A0A061IJZ9_CRIGR Loading...

Beta-defensin 14

AlphaFold DB , UniProt , Accession A0A061IJZ9, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene LOC100769521, Length 68 aa.

						>A0A061IJZ9_CRIGR|A0A061IJZ9|LOC100769521
MRLHYLLFAFLILFLVPAPGNAFIQRTIQKLFCRLRGGRCALFSCLAREEQIGQCSSRGRKCCRTKKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.2	Low	75.2	Confident	192 Å²	192	138.5 Å²	138.5	95%	0.946	65%	0.653	S	S	*	*				0	-36.6	0	-60	-46.4	-168.6	0	0	115	Y5	M1-Y5 WeakPolarHBondContact O-CD2 3.46Å; M1-Y5 WeakPolarHBondContact O-CE2 3.45Å
2	R	65.6	Low	75.1	Confident	221 Å²	221	134.2 Å²	134.2	83%	0.834	64%	0.636	S	S	*	*	H	α-helix	trans	-71.9	-31.3	-178	-77.2	-176.8	167.2	175.2	-3.6	115.9	H4 Y5 L6	R2-H4 PolarHBondContact O-N 3.34Å; R2-Y5 PolarHBondContact O-N 3.2Å; R2-L6 PolarHBondContact O-N 3.3Å
3	L	75.9	Confident	75	Confident	134 Å²	134	135 Å²	135	70%	0.702	65%	0.645	S	S	*	*	H	α-helix	trans	-65.3	-35.6	-175.7	-154.1	83	0	0	0	113.2	Y5 L6 L7	L3-Y5 VanDerWaalsContact C-N 3.32Å; L3-Y5 PolarHBondContact O-N 3.32Å; L3-L6 PolarHBondContact O-N 2.84Å; L3-L7 PolarHBondContact O-N 2.9Å
4	H	76.3	Confident	74.5	Confident	139 Å²	139	137.5 Å²	137.5	64%	0.644	65%	0.652	S	S	*	*	H	α-helix	trans	-65.5	-35.8	179.2	-62.2	92.1	0	0	0	111.9	R2 L7 F8	R2-H4 PolarHBondContact O-N 3.34Å; H4-L7 PolarHBondContact O-N 3.32Å; H4-F8 VanDerWaalsContact O-CB 3.29Å; H4-F8 WeakPolarHBondContact O-CB 3.43Å; H4-F8 PolarHBondContact O-N 2.92Å
5	Y	76.4	Confident	73.9	Confident	179 Å²	179	136.9 Å²	136.9	70%	0.702	65%	0.654	S	S	*	*	H	α-helix	trans	-67	-37.8	175.4	-66.6	-77.9	0	0	0	112.2	M1 R2 L3 F8 A9	M1-Y5 WeakPolarHBondContact O-CD2 3.46Å; M1-Y5 WeakPolarHBondContact O-CE2 3.45Å; R2-Y5 PolarHBondContact O-N 3.2Å; L3-Y5 VanDerWaalsContact C-N 3.32Å; L3-Y5 PolarHBondContact O-N 3.32Å; Y5-F8 PolarHBondContact O-N 2.71Å; Y5-A9 VanDerWaalsContact O-CB 3.31Å; Y5-A9 WeakPolarHBondContact O-CB 3.05Å; Y5-A9 PolarHBondContact O-N 3.32Å
6	L	79.1	Confident	73.3	Confident	120 Å²	120	133.5 Å²	133.5	63%	0.628	64%	0.644	S	S	*	*	H	α-helix	trans	-66	-45.1	175.3	-75.3	166.8	0	0	0	111.3	R2 L3 F8 A9 F10	R2-L6 PolarHBondContact O-N 3.3Å; L3-L6 PolarHBondContact O-N 2.84Å; L6-F8 VanDerWaalsContact C-N 3.32Å; L6-F8 PolarHBondContact O-N 3.1Å; L6-A9 PolarHBondContact O-N 3.43Å; L6-F10 WeakPolarHBondContact O-CB 3.27Å; L6-F10 PolarHBondContact O-N 3.15Å
7	L	81.4	Confident	72.5	Confident	120 Å²	120	132.2 Å²	132.2	63%	0.628	65%	0.648	S	S	*	*	H	α-helix	trans	-60.7	-44.5	177	-157.8	96	0	0	0	110.9	L3 H4 F10 L11	L3-L7 PolarHBondContact O-N 2.9Å; H4-L7 PolarHBondContact O-N 3.32Å; L7-F10 PolarHBondContact O-N 3.14Å; L7-L11 WeakPolarHBondContact O-CB 3.37Å; L7-L11 PolarHBondContact O-N 2.03Å
8	F	78.1	Confident	71.8	Confident	141 Å²	141	128.3 Å²	128.3	62%	0.618	64%	0.641	S	S	*	*	H	α-helix	trans	-66.5	-40.6	179.6	-151.5	-96.5	0	0	0	112	H4 Y5 L6 F10 L11 I12	H4-F8 VanDerWaalsContact O-CB 3.29Å; H4-F8 WeakPolarHBondContact O-CB 3.43Å; H4-F8 PolarHBondContact O-N 2.92Å; Y5-F8 PolarHBondContact O-N 2.71Å; L6-F8 VanDerWaalsContact C-N 3.32Å; L6-F8 PolarHBondContact O-N 3.1Å; F8-F10 VanDerWaalsContact C-N 3.35Å; F8-F10 PolarHBondContact O-N 3.39Å; F8-L11 PolarHBondContact O-N 2.88Å; F8-I12 HydrophobicContact CD1-CD1 3.57Å; F8-I12 HydrophobicContact CD1-CG1 4.2Å; F8-I12 HydrophobicContact CE1-CD1 3.74Å; F8-I12 HydrophobicContact CE1-CG1 4.3Å; F8-I12 VanDerWaalsContact O-CG1 3.29Å; F8-I12 WeakPolarHBondContact O-CG1 3.05Å; F8-I12 PolarHBondContact O-N 2.03Å
9	A	80.3	Confident	70.9	Confident	48 Å²	48	128.1 Å²	128.1	40%	0.397	65%	0.65	S	S	.	*	H	α-helix	trans	-62.3	-41.5	174.3	0	0	0	0	0	112	Y5 L6 L11 I12 L13	Y5-A9 VanDerWaalsContact O-CB 3.31Å; Y5-A9 WeakPolarHBondContact O-CB 3.05Å; Y5-A9 PolarHBondContact O-N 3.32Å; L6-A9 PolarHBondContact O-N 3.43Å; A9-L11 VanDerWaalsContact C-N 3.33Å; A9-I12 PolarHBondContact O-N 2.83Å; A9-L13 WeakPolarHBondContact O-CB 3.31Å; A9-L13 PolarHBondContact O-N 2.81Å
