 PolarHBondContact O-N 3.44Å; Y8-D10 PolarHBondContact O-N 3.36Å; Y8-F11 PolarHBondContact O-N 3.01Å; Y8-I12 HydrophobicContact CD1-CG1 4.03Å; Y8-I12 HydrophobicContact CE1-CD1 4.29Å; Y8-I12 HydrophobicContact CE1-CG1 3.73Å; Y8-I12 HydrophobicContact CE2-CD1 4.4Å; Y8-I12 HydrophobicContact CE2-CG1 4.4Å; Y8-I12 HydrophobicContact CG-CG1 4.49Å; Y8-I12 VanDerWaalsContact O-CG1 3.27Å; Y8-I12 WeakPolarHBondContact O-CG1 3.38Å; Y8-I12 PolarHBondContact O-N 3.38Å
9	A	76.7	Confident	66.9	Low	57 Å²	57	113.3 Å²	113.3	47%	0.471	60%	0.603	S	S	.	*	H	α-helix	trans	-59.2	-46.8	176.5	0	0	0	0	0	111.4	E5 T6 F11 I12 A13	E5-A9 PolarHBondContact O-N 3.45Å; T6-A9 PolarHBondContact O-N 3.23Å; A9-F11 PolarHBondContact O-N 3.37Å; A9-I12 PolarHBondContact O-N 3.47Å; A9-A13 WeakPolarHBondContact O-CB 3.24Å; A9-A13 PolarHBondContact O-N 3.05Å
10	D	71.5	Confident	66.8	Low	110 Å²	110	119.2 Å²	119.2	59%	0.588	62%	0.617	S	S	*	*	H	α-helix	trans	-67.3	-36.5	178.7	-73.8	-19	0	0	0	112.4	T6 Y8 S14	T6-D10 PolarHBondContact O-N 3.35Å; Y8-D10 PolarHBondContact O-N 3.36Å; D10-S14 WeakPolarHBondContact O-CA 3.42Å; D10-S14 WeakPolarHBondContact O-CB 3.36Å; D10-S14 PolarHBondContact O-N 2.99Å
11	F	66.4	Low	66.3	Low	120 Å²	120	118.3 Å²	118.3	53%	0.526	61%	0.613	S	S	.	*	H	α-helix	trans	-65.5	-44.2	176.4	179.1	-98.9	0	0	0	112.4	T7 Y8 A9 T17	T7-F11 VanDerWaalsContact O-CB 3.32Å; T7-F11 WeakPolarHBondContact O-CB 3.16Å; T7-F11 PolarHBondContact O-N 2.89Å; Y8-F11 PolarHBondContact O-N 3.01Å; A9-F11 PolarHBondContact O-N 3.37Å; F11-T17 HydrophobicContact CD1-CG2 4.4Å; F11-T17 HydrophobicContact CE1-CG2 3.91Å; F11-T17 HydrophobicContact CE2-CG2 4.37Å; F11-T17 HydrophobicContact CZ-CG2 3.89Å
12	I	72.8	Confident	66.6	Low	97 Å²	97	109.4 Å²	109.4	50%	0.497	58%	0.579	S	S	.	*	H	α-helix	trans	-68.7	-40.2	176.8	-62.5	-62.3	0	0	0	110.9	Y8 A9	Y8-I12 HydrophobicContact CD1-CG1 4.03Å; Y8-I12 HydrophobicContact CE1-CD1 4.29Å; Y8-I12 HydrophobicContact CE1-CG1 3.73Å; Y8-I12 HydrophobicContact CE2-CD1 4.4Å; Y8-I12 HydrophobicContact CE2-CG1 4.4Å; Y8-I12 HydrophobicContact CG-CG1 4.49Å; Y8-I12 VanDerWaalsContact O-CG1 3.27Å; Y8-I12 WeakPolarHBondContact O-CG1 3.38Å; Y8-I12 PolarHBondContact O-N 3.38Å; A9-I12 PolarHBondContact O-N 3.47Å
