A0A061IL37_CRIGR Loading...

Serine palmitoyltransferase small subunit B

Component of the serine palmitoyltransferase multisubunit enzyme (SPT) that catalyzes the initial and rate-limiting step in sphingolipid biosynthesis by condensing L-serine and activated acyl-CoA (most commonly palmitoyl-CoA) to form long-chain bases. The SPT complex is composed of SPTLC1, SPTLC2 or SPTLC3 and SPTSSA or SPTSSB. Within this complex, the heterodimer consisting of SPTLC1 and SPTLC2/SPTLC3 forms the catalytic core. Within the SPT complex, SPTSSB stimulates the catalytic activity and plays a role in substrate specificity. SPT complexes with this subunit showing a preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference.

AlphaFold DB , UniProt , Accession A0A061IL37, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Sptssb, Length 76 aa.

						>A0A061IL37_CRIGR|A0A061IL37|Sptssb
MDLKSVKEYFAWLYYQYQIISCCAVLEPWEQSMFNTILLTIVAMVVYTAYVFIPIHIRLAWEFFSKICGYHSSISN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.3	Low	81.6	Confident	231 Å²	231	125.3 Å²	125.3	100%	1.138	62%	0.624	S	S	*	*				0	112.4	0	-63.6	172.3	-175.1	0	0	105.8
2	D	81.3	Confident	82.4	Confident	102 Å²	102	126.8 Å²	126.8	55%	0.545	62%	0.617	S	S	.	*			trans	-66.5	133.9	-173.2	-167.6	-82.3	0	0	0	109.9	K4 S5 V6	D2-K4 PolarHBondContact O-N 2.98Å; D2-K4 WeakPolarHBondContact OD1-CA 3.47Å; D2-K4 WeakPolarHBondContact OD1-CB 3.45Å; D2-K4 PolarHBondContact OD1-N 3.19Å; D2-S5 WeakPolarHBondContact O-CB 2.9Å; D2-S5 PolarHBondContact O-N 2.9Å; D2-V6 PolarHBondContact O-N 3.06Å
3	L	77.8	Confident	82.6	Confident	147 Å²	147	122.5 Å²	122.5	77%	0.77	60%	0.598	S	S	*	*	H	α-helix	trans	-55.7	-26.6	180	-77	168.7	0	0	0	111.9	K7	L3-K7 PolarHBondContact O-N 3.49Å
4	K	80.9	Confident	82.7	Confident	148 Å²	148	121.4 Å²	121.4	64%	0.643	59%	0.586	S	S	*	*	H	α-helix	trans	-67.8	-44.4	176	-155.2	-179.6	-174.9	-161.5	0	111.5	D2 V6 K7 E8	D2-K4 PolarHBondContact O-N 2.98Å; D2-K4 WeakPolarHBondContact OD1-CA 3.47Å; D2-K4 WeakPolarHBondContact OD1-CB 3.45Å; D2-K4 PolarHBondContact OD1-N 3.19Å; K4-V6 VanDerWaalsContact C-N 3.31Å; K4-V6 PolarHBondContact O-N 2.98Å; K4-K7 WeakPolarHBondContact O-CB 3.45Å; K4-K7 PolarHBondContact O-N 3.42Å; K4-E8 WeakPolarHBondContact O-CG 3.49Å; K4-E8 PolarHBondContact O-N 3.01Å
5	S	83.4	Confident	82.7	Confident	67 Å²	67	123.3 Å²	123.3	47%	0.469	59%	0.586	S	S	.	*	H	α-helix	trans	-64.3	-36	176.2	-50	0	0	0	0	112.2	D2 E8 Y9	D2-S5 WeakPolarHBondContact O-CB 2.9Å; D2-S5 PolarHBondContact O-N 2.9Å; S5-E8 PolarHBondContact O-N 3.49Å; S5-Y9 WeakPolarHBondContact O-CB 3.43Å; S5-Y9 PolarHBondContact O-N 3.26Å