10	F	79.1	Confident	70.2	Confident	138 Å²	138	123.5 Å²	123.5	61%	0.605	64%	0.635	S	S	*	*	H	α-helix	trans	-63.9	-41.1	176.9	-145	-90	0	0	0	111.6	L6 L7 F8 L13 F14	L6-F10 WeakPolarHBondContact O-CB 3.27Å; L6-F10 PolarHBondContact O-N 3.15Å; L7-F10 PolarHBondContact O-N 3.14Å; F8-F10 VanDerWaalsContact C-N 3.35Å; F8-F10 PolarHBondContact O-N 3.39Å; F10-L13 PolarHBondContact O-N 3.41Å; F10-F14 AromaticContact CD1-CD2 3.84Å; F10-F14 HydrophobicContact CD1-CD2 3.84Å; F10-F14 HydrophobicContact CD1-CE2 4.13Å; F10-F14 AromaticContact CE1-CD2 3.64Å; F10-F14 HydrophobicContact CE1-CD2 3.64Å; F10-F14 AromaticContact CE1-CE2 3.43Å; F10-F14 HydrophobicContact CE1-CE2 3.43Å; F10-F14 VanDerWaalsContact CE1-CE2 3.43Å; F10-F14 HydrophobicContact CE1-CZ 4.48Å; F10-F14 HydrophobicContact CZ-CD2 4.48Å; F10-F14 AromaticContact CZ-CE2 3.99Å; F10-F14 HydrophobicContact CZ-CE2 3.99Å; F10-F14 PolarHBondContact O-N 3.14Å
11	L	76.9	Confident	69.8	Low	92 Å²	92	122.6 Å²	122.6	48%	0.482	63%	0.632	S	S	.	*	H	α-helix	trans	-65.9	-42.7	178.2	-145.5	150.5	0	0	0	110.7	L7 F8 A9 L13 F14 L15	L7-L11 WeakPolarHBondContact O-CB 3.37Å; L7-L11 PolarHBondContact O-N 2.03Å; F8-L11 PolarHBondContact O-N 2.88Å; A9-L11 VanDerWaalsContact C-N 3.33Å; L11-L13 PolarHBondContact O-N 3.49Å; L11-F14 PolarHBondContact O-N 2.94Å; L11-L15 HydrophobicContact CD2-CB 4.24Å; L11-L15 HydrophobicContact CD2-CD2 3.82Å; L11-L15 HydrophobicContact CD2-CG 4.49Å; L11-L15 WeakPolarHBondContact O-CA 3Å; L11-L15 WeakPolarHBondContact O-CB 3.29Å; L11-L15 PolarHBondContact O-N 3.41Å
12	I	73.6	Confident	70.2	Confident	86 Å²	86	116 Å²	116	44%	0.441	61%	0.609	S	S	.	*	H	α-helix	trans	-62.5	-43.1	173.9	-66.4	167.8	0	0	0	111.1	F8 A9 F14 L15 V16	F8-I12 HydrophobicContact CD1-CD1 3.57Å; F8-I12 HydrophobicContact CD1-CG1 4.2Å; F8-I12 HydrophobicContact CE1-CD1 3.74Å; F8-I12 HydrophobicContact CE1-CG1 4.3Å; F8-I12 VanDerWaalsContact O-CG1 3.29Å; F8-I12 WeakPolarHBondContact O-CG1 3.05Å; F8-I12 PolarHBondContact O-N 2.03Å; A9-I12 PolarHBondContact O-N 2.83Å; I12-F14 VanDerWaalsContact C-N 3.34Å; I12-F14 PolarHBondContact O-N 2.74Å; I12-L15 PolarHBondContact O-N 2.91Å; I12-V16 HydrophobicContact CG2-CG2 3.76Å; I12-V16 VanDerWaalsContact O-CB 3.25Å; I12-V16 WeakPolarHBondContact O-CB 3.09Å; I12-V16 WeakPolarHBondContact O-CG2 2.96Å; I12-V16 PolarHBondContact O-N 2.03Å
13	L	73.8	Confident	70.5	Confident	145 Å²	145	112.6 Å²	112.6	76%	0.759	60%	0.6	S	S	*	*	H	α-helix	trans	-63.9	-37.7	-179.5	-116.7	141.4	0	0	0	113.2	A9 F10 L11	A9-L13 WeakPolarHBondContact O-CB 3.31Å; A9-L13 PolarHBondContact O-N 2.81Å; F10-L13 PolarHBondContact O-N 3.41Å; L11-L13 PolarHBondContact O-N 3.49Å
14	F	67.9	Low	70.6	Confident	170 Å²	170	110.9 Å²	110.9	75%	0.746	59%	0.59	S	S	*	*	H	α-helix	trans	-83.7	-32.6	177.7	-98.7	-91.1	0	0	0	113.5	F10 L11 I12	F10-F14 AromaticContact CD1-CD2 3.84Å; F10-F14 HydrophobicContact CD1-CD2 3.84Å; F10-F14 HydrophobicContact CD1-CE2 4.13Å; F10-F14 AromaticContact CE1-CD2 3.64Å; F10-F14 HydrophobicContact CE1-CD2 3.64Å; F10-F14 AromaticContact CE1-CE2 3.43Å; F10-F14 HydrophobicContact CE1-CE2 3.43Å; F10-F14 VanDerWaalsContact CE1-CE2 3.43Å; F10-F14 HydrophobicContact CE1-CZ 4.48Å; F10-F14 HydrophobicContact CZ-CD2 4.48Å; F10-F14 AromaticContact CZ-CE2 3.99Å; F10-F14 HydrophobicContact CZ-CE2 3.99Å; F10-F14 PolarHBondContact O-N 3.14Å; L11-F14 PolarHBondContact O-N 2.94Å; I12-F14 VanDerWaalsContact C-N 3.34Å; I12-F14 PolarHBondContact O-N 2.74Å