13	A	72.2	Confident	66.5	Low	82 Å²	82	111.7 Å²	111.7	68%	0.678	59%	0.585	S	S	*	*	H	α-helix	trans	-74.7	-27.1	-179.9	0	0	0	0	0	113.7	A9 G15	A9-A13 WeakPolarHBondContact O-CB 3.24Å; A9-A13 PolarHBondContact O-N 3.05Å; A13-G15 PolarHBondContact O-N 2.92Å; A13-G15 VanDerWaalsContact O-N 3.07Å
14	S	69.6	Low	65.9	Low	46 Å²	46	113.8 Å²	113.8	32%	0.322	59%	0.591	S	S	.	*	T	Hydrogen-bonded Turn	trans	-61.9	-18.4	-176	175.8	0	0	0	0	113.3	D10 R16	D10-S14 WeakPolarHBondContact O-CA 3.42Å; D10-S14 WeakPolarHBondContact O-CB 3.36Å; D10-S14 PolarHBondContact O-N 2.99Å; S14-R16 WeakPolarHBondContact O-CG 3.25Å; S14-R16 PolarHBondContact O-N 2.78Å; S14-R16 PolarHBondContact OG-NE 3.21Å; S14-R16 PolarHBondContact OG-NH2 3.07Å
15	G	65.7	Low	65.5	Low	44 Å²	44	114.6 Å²	114.6	45%	0.454	59%	0.592	S	S	.	*			trans	62.4	-4.9	178.2	0	0	0	0	0	114.9	A13 N21	A13-G15 PolarHBondContact O-N 2.92Å; A13-G15 VanDerWaalsContact O-N 3.07Å; G15-N21 WeakPolarHBondContact O-CB 3.48Å
16	R	63.3	Low	65.1	Low	206 Å²	206	113.3 Å²	113.3	78%	0.777	59%	0.589	S	S	*	*			trans	-87.5	-2.3	-175.2	-75.6	-175.5	-79.1	179.6	-5.3	114.3	S14 G18	S14-R16 WeakPolarHBondContact O-CG 3.25Å; S14-R16 PolarHBondContact O-N 2.78Å; S14-R16 PolarHBondContact OG-NE 3.21Å; S14-R16 PolarHBondContact OG-NH2 3.07Å; R16-G18 PolarHBondContact O-N 3.2Å
17	T	53.7	Low	64.6	Low	71 Å²	71	115.3 Å²	115.3	44%	0.436	60%	0.596	S	S	.	*	S	Bend	trans	-70.2	86.8	170.1	136.4	0	0	0	0	108.4	F11 N21	F11-T17 HydrophobicContact CD1-CG2 4.4Å; F11-T17 HydrophobicContact CE1-CG2 3.91Å; F11-T17 HydrophobicContact CE2-CG2 4.37Å; F11-T17 HydrophobicContact CZ-CG2 3.89Å; T17-N21 PolarHBondContact O-ND2 3.07Å
18	G	58.8	Low	64	Low	37 Å²	37	117.3 Å²	117.3	38%	0.381	61%	0.607	S	S	.	*			trans	140.5	124.6	171.7	0	0	0	0	0	113.5	R16 R20 N21	R16-G18 PolarHBondContact O-N 3.2Å; G18-R20 PolarHBondContact O-N 3.49Å; G18-N21 PolarHBondContact O-N 3.42Å
19	R	58.3	Low	63.5	Low	246 Å²	246	114.6 Å²	114.6	93%	0.928	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.3	-13.7	155.6	-97.1	-177.8	155.9	158.3	-5.2	113.1
20	R	64.8	Low	62.6	Low	232 Å²	232	115.9 Å²	115.9	88%	0.875	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.8	-2	178.6	-56.2	-168.8	-56.9	171.2	3.4	114.1	G18	G18-R20 PolarHBondContact O-N 3.49Å
21	N	57	Low	62	Low	100 Å²	100	115 Å²	115	54%	0.535	63%	0.626	S	S	.	*	S	Bend	trans	-113.2	-6.1	-175.9	-70.4	-13.5	0	0	0	114	G15 T17 G18 I23	G15-N21 WeakPolarHBondContact O-CB 3.48Å; T17-N21 PolarHBondContact O-ND2 3.07Å; G18-N21 PolarHBondContact O-N 3.42Å; N21-I23 PolarHBondContact O-N 3.38Å; N21-I23 VanDerWaalsContact O-N 3.16Å