6	V	86.5	Confident	82.8	Confident	58 Å²	58	120.8 Å²	120.8	35%	0.352	57%	0.573	S	S	.	*	H	α-helix	trans	-67.2	-43.6	176.2	-177.8	0	0	0	0	110.6	D2 K4 E8 Y9 F10	D2-V6 PolarHBondContact O-N 3.06Å; K4-V6 VanDerWaalsContact C-N 3.31Å; K4-V6 PolarHBondContact O-N 2.98Å; V6-E8 PolarHBondContact O-N 3.45Å; V6-Y9 WeakPolarHBondContact O-CB 3.45Å; V6-Y9 PolarHBondContact O-N 3.38Å; V6-F10 HydrophobicContact CG1-CD2 3.79Å; V6-F10 HydrophobicContact CG1-CE2 3.72Å; V6-F10 VanDerWaalsContact O-CD2 3.31Å; V6-F10 WeakPolarHBondContact O-CD2 3.4Å; V6-F10 PolarHBondContact O-N 3.06Å
7	K	85.2	Confident	82.9	Confident	165 Å²	165	116.9 Å²	116.9	72%	0.717	55%	0.552	S	S	*	*	H	α-helix	trans	-59.2	-45.5	174.3	-95.8	-174.8	161.7	-174.8	0	112.5	L3 K4 Y9 F10 A11	L3-K7 PolarHBondContact O-N 3.49Å; K4-K7 WeakPolarHBondContact O-CB 3.45Å; K4-K7 PolarHBondContact O-N 3.42Å; K7-Y9 VanDerWaalsContact C-N 3.29Å; K7-Y9 PolarHBondContact O-N 2.97Å; K7-F10 PolarHBondContact O-N 2.93Å; K7-A11 WeakPolarHBondContact O-CB 3.5Å; K7-A11 PolarHBondContact O-N 3.31Å
8	E	88.6	Confident	82.7	Confident	125 Å²	125	112.5 Å²	112.5	58%	0.584	53%	0.531	S	S	*	.	H	α-helix	trans	-62.1	-39.3	177.5	-72.6	178.1	147.4	0	0	111.4	K4 S5 V6 A11 W12	K4-E8 WeakPolarHBondContact O-CG 3.49Å; K4-E8 PolarHBondContact O-N 3.01Å; S5-E8 PolarHBondContact O-N 3.49Å; V6-E8 PolarHBondContact O-N 3.45Å; E8-A11 PolarHBondContact O-N 3.26Å; E8-W12 WeakPolarHBondContact O-CB 3.31Å; E8-W12 PolarHBondContact O-N 2.92Å
9	Y	87.3	Confident	82.7	Confident	137 Å²	137	111.8 Å²	111.8	54%	0.537	53%	0.53	S	S	.	.	H	α-helix	trans	-64.3	-44	175.1	-174.3	-101.9	0	0	0	112.8	S5 V6 K7 W12 L13	S5-Y9 WeakPolarHBondContact O-CB 3.43Å; S5-Y9 PolarHBondContact O-N 3.26Å; V6-Y9 WeakPolarHBondContact O-CB 3.45Å; V6-Y9 PolarHBondContact O-N 3.38Å; K7-Y9 VanDerWaalsContact C-N 3.29Å; K7-Y9 PolarHBondContact O-N 2.97Å; Y9-W12 HydrophobicContact CE2-CE3 4.38Å; Y9-W12 WeakPolarHBondContact O-CB 3.42Å; Y9-W12 PolarHBondContact O-N 2.92Å; Y9-L13 HydrophobicContact CD1-CD1 4.36Å; Y9-L13 HydrophobicContact CE1-CD1 3.71Å; Y9-L13 HydrophobicContact CE2-CD1 4.18Å; Y9-L13 PolarHBondContact O-N 2.96Å
10	F	85	Confident	82.6	Confident	136 Å²	136	112.7 Å²	112.7	60%	0.596	54%	0.537	S	S	*	.	H	α-helix	trans	-64.4	-39.5	175.2	-88.3	-76.2	0	0	0	112.5	V6 K7 W12 L13 Y14	V6-F10 HydrophobicContact CG1-CD2 3.79Å; V6-F10 HydrophobicContact CG1-CE2 3.72Å; V6-F10 VanDerWaalsContact O-CD2 3.31Å; V6-F10 WeakPolarHBondContact O-CD2 3.4Å; V6-F10 PolarHBondContact O-N 3.06Å; K7-F10 PolarHBondContact O-N 2.93Å; F10-W12 VanDerWaalsContact C-N 3.31Å; F10-W12 PolarHBondContact O-N 3.5Å; F10-L13 PolarHBondContact O-N 3.23Å; F10-Y14 WeakPolarHBondContact O-CB 3.5Å; F10-Y14 PolarHBondContact O-N 3.37Å
11	A	85.4	Confident	82.3	Confident	62 Å²	62	109.5 Å²	109.5	51%	0.512	53%	0.526	S	S	.	.	H	α-helix	trans	-62.9	-40.6	175.1	0	0	0	0	0	111.3	K7 E8 Y14 Y15	K7-A11 WeakPolarHBondContact O-CB 3.5Å; K7-A11 PolarHBondContact O-N 3.31Å; E8-A11 PolarHBondContact O-N 3.26Å; A11-Y14 PolarHBondContact O-N 3Å; A11-Y15 PolarHBondContact O-N 2.97Å