15	L	66.5	Low	70.6	Confident	129 Å²	129	110.2 Å²	110.2	68%	0.675	59%	0.587	S	S	*	*	H	α-helix	trans	-88.4	-22.3	-173.8	-156.9	76.1	0	0	0	112.6	L11 I12 P17	L11-L15 HydrophobicContact CD2-CB 4.24Å; L11-L15 HydrophobicContact CD2-CD2 3.82Å; L11-L15 HydrophobicContact CD2-CG 4.49Å; L11-L15 WeakPolarHBondContact O-CA 3Å; L11-L15 WeakPolarHBondContact O-CB 3.29Å; L11-L15 PolarHBondContact O-N 3.41Å; I12-L15 PolarHBondContact O-N 2.91Å; L15-P17 WeakPolarHBondContact O-CD 3.01Å
16	V	64.3	Low	70.7	Confident	82 Å²	82	105.7 Å²	105.7	50%	0.497	57%	0.569	S	S	.	*	S	Bend	trans	-79.2	107.6	172.8	178.6	0	0	0	0	108.2	I12 A18	I12-V16 HydrophobicContact CG2-CG2 3.76Å; I12-V16 VanDerWaalsContact O-CB 3.25Å; I12-V16 WeakPolarHBondContact O-CB 3.09Å; I12-V16 WeakPolarHBondContact O-CG2 2.96Å; I12-V16 PolarHBondContact O-N 2.03Å; V16-A18 PolarHBondContact O-N 2.89Å
17	P	58.8	Low	70.9	Confident	111 Å²	111	103.4 Å²	103.4	72%	0.721	56%	0.56	S	S	*	*			trans	-63	113.9	175.5	26.2	-31.6	0	0	0	107.5	L15 P19	L15-P17 WeakPolarHBondContact O-CD 3.01Å; P17-P19 WeakPolarHBondContact O-CD 3.3Å
18	A	60.9	Low	71.1	Confident	62 Å²	62	102.5 Å²	102.5	51%	0.512	56%	0.555	S	S	.	*			trans	-47.2	108.2	179.4	0	0	0	0	0	109.8	V16 G20	V16-A18 PolarHBondContact O-N 2.89Å; A18-G20 PolarHBondContact O-N 2.94Å
19	P	54.5	Low	71.5	Confident	125 Å²	125	98.9 Å²	98.9	81%	0.812	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.8	0.1	-168.9	26	-31	0	0	0	113	P17	P17-P19 WeakPolarHBondContact O-CD 3.3Å
20	G	56.8	Low	71.8	Confident	35 Å²	35	101.2 Å²	101.2	36%	0.361	54%	0.541	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88	-18.9	-173.5	0	0	0	0	0	116.2	A18 A22 F23 I24	A18-G20 PolarHBondContact O-N 2.94Å; G20-A22 VanDerWaalsContact C-N 3.34Å; G20-A22 PolarHBondContact O-N 3.36Å; G20-F23 PolarHBondContact O-N 3.14Å; G20-I24 PolarHBondContact O-N 3.45Å
21	N	61.1	Low	72.3	Confident	105 Å²	105	99.7 Å²	99.7	56%	0.561	54%	0.539	S	S	*	.	H	α-helix	trans	-69	-33.1	-166.6	-65.4	-4.7	0	0	0	113	F23 I24 Q25	N21-F23 VanDerWaalsContact C-N 3.29Å; N21-F23 PolarHBondContact O-N 3.05Å; N21-I24 PolarHBondContact O-N 3.45Å; N21-Q25 WeakPolarHBondContact O-CG 3.36Å; N21-Q25 PolarHBondContact O-N 3.18Å; N21-Q25 VanDerWaalsContact O-N 3.09Å
22	A	66.3	Low	72.8	Confident	55 Å²	55	100.6 Å²	100.6	46%	0.455	54%	0.539	S	S	.	.	H	α-helix	trans	-67.2	-29.8	-179.8	0	0	0	0	0	112.8	G20 R26	G20-A22 VanDerWaalsContact C-N 3.34Å; G20-A22 PolarHBondContact O-N 3.36Å; A22-R26 VanDerWaalsContact O-CD 3.3Å; A22-R26 WeakPolarHBondContact O-CD 3.48Å; A22-R26 WeakPolarHBondContact O-CG 3.16Å; A22-R26 PolarHBondContact O-N 3.31Å
23	F	72.2	Confident	73.6	Confident	149 Å²	149	96.7 Å²	96.7	65%	0.654	52%	0.52	S	S	*	.	H	α-helix	trans	-77.2	-41.1	179.7	-167	-96.1	0	0	0	111.7	G20 N21 R26 T27	G20-F23 PolarHBondContact O-N 3.14Å; N21-F23 VanDerWaalsContact C-N 3.29Å; N21-F23 PolarHBondContact O-N 3.05Å; F23-R26 PolarHBondContact O-N 3.05Å; F23-T27 PolarHBondContact O-N 2.97Å; F23-T27 PolarHBondContact O-OG1 2.92Å
24	I	78.4	Confident	74.3	Confident	97 Å²	97	98.2 Å²	98.2	50%	0.497	52%	0.515	S	S	.	.	H	α-helix	trans	-62.7	-48.7	177.6	-62.2	167.4	0	0	0	109.7	G20 N21 R26 T27 I28	G20-I24 PolarHBondContact O-N 3.45Å; N21-I24 PolarHBondContact O-N 3.45Å; I24-R26 PolarHBondContact O-N 2.89Å; I24-T27 PolarHBondContact O-N 3.42Å; I24-T27 VanDerWaalsContact O-N 3.14Å; I24-I28 HydrophobicContact CG2-CD1 3.73Å; I24-I28 HydrophobicContact CG2-CG1 4.39Å; I24-I28 WeakPolarHBondContact O-CG1 3.43Å; I24-I28 PolarHBondContact O-N 2.81Å
25	Q	76.9	Confident	75.4	Confident	125 Å²	125	96.5 Å²	96.5	58%	0.584	51%	0.513	S	S	*	.	H	α-helix	trans	-62.1	-40.3	179.5	-72.6	-143.1	-29.8	0	0	113.4	N21 T27 I28 Q29	N21-Q25 WeakPolarHBondContact O-CG 3.36Å; N21-Q25 PolarHBondContact O-N 3.18Å; N21-Q25 VanDerWaalsContact O-N 3.09Å; Q25-T27 VanDerWaalsContact C-N 3.31Å; Q25-T27 PolarHBondContact O-N 3.4Å; Q25-I28 PolarHBondContact O-N 2.92Å; Q25-Q29 WeakPolarHBondContact O-CB 3.26Å; Q25-Q29 WeakPolarHBondContact O-CG 3.44Å; Q25-Q29 PolarHBondContact O-N 3.42Å