22	A	65.4	Low	61.6	Low	60 Å²	60	113.7 Å²	113.7	50%	0.496	63%	0.631	S	S	.	*	S	Bend	trans	-70.1	109.7	156.4	0	0	0	0	0	105.7	H24	A22-H24 PolarHBondContact O-CD2 2.82Å; A22-H24 PolarHBondContact O-N 2.67Å
23	I	61.2	Low	61.1	Low	164 Å²	164	111.7 Å²	111.7	84%	0.841	64%	0.635	S	S	*	*			trans	-57.7	97.1	155	-65.5	-176.9	0	0	0	103.1	N21 D25	N21-I23 PolarHBondContact O-N 3.38Å; N21-I23 VanDerWaalsContact O-N 3.16Å; I23-D25 PolarHBondContact O-N 2.88Å
24	H	61.9	Low	60.8	Low	128 Å²	128	111.7 Å²	111.7	59%	0.593	62%	0.623	S	S	*	*			trans	-55.2	120.3	162.5	-72.8	-85.6	0	0	0	103.6	A22 I26	A22-H24 PolarHBondContact O-CD2 2.82Å; A22-H24 PolarHBondContact O-N 2.67Å; H24-I26 HydrophobicContact CB-CD1 4.14Å; H24-I26 HydrophobicContact CB-CG1 3.59Å; H24-I26 PolarHBondContact O-N 3.03Å
25	D	59.4	Low	61.1	Low	133 Å²	133	113.9 Å²	113.9	71%	0.711	64%	0.638	S	S	*	*			trans	-66.8	72.5	163.5	-172.3	13.9	0	0	0	105.9	I23 L27	I23-D25 PolarHBondContact O-N 2.88Å; D25-L27 PolarHBondContact O-N 2.59Å; D25-L27 PolarHBondContact OD1-N 2.92Å
26	I	61.6	Low	62	Low	129 Å²	129	117.4 Å²	117.4	66%	0.662	65%	0.647	S	S	*	*			trans	-73.6	78	162.3	-47.3	175.5	0	0	0	101.2	H24 V28	H24-I26 HydrophobicContact CB-CD1 4.14Å; H24-I26 HydrophobicContact CB-CG1 3.59Å; H24-I26 PolarHBondContact O-N 3.03Å; I26-V28 PolarHBondContact O-N 3.18Å
27	L	56.8	Low	63	Low	124 Å²	124	111.4 Å²	111.4	65%	0.649	63%	0.628	S	S	*	*			trans	-40.7	111.8	140.1	-64	179.5	0	0	0	102.4	D25 S29	D25-L27 PolarHBondContact O-N 2.59Å; D25-L27 PolarHBondContact OD1-N 2.92Å; L27-S29 PolarHBondContact O-N 3.36Å
28	V	57.3	Low	64.6	Low	117 Å²	117	113.8 Å²	113.8	71%	0.709	64%	0.637	S	S	*	*			trans	-62.9	74.6	164.1	177.9	0	0	0	0	102.6	I26 S30	I26-V28 PolarHBondContact O-N 3.18Å; V28-S30 PolarHBondContact O-N 3.03Å
29	S	58.8	Low	66	Low	104 Å²	104	114.7 Å²	114.7	73%	0.727	64%	0.641	S	S	*	*			trans	-47.1	100.9	145.5	-88.1	0	0	0	0	100.1	L27 A31	L27-S29 PolarHBondContact O-N 3.36Å; S29-A31 PolarHBondContact O-N 2.76Å
30	S	57.8	Low	67.5	Low	83 Å²	83	109 Å²	109	58%	0.58	63%	0.628	S	S	*	*			trans	-64.7	79.8	-170.3	-170.7	0	0	0	0	105	V28 S32	V28-S30 PolarHBondContact O-N 3.03Å; S30-S32 PolarHBondContact O-N 2.6Å; S30-S32 PolarHBondContact O-OG 2.87Å; S30-S32 VanDerWaalsContact OG-CB 3.25Å; S30-S32 WeakPolarHBondContact OG-CB 3.27Å; S30-S32 PolarHBondContact OG-OG 2.83Å