12	W	91.2	Very high	83.2	Confident	144 Å²	144	102 Å²	102	55%	0.545	50%	0.496	S	S	.	.	H	α-helix	trans	-64.2	-44.9	175.2	-177.3	82.7	0	0	0	112.3	E8 Y9 F10 Y14 Y15 Q16	E8-W12 WeakPolarHBondContact O-CB 3.31Å; E8-W12 PolarHBondContact O-N 2.92Å; Y9-W12 HydrophobicContact CE2-CE3 4.38Å; Y9-W12 WeakPolarHBondContact O-CB 3.42Å; Y9-W12 PolarHBondContact O-N 2.92Å; F10-W12 VanDerWaalsContact C-N 3.31Å; F10-W12 PolarHBondContact O-N 3.5Å; W12-Y14 VanDerWaalsContact C-N 3.32Å; W12-Y14 PolarHBondContact O-N 3.41Å; W12-Y15 WeakPolarHBondContact O-CB 3.42Å; W12-Y15 PolarHBondContact O-N 3.06Å; W12-Q16 PolarHBondContact O-N 3.29Å
13	L	85.3	Confident	82.9	Confident	70 Å²	70	97.2 Å²	97.2	37%	0.366	47%	0.471	S	S	.	.	H	α-helix	trans	-59.7	-42.9	175.6	-123.2	76.3	0	0	0	112	Y9 F10 Y15 Q16 Y17	Y9-L13 HydrophobicContact CD1-CD1 4.36Å; Y9-L13 HydrophobicContact CE1-CD1 3.71Å; Y9-L13 HydrophobicContact CE2-CD1 4.18Å; Y9-L13 PolarHBondContact O-N 2.96Å; F10-L13 PolarHBondContact O-N 3.23Å; L13-Y15 VanDerWaalsContact C-N 3.34Å; L13-Q16 PolarHBondContact O-N 3.27Å; L13-Y17 WeakPolarHBondContact O-CB 3.44Å; L13-Y17 PolarHBondContact O-N 3.32Å
14	Y	83.9	Confident	82.6	Confident	108 Å²	108	93.1 Å²	93.1	42%	0.424	46%	0.458	S	S	.	.	H	α-helix	trans	-64.2	-40.7	178.2	-178.6	-106	0	0	0	111.8	F10 A11 W12 Q16 Y17 Q18	F10-Y14 WeakPolarHBondContact O-CB 3.5Å; F10-Y14 PolarHBondContact O-N 3.37Å; A11-Y14 PolarHBondContact O-N 3Å; W12-Y14 VanDerWaalsContact C-N 3.32Å; W12-Y14 PolarHBondContact O-N 3.41Å; Y14-Q16 VanDerWaalsContact C-N 3.34Å; Y14-Y17 HydrophobicContact CD2-CD1 4.31Å; Y14-Y17 HydrophobicContact CE2-CD1 4.3Å; Y14-Y17 PolarHBondContact O-N 3.04Å; Y14-Q18 HydrophobicContact CE1-CG 4.15Å; Y14-Q18 VanDerWaalsContact CZ-NE2 3.3Å; Y14-Q18 PolarHBondContact O-N 3.42Å; Y14-Q18 PolarHBondContact OH-NE2 3.29Å
15	Y	82.6	Confident	82.5	Confident	150 Å²	150	91.9 Å²	91.9	59%	0.588	46%	0.463	S	S	*	.	H	α-helix	trans	-61	-45.3	174.1	-166.4	-95.4	0	0	0	111.2	A11 W12 L13 Y17 Q18 I19	A11-Y15 PolarHBondContact O-N 2.97Å; W12-Y15 WeakPolarHBondContact O-CB 3.42Å; W12-Y15 PolarHBondContact O-N 3.06Å; L13-Y15 VanDerWaalsContact C-N 3.34Å; Y15-Y17 VanDerWaalsContact C-N 3.33Å; Y15-Y17 PolarHBondContact O-N 2.97Å; Y15-Q18 PolarHBondContact O-N 3.44Å; Y15-I19 HydrophobicContact CD1-CG1 4.1Å; Y15-I19 HydrophobicContact CE1-CD1 4.05Å; Y15-I19 HydrophobicContact CE1-CG1 3.91Å; Y15-I19 VanDerWaalsContact O-CG1 3.29Å; Y15-I19 WeakPolarHBondContact O-CG1 3.45Å; Y15-I19 PolarHBondContact O-N 3.33Å; Y15-I19 VanDerWaalsContact O-N 3.11Å