26	R	77.3	Confident	76.4	Confident	84 Å²	84	96.8 Å²	96.8	32%	0.317	51%	0.505	S	S	.	.	H	α-helix	trans	-61.5	-41.8	174.9	-74.7	170.2	-173.7	-176.9	7	111.6	A22 F23 I24 K30	A22-R26 VanDerWaalsContact O-CD 3.3Å; A22-R26 WeakPolarHBondContact O-CD 3.48Å; A22-R26 WeakPolarHBondContact O-CG 3.16Å; A22-R26 PolarHBondContact O-N 3.31Å; F23-R26 PolarHBondContact O-N 3.05Å; I24-R26 PolarHBondContact O-N 2.89Å; R26-K30 VanDerWaalsContact O-CB 3.22Å; R26-K30 WeakPolarHBondContact O-CB 3.47Å; R26-K30 PolarHBondContact O-N 3.38Å
27	T	83.7	Confident	77.5	Confident	73 Å²	73	95.6 Å²	95.6	45%	0.448	51%	0.509	S	S	.	.	H	α-helix	trans	-65.8	-45.5	179.8	-56.4	0	0	0	0	110.9	F23 I24 Q25 K30 L31	F23-T27 PolarHBondContact O-N 2.97Å; F23-T27 PolarHBondContact O-OG1 2.92Å; I24-T27 PolarHBondContact O-N 3.42Å; I24-T27 VanDerWaalsContact O-N 3.14Å; Q25-T27 VanDerWaalsContact C-N 3.31Å; Q25-T27 PolarHBondContact O-N 3.4Å; T27-K30 PolarHBondContact O-N 2.79Å; T27-L31 WeakPolarHBondContact O-CB 3.03Å; T27-L31 PolarHBondContact O-N 2.76Å
28	I	86.8	Confident	79	Confident	101 Å²	101	90.9 Å²	90.9	52%	0.518	48%	0.481	S	S	.	.	H	α-helix	trans	-61	-51.2	177.3	-66.1	169.9	0	0	0	110.9	I24 Q25 K30 L31 F32	I24-I28 HydrophobicContact CG2-CD1 3.73Å; I24-I28 HydrophobicContact CG2-CG1 4.39Å; I24-I28 WeakPolarHBondContact O-CG1 3.43Å; I24-I28 PolarHBondContact O-N 2.81Å; Q25-I28 PolarHBondContact O-N 2.92Å; I28-K30 VanDerWaalsContact C-N 3.28Å; I28-K30 PolarHBondContact O-N 3.47Å; I28-L31 PolarHBondContact O-N 2.95Å; I28-F32 WeakPolarHBondContact O-CB 3.22Å; I28-F32 PolarHBondContact O-N 3.24Å
29	Q	85.3	Confident	80.2	Confident	64 Å²	64	93.9 Å²	93.9	30%	0.299	48%	0.479	S	S	.	.	H	α-helix	trans	-59.1	-40.3	179.8	-73.7	179	-4.7	0	0	112.1	Q25 F32 C33 C55 S56	Q25-Q29 WeakPolarHBondContact O-CB 3.26Å; Q25-Q29 WeakPolarHBondContact O-CG 3.44Å; Q25-Q29 PolarHBondContact O-N 3.42Å; Q29-F32 PolarHBondContact O-N 3.23Å; Q29-C33 WeakPolarHBondContact O-CB 3.44Å; Q29-C33 PolarHBondContact O-N 3.09Å; Q29-C55 PolarHBondContact OE1-O 3.32Å; Q29-S56 VanDerWaalsContact OE1-CA 3.32Å
30	K	86.4	Confident	81.9	Confident	98 Å²	98	90.2 Å²	90.2	43%	0.426	46%	0.456	S	S	.	.	H	α-helix	trans	-67.7	-39.9	178.4	-158.5	178.2	-169.1	-172.8	0	111.9	R26 T27 I28 R34	R26-K30 VanDerWaalsContact O-CB 3.22Å; R26-K30 WeakPolarHBondContact O-CB 3.47Å; R26-K30 PolarHBondContact O-N 3.38Å; T27-K30 PolarHBondContact O-N 2.79Å; I28-K30 VanDerWaalsContact C-N 3.28Å; I28-K30 PolarHBondContact O-N 3.47Å; K30-R34 PolarHBondContact O-N 3.45Å; K30-R34 VanDerWaalsContact O-N 3.14Å
31	L	89	Confident	83.4	Confident	106 Å²	106	89.1 Å²	89.1	56%	0.555	44%	0.443	S	S	*	.	H	α-helix	trans	-65.2	-44.8	175.5	-162.7	77.4	0	0	0	110.7	T27 I28 C33 R34 L35	T27-L31 WeakPolarHBondContact O-CB 3.03Å; T27-L31 PolarHBondContact O-N 2.76Å; I28-L31 PolarHBondContact O-N 2.95Å; L31-C33 VanDerWaalsContact C-N 3.34Å; L31-C33 PolarHBondContact O-N 3.42Å; L31-R34 PolarHBondContact O-N 3.3Å; L31-R34 VanDerWaalsContact O-N 3.15Å; L31-L35 HydrophobicContact CG-CD1 4.44Å; L31-L35 WeakPolarHBondContact O-CG 3.45Å; L31-L35 PolarHBondContact O-N 3.37Å
32	F	89.1	Confident	84.5	Confident	111 Å²	111	89.4 Å²	89.4	49%	0.487	44%	0.444	S	S	.	.	H	α-helix	trans	-62.9	-39.9	178.8	-144.7	-104.6	0	0	0	112.4	I28 Q29 L35 R36	I28-F32 WeakPolarHBondContact O-CB 3.22Å; I28-F32 PolarHBondContact O-N 3.24Å; Q29-F32 PolarHBondContact O-N 3.23Å; F32-L35 PolarHBondContact O-N 3.16Å; F32-R36 VanDerWaalsContact CE1-CZ 3.49Å; F32-R36 PolarHBondContact O-N 3.3Å; F32-R36 VanDerWaalsContact O-N 3.14Å