31	A	59.6	Low	68.6	Low	93 Å²	93	104.4 Å²	104.4	77%	0.769	62%	0.615	S	S	*	*			trans	-69.8	56.8	145.9	0	0	0	0	0	105.6	S29 G33	S29-A31 PolarHBondContact O-N 2.76Å; A31-G33 PolarHBondContact O-N 2.68Å
32	S	57.6	Low	70.2	Confident	91 Å²	91	105.3 Å²	105.3	64%	0.636	62%	0.619	S	S	*	*			trans	-66.1	27.4	145.2	57.4	0	0	0	0	110.1	S30 N34	S30-S32 PolarHBondContact O-N 2.6Å; S30-S32 PolarHBondContact O-OG 2.87Å; S30-S32 VanDerWaalsContact OG-CB 3.25Å; S30-S32 WeakPolarHBondContact OG-CB 3.27Å; S30-S32 PolarHBondContact OG-OG 2.83Å; S32-N34 VanDerWaalsContact C-N 3.25Å; S32-N34 PolarHBondContact O-N 3.47Å
33	G	62.8	Low	71.4	Confident	55 Å²	55	106.6 Å²	106.6	57%	0.567	63%	0.63	S	S	*	*			trans	-55.9	101.3	159.8	0	0	0	0	0	105.6	A31 S35	A31-G33 PolarHBondContact O-N 2.68Å; G33-S35 PolarHBondContact O-N 3.04Å
34	N	66	Low	72.6	Confident	83 Å²	83	100.6 Å²	100.6	44%	0.444	61%	0.608	S	S	.	*			trans	-47.3	125.1	-175.3	59.3	83.6	0	0	0	108.7	S32 N36 E37	S32-N34 VanDerWaalsContact C-N 3.25Å; S32-N34 PolarHBondContact O-N 3.47Å; N34-N36 PolarHBondContact O-N 2.76Å; N34-E37 PolarHBondContact O-N 3.16Å; N34-E37 WeakPolarHBondContact OD1-CB 3.18Å; N34-E37 PolarHBondContact OD1-N 3.47Å
35	S	75.6	Confident	73.9	Confident	91 Å²	91	100.7 Å²	100.7	64%	0.636	61%	0.612	S	S	*	*	H	α-helix	trans	-57.1	-16.7	178	-174.9	0	0	0	0	112.6	G33 L38 A39	G33-S35 PolarHBondContact O-N 3.04Å; S35-L38 PolarHBondContact O-N 2.89Å; S35-A39 PolarHBondContact O-N 3.07Å
36	N	83.9	Confident	75.3	Confident	118 Å²	118	97.8 Å²	97.8	63%	0.631	60%	0.597	S	S	*	*	H	α-helix	trans	-65.7	-41.1	176	-67.6	-28.2	0	0	0	112.5	N34 L38 A39 L40	N34-N36 PolarHBondContact O-N 2.76Å; N36-L38 VanDerWaalsContact C-N 3.29Å; N36-L38 PolarHBondContact O-N 2.81Å; N36-A39 PolarHBondContact O-N 3.07Å; N36-L40 VanDerWaalsContact O-CG 3.29Å; N36-L40 WeakPolarHBondContact O-CG 3.42Å; N36-L40 PolarHBondContact O-N 2.98Å
37	E	84.8	Confident	76.6	Confident	81 Å²	81	99 Å²	99	38%	0.379	60%	0.603	S	S	.	*	H	α-helix	trans	-62.5	-40	177.1	-178.4	-177.8	164.6	0	0	110.9	N34 L40 K41	N34-E37 PolarHBondContact O-N 3.16Å; N34-E37 WeakPolarHBondContact OD1-CB 3.18Å; N34-E37 PolarHBondContact OD1-N 3.47Å; E37-L40 PolarHBondContact O-N 2.85Å; E37-K41 HydrophobicContact CG-CD 4.4Å; E37-K41 WeakPolarHBondContact O-CG 3.01Å; E37-K41 PolarHBondContact O-N 3.39Å; E37-K41 VanDerWaalsContact OE1-CE 3.24Å; E37-K41 WeakPolarHBondContact OE1-CE 3.48Å; E37-K41 IonicContact OE1-NZ 2.67Å; E37-K41 PolarHBondContact OE1-NZ 3.08Å