16	Q	84.3	Confident	82.1	Confident	82 Å²	82	91.8 Å²	91.8	38%	0.383	46%	0.456	S	S	.	.	H	α-helix	trans	-62.5	-41.1	178.4	-152.4	-179.1	1.3	0	0	112	W12 L13 Y14 I19 I20	W12-Q16 PolarHBondContact O-N 3.29Å; L13-Q16 PolarHBondContact O-N 3.27Å; Y14-Q16 VanDerWaalsContact C-N 3.34Å; Q16-I19 PolarHBondContact O-N 3.11Å; Q16-I20 HydrophobicContact CG-CD1 3.91Å; Q16-I20 WeakPolarHBondContact O-CB 3.5Å; Q16-I20 WeakPolarHBondContact O-CD1 3.22Å; Q16-I20 WeakPolarHBondContact O-CG1 3.29Å; Q16-I20 PolarHBondContact O-N 3.37Å
17	Y	83.8	Confident	81.8	Confident	55 Å²	55	94.8 Å²	94.8	22%	0.216	47%	0.467	C	S	.	.	H	α-helix	trans	-59.8	-46.1	173.3	162.7	-99.8	0	0	0	112.4	L13 Y14 Y15 I19 I20 S21 L38	L13-Y17 WeakPolarHBondContact O-CB 3.44Å; L13-Y17 PolarHBondContact O-N 3.32Å; Y14-Y17 HydrophobicContact CD2-CD1 4.31Å; Y14-Y17 HydrophobicContact CE2-CD1 4.3Å; Y14-Y17 PolarHBondContact O-N 3.04Å; Y15-Y17 VanDerWaalsContact C-N 3.33Å; Y15-Y17 PolarHBondContact O-N 2.97Å; Y17-I19 VanDerWaalsContact C-N 3.28Å; Y17-I19 PolarHBondContact O-N 3.34Å; Y17-I20 PolarHBondContact O-N 2.99Å; Y17-S21 PolarHBondContact O-N 3.03Å; Y17-L38 HydrophobicContact CE2-CD1 3.46Å; Y17-L38 VanDerWaalsContact CE2-CD1 3.46Å; Y17-L38 WeakPolarHBondContact OH-CD1 3.44Å
18	Q	79.6	Confident	81.5	Confident	38 Å²	38	92 Å²	92	18%	0.178	47%	0.466	C	S	.	.	H	α-helix	trans	-58.9	-39.7	177.3	-80.4	-172.3	-7.1	0	0	112.4	Y14 Y15 C22 C23 A24	Y14-Q18 HydrophobicContact CE1-CG 4.15Å; Y14-Q18 VanDerWaalsContact CZ-NE2 3.3Å; Y14-Q18 PolarHBondContact O-N 3.42Å; Y14-Q18 PolarHBondContact OH-NE2 3.29Å; Y15-Q18 PolarHBondContact O-N 3.44Å; Q18-C22 CarbonylContact O-C 3.54Å; Q18-C22 PolarHBondContact O-N 2.93Å; Q18-C23 PolarHBondContact O-N 3.35Å; Q18-A24 HydrophobicContact CB-CB 4.43Å; Q18-A24 PolarHBondContact O-N 3.42Å
19	I	82.6	Confident	81.2	Confident	99 Å²	99	93.7 Å²	93.7	51%	0.508	47%	0.466	S	S	.	.	H	α-helix	trans	-72.4	-46.4	179.2	-57.5	-75	0	0	0	110.8	Y15 Q16 Y17 S21 C22	Y15-I19 HydrophobicContact CD1-CG1 4.1Å; Y15-I19 HydrophobicContact CE1-CD1 4.05Å; Y15-I19 HydrophobicContact CE1-CG1 3.91Å; Y15-I19 VanDerWaalsContact O-CG1 3.29Å; Y15-I19 WeakPolarHBondContact O-CG1 3.45Å; Y15-I19 PolarHBondContact O-N 3.33Å; Y15-I19 VanDerWaalsContact O-N 3.11Å; Q16-I19 PolarHBondContact O-N 3.11Å; Y17-I19 VanDerWaalsContact C-N 3.28Å; Y17-I19 PolarHBondContact O-N 3.34Å; I19-S21 PolarHBondContact O-N 2.91Å; I19-C22 PolarHBondContact O-N 3.22Å; I19-C22 VanDerWaalsContact O-N 3.14Å
20	I	81	Confident	80.9	Confident	129 Å²	129	90.8 Å²	90.8	66%	0.662	46%	0.458	S	S	*	.	H	α-helix	trans	-64.1	-41.4	-177.4	-69.9	164.2	0	0	0	111.8	Q16 Y17 C22	Q16-I20 HydrophobicContact CG-CD1 3.91Å; Q16-I20 WeakPolarHBondContact O-CB 3.5Å; Q16-I20 WeakPolarHBondContact O-CD1 3.22Å; Q16-I20 WeakPolarHBondContact O-CG1 3.29Å; Q16-I20 PolarHBondContact O-N 3.37Å; Y17-I20 PolarHBondContact O-N 2.99Å; I20-C22 PolarHBondContact O-N 3.39Å