33	C	90.1	Very high	85.2	Confident	4 Å²	4	95.1 Å²	95.1	3%	0.027	46%	0.459	C	S	.	.	H	α-helix	trans	-62	-43	173.5	-173.7	0	0	0	0	111.7	Q29 L31 R36 G38 C62	Q29-C33 WeakPolarHBondContact O-CB 3.44Å; Q29-C33 PolarHBondContact O-N 3.09Å; L31-C33 VanDerWaalsContact C-N 3.34Å; L31-C33 PolarHBondContact O-N 3.42Å; C33-R36 PolarHBondContact O-N 2.97Å; C33-G38 WeakPolarHBondContact O-CA 3.35Å; C33-G38 PolarHBondContact O-N 3.12Å; C33-C62 VanDerWaalsContact CA-SG 3.52Å; C33-C62 HydrophobicContact CB-CB 3.9Å; C33-C62 WeakPolarHBondContact CB-SG 3.29Å; C33-C62 VanDerWaalsContact SG-CA 3.6Å; C33-C62 WeakPolarHBondContact SG-CB 3.33Å; C33-C62 CovalentContact SG-SG 2.03Å; C33-C62 PolarHBondContact SG-SG 3.16Å
34	R	88.3	Confident	85.8	Confident	177 Å²	177	92 Å²	92	67%	0.668	46%	0.456	S	S	*	.	H	α-helix	trans	-64.5	-43.4	175.8	-78.5	-155.6	-119.4	-173.5	1.2	112.8	K30 L31 R36 G37	K30-R34 PolarHBondContact O-N 3.45Å; K30-R34 VanDerWaalsContact O-N 3.14Å; L31-R34 PolarHBondContact O-N 3.3Å; L31-R34 VanDerWaalsContact O-N 3.15Å; R34-R36 PolarHBondContact O-N 2.99Å; R34-G37 WeakPolarHBondContact O-CA 3.3Å; R34-G37 PolarHBondContact O-N 2.98Å
35	L	90.6	Very high	86.2	Confident	133 Å²	133	88.6 Å²	88.6	70%	0.696	44%	0.441	S	S	*	.	H	α-helix	trans	-61.2	-33.2	178.6	-73.9	170.5	0	0	0	112.3	L31 F32 G37	L31-L35 HydrophobicContact CG-CD1 4.44Å; L31-L35 WeakPolarHBondContact O-CG 3.45Å; L31-L35 PolarHBondContact O-N 3.37Å; F32-L35 PolarHBondContact O-N 3.16Å; L35-G37 PolarHBondContact O-N 3.48Å
36	R	87.4	Confident	86.8	Confident	135 Å²	135	86.8 Å²	86.8	51%	0.509	43%	0.434	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.5	3.1	173.5	-71	179.1	173	-169.5	-6.2	113.9	F32 C33 R34 G38	F32-R36 VanDerWaalsContact CE1-CZ 3.49Å; F32-R36 PolarHBondContact O-N 3.3Å; F32-R36 VanDerWaalsContact O-N 3.14Å; C33-R36 PolarHBondContact O-N 2.97Å; R34-R36 PolarHBondContact O-N 2.99Å; R36-G38 VanDerWaalsContact C-N 3.29Å
37	G	87.6	Confident	87.2	Confident	57 Å²	57	87.8 Å²	87.8	59%	0.588	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.9	23.2	-176.6	0	0	0	0	0	113.5	R34 L35	R34-G37 WeakPolarHBondContact O-CA 3.3Å; R34-G37 PolarHBondContact O-N 2.98Å; L35-G37 PolarHBondContact O-N 3.48Å
38	G	89.6	Confident	87.3	Confident	12 Å²	12	94.4 Å²	94.4	12%	0.124	48%	0.477	C	S	.	.			trans	-98	163	178.2	0	0	0	0	0	113.3	C33 R36 C63	C33-G38 WeakPolarHBondContact O-CA 3.35Å; C33-G38 PolarHBondContact O-N 3.12Å; R36-G38 VanDerWaalsContact C-N 3.29Å; G38-C63 CarbonylContact C-O 3.45Å; G38-C63 WeakPolarHBondContact CA-O 3.15Å
39	R	87.9	Confident	87.4	Confident	125 Å²	125	90.5 Å²	90.5	47%	0.472	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	143.3	172.7	59.1	-172.7	-100.1	-159	6.9	110.5	E49 C63	R39-E49 VanDerWaalsContact CD-OE1 3.27Å; R39-E49 WeakPolarHBondContact CD-OE1 3.1Å; R39-E49 IonicContact CZ-OE1 3.46Å; R39-E49 IonicContact CZ-OE2 3.71Å; R39-E49 IonicContact NE-OE1 3.64Å; R39-E49 IonicContact NE-OE2 3.61Å; R39-E49 IonicContact NH1-OE1 2.71Å; R39-E49 PolarHBondContact NH1-OE1 3.37Å; R39-E49 IonicContact NH1-OE2 3.64Å; R39-C63 HydrophobicContact CG-CB 4.18Å; R39-C63 PolarHBondContact N-O 3.46Å; R39-C63 PolarHBondContact O-N 2.92Å
40	C	88.6	Confident	87.7	Confident	48 Å²	48	91.1 Å²	91.1	32%	0.324	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.9	120.8	174.7	-60.5	0	0	0	0	110.4	C55 K61	C40-C55 VanDerWaalsContact CA-SG 3.55Å; C40-C55 HydrophobicContact CB-CB 3.68Å; C40-C55 WeakPolarHBondContact CB-SG 3.47Å; C40-C55 WeakPolarHBondContact SG-CB 3.13Å; C40-C55 CovalentContact SG-SG 2.03Å; C40-C55 PolarHBondContact SG-SG 3.43Å; C40-K61 CarbonylContact C-O 3.56Å; C40-K61 VanDerWaalsContact CA-O 3.31Å; C40-K61 WeakPolarHBondContact CA-O 3.27Å