38	L	86.8	Confident	78.2	Confident	121 Å²	121	99.4 Å²	99.4	63%	0.634	61%	0.606	S	S	*	*	H	α-helix	trans	-64.4	-43.8	174.8	-178.7	59.9	0	0	0	111.5	S35 N36 L40 K41 L42	S35-L38 PolarHBondContact O-N 2.89Å; N36-L38 VanDerWaalsContact C-N 3.29Å; N36-L38 PolarHBondContact O-N 2.81Å; L38-L40 VanDerWaalsContact C-N 3.32Å; L38-L40 PolarHBondContact O-N 3.21Å; L38-K41 PolarHBondContact O-N 2.89Å; L38-L42 WeakPolarHBondContact O-CB 3.41Å; L38-L42 PolarHBondContact O-N 3.2Å
39	A	89.6	Confident	79.5	Confident	55 Å²	55	99.6 Å²	99.6	46%	0.455	60%	0.597	S	S	.	*	H	α-helix	trans	-61.2	-40.4	176.6	0	0	0	0	0	112.1	S35 N36 L42 A43	S35-A39 PolarHBondContact O-N 3.07Å; N36-A39 PolarHBondContact O-N 3.07Å; A39-L42 PolarHBondContact O-N 2.88Å; A39-A43 PolarHBondContact O-N 3.44Å
40	L	89.3	Confident	80.3	Confident	128 Å²	128	99.8 Å²	99.8	67%	0.67	59%	0.594	S	S	*	*	H	α-helix	trans	-66	-45.7	176.9	-70.6	169.4	0	0	0	112.1	N36 E37 L38 L42 A43 G44	N36-L40 VanDerWaalsContact O-CG 3.29Å; N36-L40 WeakPolarHBondContact O-CG 3.42Å; N36-L40 PolarHBondContact O-N 2.98Å; E37-L40 PolarHBondContact O-N 2.85Å; L38-L40 VanDerWaalsContact C-N 3.32Å; L38-L40 PolarHBondContact O-N 3.21Å; L40-L42 VanDerWaalsContact C-N 3.29Å; L40-L42 PolarHBondContact O-N 3.46Å; L40-A43 PolarHBondContact O-N 3.49Å; L40-G44 PolarHBondContact O-N 2.77Å; L40-G44 VanDerWaalsContact O-N 3.17Å
41	K	87.3	Confident	80.6	Confident	135 Å²	135	105.6 Å²	105.6	59%	0.587	61%	0.612	S	S	*	*	H	α-helix	trans	-61.5	-38.6	176.4	-73	177.8	-175.1	174.5	0	111.9	E37 L38 G44 L45	E37-K41 HydrophobicContact CG-CD 4.4Å; E37-K41 WeakPolarHBondContact O-CG 3.01Å; E37-K41 PolarHBondContact O-N 3.39Å; E37-K41 VanDerWaalsContact OE1-CE 3.24Å; E37-K41 WeakPolarHBondContact OE1-CE 3.48Å; E37-K41 IonicContact OE1-NZ 2.67Å; E37-K41 PolarHBondContact OE1-NZ 3.08Å; L38-K41 PolarHBondContact O-N 2.89Å; K41-G44 PolarHBondContact O-N 3.28Å; K41-L45 PolarHBondContact O-N 3.38Å