21	S	77	Confident	80.8	Confident	46 Å²	46	86.6 Å²	86.6	32%	0.322	44%	0.44	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84	4.9	178.4	-62.2	0	0	0	0	113.3	Y17 I19 C23	Y17-S21 PolarHBondContact O-N 3.03Å; I19-S21 PolarHBondContact O-N 2.91Å; S21-C23 PolarHBondContact O-N 3.41Å
22	C	75	Confident	80.5	Confident	74 Å²	74	86.7 Å²	86.7	50%	0.5	44%	0.437	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.1	17.8	-171.8	-158.8	0	0	0	0	113.6	Q18 I19 I20 A24 V25 L26	Q18-C22 CarbonylContact O-C 3.54Å; Q18-C22 PolarHBondContact O-N 2.93Å; I19-C22 PolarHBondContact O-N 3.22Å; I19-C22 VanDerWaalsContact O-N 3.14Å; I20-C22 PolarHBondContact O-N 3.39Å; C22-A24 PolarHBondContact O-N 2.91Å; C22-A24 VanDerWaalsContact O-N 3.16Å; C22-V25 PolarHBondContact O-N 3.01Å; C22-V25 VanDerWaalsContact O-N 3.17Å; C22-L26 WeakPolarHBondContact O-CD1 3.17Å
23	C	75.3	Confident	80.3	Confident	2 Å²	2	84.2 Å²	84.2	1%	0.014	43%	0.433	C	S	.	.	G	3₁₀ helix	trans	-68.7	-19.9	-171.3	-147.9	0	0	0	0	111.9	Q18 S21 V25 L26 Q31	Q18-C23 PolarHBondContact O-N 3.35Å; S21-C23 PolarHBondContact O-N 3.41Å; C23-V25 PolarHBondContact O-N 3.17Å; C23-L26 PolarHBondContact O-N 3.32Å; C23-Q31 VanDerWaalsContact SG-CG 3.6Å
24	A	71.6	Confident	80.2	Confident	60 Å²	60	85.3 Å²	85.3	50%	0.496	44%	0.435	S	S	.	.	G	3₁₀ helix	trans	-66.5	-18.1	175.9	0	0	0	0	0	114.4	Q18 C22	Q18-A24 HydrophobicContact CB-CB 4.43Å; Q18-A24 PolarHBondContact O-N 3.42Å; C22-A24 PolarHBondContact O-N 2.91Å; C22-A24 VanDerWaalsContact O-N 3.16Å
25	V	77.3	Confident	80.2	Confident	123 Å²	123	83.7 Å²	83.7	75%	0.745	43%	0.433	S	S	*	.	G	3₁₀ helix	trans	-98.4	-15.1	-179.2	178.7	0	0	0	0	112	C22 C23	C22-V25 PolarHBondContact O-N 3.01Å; C22-V25 VanDerWaalsContact O-N 3.17Å; C23-V25 PolarHBondContact O-N 3.17Å
26	L	76.4	Confident	80.5	Confident	64 Å²	64	79.7 Å²	79.7	34%	0.335	42%	0.424	S	S	.	.	S	Bend	trans	-78.1	156.7	-177.1	-85.5	76.2	0	0	0	111.8	C22 C23 E30	C22-L26 WeakPolarHBondContact O-CD1 3.17Å; C23-L26 PolarHBondContact O-N 3.32Å; L26-E30 HydrophobicContact CB-CB 4.2Å; L26-E30 HydrophobicContact CD2-CB 3.87Å; L26-E30 HydrophobicContact CG-CB 4.47Å
27	E	79.8	Confident	80.8	Confident	122 Å²	122	80.4 Å²	80.4	57%	0.57	43%	0.43	S	S	*	.			trans	-62.4	150.6	174.3	-73.1	-168.8	86.5	0	0	111.2	W29 E30 Q31	E27-W29 PolarHBondContact O-N 3.05Å; E27-E30 HydrophobicContact CB-CG 4.37Å; E27-E30 PolarHBondContact N-OE2 3.16Å; E27-E30 PolarHBondContact O-N 2.99Å; E27-Q31 PolarHBondContact O-N 3.4Å
28	P	77.9	Confident	81	Confident	107 Å²	107	80.3 Å²	80.3	70%	0.695	43%	0.433	S	S	*	.	H	α-helix	trans	-58	-28.5	-175.2	21.8	-34.1	0	0	0	113.3	S32	P28-S32 PolarHBondContact O-N 3.48Å