41	A	88.9	Confident	87.8	Confident	12 Å²	12	91.3 Å²	91.3	10%	0.099	46%	0.462	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	148.9	173.1	0	0	0	0	0	111.2	S44 R60 K61 C63	A41-S44 VanDerWaalsContact CB-O 3.26Å; A41-S44 WeakPolarHBondContact CB-O 3.47Å; A41-R60 CarbonylContact O-C 3.5Å; A41-R60 VanDerWaalsContact O-CA 3.29Å; A41-R60 WeakPolarHBondContact O-CA 3.29Å; A41-K61 PolarHBondContact N-O 2.97Å; A41-K61 PolarHBondContact O-N 2.93Å; A41-C63 VanDerWaalsContact CB-SG 3.57Å
42	L	84.3	Confident	87.8	Confident	112 Å²	112	88.9 Å²	88.9	59%	0.586	45%	0.449	S	S	*	.	S	Bend	trans	-76.9	-40.8	-177.4	-129.1	86.6	0	0	0	112.9	R60	L42-R60 HydrophobicContact CD1-CG 4.49Å
43	F	81.2	Confident	87.7	Confident	175 Å²	175	84.9 Å²	84.9	77%	0.768	44%	0.439	S	S	*	.	S	Bend	trans	-119	-58.2	-174.4	-80.9	-84.7	0	0	0	112.5
44	S	85.2	Confident	87.5	Confident	82 Å²	82	90 Å²	90	57%	0.573	46%	0.463	S	S	*	.			trans	-145	157.3	-175.9	53.9	0	0	0	0	111.4	A41	A41-S44 VanDerWaalsContact CB-O 3.26Å; A41-S44 WeakPolarHBondContact CB-O 3.47Å
45	C	87.1	Confident	87.4	Confident	27 Å²	27	81.9 Å²	81.9	18%	0.182	43%	0.433	C	S	.	.			trans	-77	152.7	170.5	-58.3	0	0	0	0	110.2	E49 C63	C45-E49 HydrophobicContact CB-CB 4.27Å; C45-C63 WeakPolarHBondContact CA-SG 2.95Å; C45-C63 HydrophobicContact CB-CB 3.64Å; C45-C63 WeakPolarHBondContact CB-SG 3.46Å; C45-C63 VanDerWaalsContact SG-CA 3.55Å; C45-C63 WeakPolarHBondContact SG-CB 3.41Å; C45-C63 CovalentContact SG-SG 2.03Å; C45-C63 PolarHBondContact SG-SG 3.42Å
46	L	88.8	Confident	86.9	Confident	87 Å²	87	76 Å²	76	46%	0.455	40%	0.402	S	S	.	.			trans	-68.5	157.1	175.2	-82.2	71.3	0	0	0	110.5	R48 E49	L46-R48 PolarHBondContact O-N 3.44Å; L46-R48 VanDerWaalsContact O-N 3.1Å; L46-E49 HydrophobicContact CB-CB 4.42Å; L46-E49 HydrophobicContact CB-CG 4.09Å; L46-E49 WeakPolarHBondContact O-CA 3.11Å; L46-E49 WeakPolarHBondContact O-CB 3.25Å; L46-E49 PolarHBondContact O-N 3.46Å; L46-E49 VanDerWaalsContact O-O 3.04Å
47	A	85.2	Confident	86.1	Confident	104 Å²	104	74.1 Å²	74.1	86%	0.86	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.4	-26.8	179.5	0	0	0	0	0	114.2	E49	A47-E49 VanDerWaalsContact C-N 3.3Å
48	R	86.4	Confident	85.5	Confident	212 Å²	212	81.1 Å²	81.1	80%	0.8	42%	0.419	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.1	-1.2	175.2	-64.5	-176.1	179.1	175.5	0.5	113.5	L46 K66	L46-R48 PolarHBondContact O-N 3.44Å; L46-R48 VanDerWaalsContact O-N 3.1Å; R48-K66 PolarHBondContact O-N 3.24Å
49	E	89.3	Confident	84.9	Confident	20 Å²	20	82.3 Å²	82.3	9%	0.093	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	148.7	-176.9	-60.3	-176.4	164.8	0	0	110.4	R39 C45 L46 A47 C63 R64	R39-E49 VanDerWaalsContact CD-OE1 3.27Å; R39-E49 WeakPolarHBondContact CD-OE1 3.1Å; R39-E49 IonicContact CZ-OE1 3.46Å; R39-E49 IonicContact CZ-OE2 3.71Å; R39-E49 IonicContact NE-OE1 3.64Å; R39-E49 IonicContact NE-OE2 3.61Å; R39-E49 IonicContact NH1-OE1 2.71Å; R39-E49 PolarHBondContact NH1-OE1 3.37Å; R39-E49 IonicContact NH1-OE2 3.64Å; C45-E49 HydrophobicContact CB-CB 4.27Å; L46-E49 HydrophobicContact CB-CB 4.42Å; L46-E49 HydrophobicContact CB-CG 4.09Å; L46-E49 WeakPolarHBondContact O-CA 3.11Å; L46-E49 WeakPolarHBondContact O-CB 3.25Å; L46-E49 PolarHBondContact O-N 3.46Å; L46-E49 VanDerWaalsContact O-O 3.04Å; A47-E49 VanDerWaalsContact C-N 3.3Å; E49-C63 HydrophobicContact CB-CB 4.26Å; E49-C63 WeakPolarHBondContact OE2-CB 3.31Å; E49-R64 CarbonylContact C-O 3.4Å; E49-R64 WeakPolarHBondContact CA-O 3.37Å; E49-R64 WeakPolarHBondContact CB-O 3.14Å