42	L	90.1	Very high	80.8	Confident	118 Å²	118	104.9 Å²	104.9	62%	0.618	61%	0.614	S	S	*	*	H	α-helix	trans	-68.5	-39	177.1	-174.7	60.3	0	0	0	112.2	L38 A39 L40 G44 L45	L38-L42 WeakPolarHBondContact O-CB 3.41Å; L38-L42 PolarHBondContact O-N 3.2Å; A39-L42 PolarHBondContact O-N 2.88Å; L40-L42 VanDerWaalsContact C-N 3.29Å; L40-L42 PolarHBondContact O-N 3.46Å; L42-G44 PolarHBondContact O-N 3.3Å; L42-L45 HydrophobicContact CD1-CD2 4.15Å; L42-L45 WeakPolarHBondContact O-CB 3.32Å; L42-L45 PolarHBondContact O-N 3.03Å
43	A	90.8	Very high	80.8	Confident	88 Å²	88	108.4 Å²	108.4	73%	0.727	62%	0.62	S	S	*	*	H	α-helix	trans	-64.5	-28.1	175.9	0	0	0	0	0	113	A39 L40	A39-A43 PolarHBondContact O-N 3.44Å; L40-A43 PolarHBondContact O-N 3.49Å
44	G	87.4	Confident	80.6	Confident	38 Å²	38	113.4 Å²	113.4	39%	0.392	63%	0.634	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83.6	-9.2	176.8	0	0	0	0	0	115.2	L40 K41 L42 D46 K49	L40-G44 PolarHBondContact O-N 2.77Å; L40-G44 VanDerWaalsContact O-N 3.17Å; K41-G44 PolarHBondContact O-N 3.28Å; L42-G44 PolarHBondContact O-N 3.3Å; G44-D46 PolarHBondContact O-N 3.2Å; G44-K49 PolarHBondContact O-NZ 2.73Å
45	L	89.6	Confident	80.3	Confident	129 Å²	129	116.4 Å²	116.4	68%	0.675	65%	0.65	S	S	*	*			trans	-72.3	118.7	-176.5	-176.3	66.2	0	0	0	110.7	K41 L42	K41-L45 PolarHBondContact O-N 3.38Å; L42-L45 HydrophobicContact CD1-CD2 4.15Å; L42-L45 WeakPolarHBondContact O-CB 3.32Å; L42-L45 PolarHBondContact O-N 3.03Å
46	D	88.9	Confident	79.3	Confident	72 Å²	72	114.8 Å²	114.8	39%	0.385	65%	0.648	S	S	.	*			trans	-139.2	122.7	176.9	178.3	-2	0	0	0	108.6	G44 N48 K49	G44-D46 PolarHBondContact O-N 3.2Å; D46-N48 PolarHBondContact O-N 3.25Å; D46-N48 PolarHBondContact OD1-N 3.43Å; D46-N48 PolarHBondContact OD1-ND2 2.99Å; D46-N48 VanDerWaalsContact OD1-ND2 3.15Å; D46-K49 HydrophobicContact CB-CB 4.38Å; D46-K49 HydrophobicContact CB-CD 3.77Å; D46-K49 HydrophobicContact CB-CG 3.76Å; D46-K49 PolarHBondContact O-N 3.19Å
47	I	88.4	Confident	77.5	Confident	156 Å²	156	117.7 Å²	117.7	80%	0.8	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.1	-13.2	-175.6	63.8	174.4	0	0	0	113.2
48	N	90.8	Very high	76.1	Confident	131 Å²	131	124.5 Å²	124.5	70%	0.701	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.1	-5.5	-179.9	-49.2	-75.6	0	0	0	112.1	D46 T50	D46-N48 PolarHBondContact O-N 3.25Å; D46-N48 PolarHBondContact OD1-N 3.43Å; D46-N48 PolarHBondContact OD1-ND2 2.99Å; D46-N48 VanDerWaalsContact OD1-ND2 3.15Å; N48-T50 PolarHBondContact O-N 3.38Å