29	W	83.4	Confident	81.5	Confident	159 Å²	159	84.4 Å²	84.4	60%	0.602	46%	0.455	S	S	*	.	H	α-helix	trans	-74.3	-38.4	177.1	94.3	-88.7	0	0	0	112.3	E27 S32 M33	E27-W29 PolarHBondContact O-N 3.05Å; W29-S32 WeakPolarHBondContact O-CB 2.83Å; W29-S32 PolarHBondContact O-N 3.21Å; W29-M33 HydrophobicContact CE3-CG 3.94Å; W29-M33 HydrophobicContact CZ3-CG 3.76Å; W29-M33 HydrophobicContact CZ3-SD 4.49Å; W29-M33 PolarHBondContact O-N 3.44Å; W29-M33 VanDerWaalsContact O-N 3.14Å
30	E	80.3	Confident	82	Confident	77 Å²	77	83.2 Å²	83.2	36%	0.36	45%	0.453	S	S	.	.	H	α-helix	trans	-71.5	-39.1	178.4	-60.2	-174.9	109.4	0	0	111.3	L26 E27 S32 M33 F34	L26-E30 HydrophobicContact CB-CB 4.2Å; L26-E30 HydrophobicContact CD2-CB 3.87Å; L26-E30 HydrophobicContact CG-CB 4.47Å; E27-E30 HydrophobicContact CB-CG 4.37Å; E27-E30 PolarHBondContact N-OE2 3.16Å; E27-E30 PolarHBondContact O-N 2.99Å; E30-S32 PolarHBondContact O-N 3.5Å; E30-M33 PolarHBondContact O-N 3.39Å; E30-M33 VanDerWaalsContact O-N 3.14Å; E30-F34 PolarHBondContact O-N 3.45Å
31	Q	82.3	Confident	82.6	Confident	47 Å²	47	81.4 Å²	81.4	22%	0.22	44%	0.444	C	S	.	.	H	α-helix	trans	-58.1	-40.5	172.3	176	169.7	34.6	0	0	111.2	C23 E27 F34 N35	C23-Q31 VanDerWaalsContact SG-CG 3.6Å; E27-Q31 PolarHBondContact O-N 3.4Å; Q31-F34 PolarHBondContact O-N 2.93Å; Q31-N35 WeakPolarHBondContact O-CB 3.36Å; Q31-N35 PolarHBondContact O-N 3.02Å
32	S	80.8	Confident	83.4	Confident	65 Å²	65	83.3 Å²	83.3	46%	0.455	45%	0.453	S	S	.	.	H	α-helix	trans	-62.8	-43.9	175.2	-172.7	0	0	0	0	111.8	P28 W29 E30 N35 T36	P28-S32 PolarHBondContact O-N 3.48Å; W29-S32 WeakPolarHBondContact O-CB 2.83Å; W29-S32 PolarHBondContact O-N 3.21Å; E30-S32 PolarHBondContact O-N 3.5Å; S32-N35 PolarHBondContact O-N 2.7Å; S32-T36 WeakPolarHBondContact O-CG2 3.3Å; S32-T36 PolarHBondContact O-N 3.47Å; S32-T36 PolarHBondContact O-OG1 2.92Å
33	M	86.1	Confident	84.3	Confident	92 Å²	92	82.2 Å²	82.2	45%	0.453	45%	0.45	S	S	.	.	H	α-helix	trans	-61.6	-46.3	177.1	-71.6	-72.9	90.5	0	0	111.8	W29 E30 N35 T36 I37	W29-M33 HydrophobicContact CE3-CG 3.94Å; W29-M33 HydrophobicContact CZ3-CG 3.76Å; W29-M33 HydrophobicContact CZ3-SD 4.49Å; W29-M33 PolarHBondContact O-N 3.44Å; W29-M33 VanDerWaalsContact O-N 3.14Å; E30-M33 PolarHBondContact O-N 3.39Å; E30-M33 VanDerWaalsContact O-N 3.14Å; M33-N35 VanDerWaalsContact C-N 3.33Å; M33-N35 PolarHBondContact O-N 3.14Å; M33-T36 WeakPolarHBondContact CA-OG1 3.4Å; M33-T36 PolarHBondContact O-N 3.14Å; M33-T36 PolarHBondContact O-OG1 3.04Å; M33-I37 WeakPolarHBondContact O-CG1 3.37Å; M33-I37 PolarHBondContact O-N 3.28Å