50	E	90.1	Very high	84.9	Confident	77 Å²	77	81.5 Å²	81.5	36%	0.36	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	144.2	173.4	59.9	178.7	174.6	0	0	110.8	I52 C63 R64 K66	E50-I52 HydrophobicContact CG-CD1 4.26Å; E50-I52 HydrophobicContact CG-CG1 4.01Å; E50-I52 PolarHBondContact O-N 2.98Å; E50-C63 CarbonylContact O-C 3.5Å; E50-C63 VanDerWaalsContact O-CA 3.3Å; E50-C63 WeakPolarHBondContact O-CA 3.29Å; E50-R64 HydrophobicContact CG-CB 4.21Å; E50-R64 PolarHBondContact N-O 3Å; E50-R64 PolarHBondContact O-N 3.44Å; E50-K66 HydrophobicContact CB-CG 4.13Å; E50-K66 HydrophobicContact CG-CG 4.33Å
51	Q	89.8	Confident	85	Confident	102 Å²	102	82.3 Å²	82.3	48%	0.477	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.3	116.4	172.7	-177.8	-174.2	-32.9	0	0	109.3	K61	Q51-K61 HydrophobicContact CG-CD 4.31Å
52	I	87.6	Confident	85	Confident	55 Å²	55	82 Å²	82	28%	0.282	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	-22.6	179.7	-57.6	-162.5	0	0	0	112	E50 C62 R64	E50-I52 HydrophobicContact CG-CD1 4.26Å; E50-I52 HydrophobicContact CG-CG1 4.01Å; E50-I52 PolarHBondContact O-N 2.98Å; I52-C62 PolarHBondContact N-O 3.32Å; I52-R64 HydrophobicContact CD1-CB 3.25Å; I52-R64 HydrophobicContact CD1-CG 3.9Å; I52-R64 HydrophobicContact CG1-CB 3.9Å
53	G	86.8	Confident	85.4	Confident	26 Å²	26	76.7 Å²	76.7	27%	0.268	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	175	-149.1	-178.8	0	0	0	0	0	113.3	C62	G53-C62 PolarHBondContact N-O 3.32Å; G53-C62 PolarHBondContact O-N 2.8Å
54	Q	86.8	Confident	85.9	Confident	113 Å²	113	72.8 Å²	72.8	53%	0.528	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	144.3	-179	-57	-178.4	23.7	0	0	110.5	R60	Q54-R60 CarbonylContact C-O 3.47Å; Q54-R60 VanDerWaalsContact CA-O 3.27Å; Q54-R60 WeakPolarHBondContact CA-O 3.48Å
55	C	85.6	Confident	86	Confident	6 Å²	6	73 Å²	73	4%	0.041	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	-12.3	176.7	-69.7	0	0	0	0	113.6	Q29 C40 R60	Q29-C55 PolarHBondContact OE1-O 3.32Å; C40-C55 VanDerWaalsContact CA-SG 3.55Å; C40-C55 HydrophobicContact CB-CB 3.68Å; C40-C55 WeakPolarHBondContact CB-SG 3.47Å; C40-C55 WeakPolarHBondContact SG-CB 3.13Å; C40-C55 CovalentContact SG-SG 2.03Å; C40-C55 PolarHBondContact SG-SG 3.43Å; C55-R60 HydrophobicContact CB-CB 4.1Å; C55-R60 PolarHBondContact N-O 3.03Å
56	S	79.9	Confident	85.8	Confident	8 Å²	8	77.4 Å²	77.4	6%	0.056	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159	145.5	178.3	177.7	0	0	0	0	109.4	Q29 R58 G59	Q29-S56 VanDerWaalsContact OE1-CA 3.32Å; S56-R58 PolarHBondContact O-N 3.49Å; S56-R58 VanDerWaalsContact O-N 3.12Å; S56-R58 PolarHBondContact OG-N 2.91Å; S56-G59 PolarHBondContact O-N 3.49Å; S56-G59 VanDerWaalsContact O-N 3.16Å
57	S	72.3	Confident	85.2	Confident	97 Å²	97	82 Å²	82	68%	0.678	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.6	-20.3	170.6	57.4	0	0	0	0	113.6	G59	S57-G59 PolarHBondContact O-N 3.4Å; S57-G59 VanDerWaalsContact O-N 3.16Å
58	R	74.3	Confident	84.1	Confident	203 Å²	203	90.2 Å²	90.2	77%	0.766	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.7	27.3	173.2	-71.9	-171.8	177.2	179.3	-0.8	113.7	S56	S56-R58 PolarHBondContact O-N 3.49Å; S56-R58 VanDerWaalsContact O-N 3.12Å; S56-R58 PolarHBondContact OG-N 2.91Å
59	G	77.9	Confident	84	Confident	37 Å²	37	84.1 Å²	84.1	38%	0.381	40%	0.403	S	S	.	.	T	Hydrogen-bonded Turn	trans	84.5	8.2	170.2	0	0	0	0	0	116.7	S56 S57 K61	S56-G59 PolarHBondContact O-N 3.49Å; S56-G59 VanDerWaalsContact O-N 3.16Å; S57-G59 PolarHBondContact O-N 3.4Å; S57-G59 VanDerWaalsContact O-N 3.16Å; G59-K61 PolarHBondContact O-N 3.31Å
60	R	87.2	Confident	83.7	Confident	109 Å²	109	87.5 Å²	87.5	41%	0.411	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.2	127.9	174.4	-65.8	-172.5	173.8	170.4	-3.2	109.6	A41 L42 Q54 C55	A41-R60 CarbonylContact O-C 3.5Å; A41-R60 VanDerWaalsContact O-CA 3.29Å; A41-R60 WeakPolarHBondContact O-CA 3.29Å; L42-R60 HydrophobicContact CD1-CG 4.49Å; Q54-R60 CarbonylContact C-O 3.47Å; Q54-R60 VanDerWaalsContact CA-O 3.27Å; Q54-R60 WeakPolarHBondContact CA-O 3.48Å; C55-R60 HydrophobicContact CB-CB 4.1Å; C55-R60 PolarHBondContact N-O 3.03Å