49	K	83.8	Confident	74.2	Confident	122 Å²	122	123.5 Å²	123.5	53%	0.53	68%	0.683	S	S	.	*			trans	-68.5	126.2	173.5	-80.8	178.3	-169.9	173.4	0	109.4	G44 D46 E51	G44-K49 PolarHBondContact O-NZ 2.73Å; D46-K49 HydrophobicContact CB-CB 4.38Å; D46-K49 HydrophobicContact CB-CD 3.77Å; D46-K49 HydrophobicContact CB-CG 3.76Å; D46-K49 PolarHBondContact O-N 3.19Å; K49-E51 PolarHBondContact O-N 3.5Å
50	T	75.7	Confident	72.3	Confident	108 Å²	108	125.6 Å²	125.6	66%	0.663	69%	0.694	S	S	*	*			trans	-75.5	119.1	166.5	47	0	0	0	0	108.5	N48 G52	N48-T50 PolarHBondContact O-N 3.38Å; T50-G52 PolarHBondContact O-N 3.24Å
51	E	65.1	Low	69.9	Low	204 Å²	204	125.9 Å²	125.9	95%	0.953	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-50.5	109.5	178.2	56.1	-160.1	154.8	0	0	111.7	K49	K49-E51 PolarHBondContact O-N 3.5Å
52	G	62.2	Low	68	Low	78 Å²	78	127.5 Å²	127.5	80%	0.804	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	159.8	-10.8	-177.8	0	0	0	0	0	117.3	T50	T50-G52 PolarHBondContact O-N 3.24Å
53	E	58.2	Low	65.7	Low	166 Å²	166	130.5 Å²	130.5	78%	0.776	72%	0.722	S	S	*	*			trans	-107.3	7.1	-172.3	-61.3	-177.1	132.2	0	0	115.4
54	D	58	Low	63.3	Low	159 Å²	159	131.6 Å²	131.6	85%	0.85	72%	0.724	S	S	*	*			trans	-104.8	94.1	176.3	-164.2	53	0	0	0	111.7	G56	D54-G56 PolarHBondContact O-N 3.5Å
55	N	59.5	Low	60.9	Low	147 Å²	147	133.2 Å²	133.2	79%	0.786	74%	0.741	S	S	*	*			trans	-85.4	92.6	175.7	177.5	39.8	0	0	0	110.6
56	G	55.5	Low	58.6	Low	57 Å²	57	136.1 Å²	136.1	59%	0.588	75%	0.751	S	S	*	*			trans	156.9	74.8	157.3	0	0	0	0	0	118.4	D54	D54-G56 PolarHBondContact O-N 3.5Å
57	Q	45.7	Very low	56.3	Low	179 Å²	179	137.4 Å²	137.4	84%	0.836	77%	0.771	S	S	*	*				-163.3	89.7	127.4	-165.5	147.9	-100.5	0	0	109.6	S59	Q57-S59 PolarHBondContact O-N 3.35Å
58	R	54.7	Low	54.1	Low	224 Å²	224	139.6 Å²	139.6	85%	0.845	78%	0.778	S	S	*	*			trans	-68.4	105.6	159	-66.8	-178.4	-178.2	97.1	2.3	107.2
59	S	47.2	Very low	51.4	Low	100 Å²	100	136.9 Å²	136.9	70%	0.699	78%	0.782	S	S	*	*			trans	-107.8	73.3	148.7	76.3	0	0	0	0	108.3	Q57 T61	Q57-S59 PolarHBondContact O-N 3.35Å; S59-T61 VanDerWaalsContact C-N 3.29Å; S59-T61 PolarHBondContact O-N 2.9Å; S59-T61 VanDerWaalsContact O-N 3.08Å
60	S	49.9	Very low	49.3	Very low	99 Å²	99	139.7 Å²	139.7	69%	0.692	80%	0.797	S	S	*	*			trans	-64.2	100.9	150.8	-81.8	0	0	0	0	106.5