34	F	83.4	Confident	85.2	Confident	93 Å²	93	87.6 Å²	87.6	41%	0.408	48%	0.476	S	S	.	.	H	α-helix	trans	-61.9	-42.2	-179.7	-150.3	-96.9	0	0	0	112.1	E30 Q31 T36 I37 L38	E30-F34 PolarHBondContact O-N 3.45Å; Q31-F34 PolarHBondContact O-N 2.93Å; F34-T36 PolarHBondContact O-N 3.41Å; F34-I37 PolarHBondContact O-N 3.18Å; F34-L38 HydrophobicContact CD1-CD1 3.62Å; F34-L38 HydrophobicContact CD1-CG 4.48Å; F34-L38 HydrophobicContact CE1-CD1 3.69Å; F34-L38 HydrophobicContact CE1-CG 4.45Å; F34-L38 PolarHBondContact O-N 2.89Å
35	N	84.8	Confident	86.3	Confident	74 Å²	74	88.9 Å²	88.9	40%	0.396	48%	0.477	S	S	.	.	H	α-helix	trans	-66.9	-36.9	178.6	-149.5	39.8	0	0	0	111.8	Q31 S32 M33 L38 L39	Q31-N35 WeakPolarHBondContact O-CB 3.36Å; Q31-N35 PolarHBondContact O-N 3.02Å; S32-N35 PolarHBondContact O-N 2.7Å; M33-N35 VanDerWaalsContact C-N 3.33Å; M33-N35 PolarHBondContact O-N 3.14Å; N35-L38 PolarHBondContact O-N 3.14Å; N35-L39 VanDerWaalsContact O-CB 3.3Å; N35-L39 WeakPolarHBondContact O-CB 3.3Å; N35-L39 PolarHBondContact O-N 3.35Å
36	T	88.1	Confident	87.2	Confident	65 Å²	65	87.4 Å²	87.4	40%	0.399	47%	0.468	S	S	.	.	H	α-helix	trans	-67.1	-38.5	175	54.8	0	0	0	0	113	S32 M33 F34 L39 T40	S32-T36 WeakPolarHBondContact O-CG2 3.3Å; S32-T36 PolarHBondContact O-N 3.47Å; S32-T36 PolarHBondContact O-OG1 2.92Å; M33-T36 WeakPolarHBondContact CA-OG1 3.4Å; M33-T36 PolarHBondContact O-N 3.14Å; M33-T36 PolarHBondContact O-OG1 3.04Å; F34-T36 PolarHBondContact O-N 3.41Å; T36-L39 PolarHBondContact O-N 3.42Å; T36-T40 WeakPolarHBondContact O-CB 3.46Å; T36-T40 PolarHBondContact O-N 3.44Å; T36-T40 PolarHBondContact O-OG1 3.41Å
37	I	89.6	Confident	88.1	Confident	97 Å²	97	91.3 Å²	91.3	50%	0.497	48%	0.48	S	S	.	.	H	α-helix	trans	-64.8	-47.7	175.8	-67.5	166.7	0	0	0	109.9	M33 F34 L39 T40 I41	M33-I37 WeakPolarHBondContact O-CG1 3.37Å; M33-I37 PolarHBondContact O-N 3.28Å; F34-I37 PolarHBondContact O-N 3.18Å; I37-L39 PolarHBondContact O-N 2.83Å; I37-T40 WeakPolarHBondContact O-CB 3.3Å; I37-T40 PolarHBondContact O-N 3.34Å; I37-T40 VanDerWaalsContact O-N 3.13Å; I37-I41 HydrophobicContact CG2-CD1 3.88Å; I37-I41 HydrophobicContact CG2-CG1 4.48Å; I37-I41 WeakPolarHBondContact O-CG1 3.49Å; I37-I41 PolarHBondContact O-N 2.85Å
38	L	88	Confident	88.7	Confident	54 Å²	54	88.4 Å²	88.4	28%	0.283	47%	0.47	S	S	.	.	H	α-helix	trans	-61.8	-42.5	177.4	-83.1	162.2	0	0	0	112.7	Y17 F34 N35 T40 I41 V42	Y17-L38 HydrophobicContact CE2-CD1 3.46Å; Y17-L38 VanDerWaalsContact CE2-CD1 3.46Å; Y17-L38 WeakPolarHBondContact OH-CD1 3.44Å; F34-L38 HydrophobicContact CD1-CD1 3.62Å; F34-L38 HydrophobicContact CD1-CG 4.48Å; F34-L38 HydrophobicContact CE1-CD1 3.69Å; F34-L38 HydrophobicContact CE1-CG 4.45Å; F34-L38 PolarHBondContact O-N 2.89Å; N35-L38 PolarHBondContact O-N 3.14Å; L38-T40 VanDerWaalsContact C-N 3.25Å; L38-T40 PolarHBondContact O-N 2.84Å; L38-I41 PolarHBondContact O-N 3.22Å; L38-V42 WeakPolarHBondContact O-CB 3.23Å; L38-V42 VanDerWaalsContact O-CG2 3.3Å; L38-V42 WeakPolarHBondContact O-CG2 3.22Å; L38-V42 PolarHBondContact O-N 2.87Å