61	K	89.8	Confident	83.4	Confident	64 Å²	64	88.1 Å²	88.1	28%	0.278	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	147.2	-178.7	-64.5	-172.8	167.4	-164.3	0	111.4	C40 A41 Q51 G59	C40-K61 CarbonylContact C-O 3.56Å; C40-K61 VanDerWaalsContact CA-O 3.31Å; C40-K61 WeakPolarHBondContact CA-O 3.27Å; A41-K61 PolarHBondContact N-O 2.97Å; A41-K61 PolarHBondContact O-N 2.93Å; Q51-K61 HydrophobicContact CG-CD 4.31Å; G59-K61 PolarHBondContact O-N 3.31Å
62	C	90.6	Very high	83	Confident	6 Å²	6	87.2 Å²	87.2	4%	0.041	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	121	170.1	-178.6	0	0	0	0	108.8	C33 I52 G53	C33-C62 VanDerWaalsContact CA-SG 3.52Å; C33-C62 HydrophobicContact CB-CB 3.9Å; C33-C62 WeakPolarHBondContact CB-SG 3.29Å; C33-C62 VanDerWaalsContact SG-CA 3.6Å; C33-C62 WeakPolarHBondContact SG-CB 3.33Å; C33-C62 CovalentContact SG-SG 2.03Å; C33-C62 PolarHBondContact SG-SG 3.16Å; I52-C62 PolarHBondContact N-O 3.32Å; G53-C62 PolarHBondContact N-O 3.32Å; G53-C62 PolarHBondContact O-N 2.8Å
63	C	91.7	Very high	82.7	Confident	0 Å²	0	89.3 Å²	89.3	0%	0	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	136.7	-173.8	-52.3	0	0	0	0	109.8	G38 R39 A41 C45 E49 E50	G38-C63 CarbonylContact C-O 3.45Å; G38-C63 WeakPolarHBondContact CA-O 3.15Å; R39-C63 HydrophobicContact CG-CB 4.18Å; R39-C63 PolarHBondContact N-O 3.46Å; R39-C63 PolarHBondContact O-N 2.92Å; A41-C63 VanDerWaalsContact CB-SG 3.57Å; C45-C63 WeakPolarHBondContact CA-SG 2.95Å; C45-C63 HydrophobicContact CB-CB 3.64Å; C45-C63 WeakPolarHBondContact CB-SG 3.46Å; C45-C63 VanDerWaalsContact SG-CA 3.55Å; C45-C63 WeakPolarHBondContact SG-CB 3.41Å; C45-C63 CovalentContact SG-SG 2.03Å; C45-C63 PolarHBondContact SG-SG 3.42Å; E49-C63 HydrophobicContact CB-CB 4.26Å; E49-C63 WeakPolarHBondContact OE2-CB 3.31Å; E50-C63 CarbonylContact O-C 3.5Å; E50-C63 VanDerWaalsContact O-CA 3.3Å; E50-C63 WeakPolarHBondContact O-CA 3.29Å
64	R	91	Very high	82.4	Confident	94 Å²	94	93.5 Å²	93.5	36%	0.355	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	142.9	175.3	-172.6	-170.9	-176.6	-171.7	7.3	109.6	E49 E50 I52 K66	E49-R64 CarbonylContact C-O 3.4Å; E49-R64 WeakPolarHBondContact CA-O 3.37Å; E49-R64 WeakPolarHBondContact CB-O 3.14Å; E50-R64 HydrophobicContact CG-CB 4.21Å; E50-R64 PolarHBondContact N-O 3Å; E50-R64 PolarHBondContact O-N 3.44Å; I52-R64 HydrophobicContact CD1-CB 3.25Å; I52-R64 HydrophobicContact CD1-CG 3.9Å; I52-R64 HydrophobicContact CG1-CB 3.9Å; R64-K66 PolarHBondContact O-N 3.44Å
65	T	88.4	Confident	82.1	Confident	87 Å²	87	92.1 Å²	92.1	53%	0.534	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.7	127.1	172.8	-40.6	0	0	0	0	109.4	K67	T65-K67 PolarHBondContact O-N 3.43Å
66	K	83.1	Confident	81.8	Confident	119 Å²	119	98.7 Å²	98.7	52%	0.517	46%	0.463	S	S	.	.	P	Polyproline II helix	trans	-61.2	128.7	173.1	-68.7	-176.4	178.7	-179	0	107.9	R48 E50 R64 K68	R48-K66 PolarHBondContact O-N 3.24Å; E50-K66 HydrophobicContact CB-CG 4.13Å; E50-K66 HydrophobicContact CG-CG 4.33Å; R64-K66 PolarHBondContact O-N 3.44Å; K66-K68 PolarHBondContact O-N 2.93Å
67	K	76	Confident	82	Confident	183 Å²	183	106.3 Å²	106.3	80%	0.796	50%	0.496	S	S	*	.	P	Polyproline II helix	trans	-65.8	126.1	167.7	-73.5	-163.5	176.1	-170.7	0	107	T65	T65-K67 PolarHBondContact O-N 3.43Å
68	K	62	Low	82.9	Confident	276 Å²	276	107.1 Å²	107.1	100%	1.2	48%	0.48	S	S	*	.			trans	-74.2	0	-179.8	-159	-176.8	-174.4	-168.9	0	110	K66	K66-K68 PolarHBondContact O-N 2.93Å

Retrieved 68 of 68 residues in 54.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).