61	T	40.2	Very low	47.8	Very low	134 Å²	134	139.4 Å²	139.4	82%	0.822	81%	0.805	S	S	*	*			trans	-111.2	77.6	150.6	-56.3	0	0	0	0	105.7	S59	S59-T61 VanDerWaalsContact C-N 3.29Å; S59-T61 PolarHBondContact O-N 2.9Å; S59-T61 VanDerWaalsContact O-N 3.08Å
62	E	46.2	Very low	46.7	Very low	169 Å²	169	133.6 Å²	133.6	79%	0.79	79%	0.792	S	S	*	*			trans	-66	121.7	156	-63.2	-179.8	127.7	0	0	107.3
63	Q	41.1	Very low	45.9	Very low	181 Å²	181	139.2 Å²	139.2	85%	0.846	79%	0.794	S	S	*	*				-178.4	113.4	122.8	-113.7	179.1	-90.3	0	0	111.5
64	S	40.3	Very low	45.2	Very low	110 Å²	110	135.9 Å²	135.9	77%	0.769	79%	0.789	S	S	*	*				49.9	120.9	122.9	-164	0	0	0	0	119.3
65	G	36.9	Very low	44.1	Very low	72 Å²	72	137.1 Å²	137.1	74%	0.742	79%	0.79	S	S	*	*			trans	-179.5	40.4	166.6	0	0	0	0	0	113.9	A67	G65-A67 PolarHBondContact O-N 3.35Å
66	E	43	Very low	43.4	Very low	191 Å²	191	139.5 Å²	139.5	89%	0.893	82%	0.818	S	S	*	*			trans	-66.8	115.5	161.1	37.7	-166	117.9	0	0	108.8
67	A	38.9	Very low	42.8	Very low	98 Å²	98	143.7 Å²	143.7	81%	0.81	83%	0.83	S	S	*	*			trans	-139.6	114.7	166.2	0	0	0	0	0	109.2	G65	G65-A67 PolarHBondContact O-N 3.35Å
68	Q	43.2	Very low	42.7	Very low	202 Å²	202	141.8 Å²	141.8	94%	0.944	83%	0.829	S	S	*	*			trans	-68.6	162.3	173.1	-57.3	172	-70.5	0	0	111.4
69	G	34	Very low	42	Very low	75 Å²	75	137.2 Å²	137.2	77%	0.773	83%	0.829	S	S	*	*			trans	112.1	126.6	168.6	0	0	0	0	0	111
70	E	40.3	Very low	41.7	Very low	181 Å²	181	139.4 Å²	139.4	85%	0.846	84%	0.836	S	S	*	*			cis	-160.6	128.9	35.7	-170.4	157.8	129.5	0	0	109.6
71	A	42.7	Very low	41.2	Very low	102 Å²	102	141.9 Å²	141.9	84%	0.843	85%	0.845	S	S	*	*			trans	-87.6	121.5	157.4	0	0	0	0	0	107.8
72	A	43.2	Very low	41.3	Very low	82 Å²	82	142.5 Å²	142.5	68%	0.678	85%	0.847	S	S	*	*			trans	152.6	142.3	159.7	0	0	0	0	0	106.2
73	K	44.8	Very low	40.9	Very low	196 Å²	196	140.6 Å²	140.6	85%	0.852	85%	0.851	S	S	*	*			cis	-164.6	151.8	22.5	-159.9	174.2	173.2	-166.4	0	109.2
74	S	42.8	Very low	40.9	Very low	96 Å²	96	137.5 Å²	137.5	67%	0.671	85%	0.851	S	S	*	*			trans	-19.1	144.5	157.2	-43.2	0	0	0	0	119.3
75	E	36.3	Very low	41	Very low	184 Å²	184	139.8 Å²	139.8	86%	0.86	86%	0.858	S	S	*	*				65.8	110.8	125.3	-161.8	176.6	141.3	0	0	119
76	S	45.3	Very low	41.3	Very low	198 Å²	198	145.9 Å²	145.9	100%	1.385	87%	0.869	S	S	*	*			trans	-155	0	136.1	-77.6	0	0	0	0	109.5

Retrieved 76 of 76 residues in 38.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).