39	L	90.9	Very high	89.4	Confident	123 Å²	123	85.3 Å²	85.3	64%	0.644	45%	0.453	S	S	*	.	H	α-helix	trans	-61.3	-38.2	175.4	-174.1	136	0	0	0	111.3	N35 T36 I37 A43	N35-L39 VanDerWaalsContact O-CB 3.3Å; N35-L39 WeakPolarHBondContact O-CB 3.3Å; N35-L39 PolarHBondContact O-N 3.35Å; T36-L39 PolarHBondContact O-N 3.42Å; I37-L39 PolarHBondContact O-N 2.83Å; L39-A43 VanDerWaalsContact O-CB 3.22Å; L39-A43 WeakPolarHBondContact O-CB 3.41Å; L39-A43 PolarHBondContact O-N 3.38Å
40	T	92.9	Very high	89.8	Confident	75 Å²	75	86 Å²	86	46%	0.46	46%	0.457	S	S	.	.	H	α-helix	trans	-66	-43.6	175.4	-54.8	0	0	0	0	111.7	T36 I37 L38 A43 M44	T36-T40 WeakPolarHBondContact O-CB 3.46Å; T36-T40 PolarHBondContact O-N 3.44Å; T36-T40 PolarHBondContact O-OG1 3.41Å; I37-T40 WeakPolarHBondContact O-CB 3.3Å; I37-T40 PolarHBondContact O-N 3.34Å; I37-T40 VanDerWaalsContact O-N 3.13Å; L38-T40 VanDerWaalsContact C-N 3.25Å; L38-T40 PolarHBondContact O-N 2.84Å; T40-A43 PolarHBondContact O-N 3.13Å; T40-M44 WeakPolarHBondContact O-CG 3.49Å; T40-M44 PolarHBondContact O-N 3Å
41	I	92.8	Very high	90.4	Very high	90 Å²	90	85.7 Å²	85.7	46%	0.462	46%	0.46	S	S	.	.	H	α-helix	trans	-61.5	-48.7	176.4	-66.8	164.7	0	0	0	110.1	I37 L38 A43 M44 V45	I37-I41 HydrophobicContact CG2-CD1 3.88Å; I37-I41 HydrophobicContact CG2-CG1 4.48Å; I37-I41 WeakPolarHBondContact O-CG1 3.49Å; I37-I41 PolarHBondContact O-N 2.85Å; L38-I41 PolarHBondContact O-N 3.22Å; I41-A43 VanDerWaalsContact C-N 3.33Å; I41-A43 PolarHBondContact O-N 2.97Å; I41-M44 PolarHBondContact O-N 3.34Å; I41-V45 HydrophobicContact CG2-CG2 4.48Å; I41-V45 WeakPolarHBondContact O-CG2 3.45Å; I41-V45 PolarHBondContact O-N 3.08Å
42	V	93.8	Very high	90.7	Very high	87 Å²	87	88.9 Å²	88.9	53%	0.527	47%	0.474	S	S	.	.	H	α-helix	trans	-60.8	-44.1	177.8	172.2	0	0	0	0	110.5	L38 M44 V45 V46	L38-V42 WeakPolarHBondContact O-CB 3.23Å; L38-V42 VanDerWaalsContact O-CG2 3.3Å; L38-V42 WeakPolarHBondContact O-CG2 3.22Å; L38-V42 PolarHBondContact O-N 2.87Å; V42-M44 VanDerWaalsContact C-N 3.31Å; V42-M44 PolarHBondContact O-N 2.76Å; V42-V45 PolarHBondContact O-N 3.23Å; V42-V46 HydrophobicContact CG1-CG2 4.29Å; V42-V46 WeakPolarHBondContact O-CB 3.25Å; V42-V46 VanDerWaalsContact O-CG2 3.3Å; V42-V46 WeakPolarHBondContact O-CG2 3.04Å; V42-V46 PolarHBondContact O-N 2.89Å
43	A	94.5	Very high	91.2	Very high	51 Å²	51	90.1 Å²	90.1	42%	0.421	47%	0.474	S	S	.	.	H	α-helix	trans	-59.8	-41.9	176.1	0	0	0	0	0	111.8	L39 T40 I41 V46 Y47	L39-A43 VanDerWaalsContact O-CB 3.22Å; L39-A43 WeakPolarHBondContact O-CB 3.41Å; L39-A43 PolarHBondContact O-N 3.38Å; T40-A43 PolarHBondContact O-N 3.13Å; I41-A43 VanDerWaalsContact C-N 3.33Å; I41-A43 PolarHBondContact O-N 2.97Å; A43-V46 PolarHBondContact O-N 3.45Å; A43-Y47 VanDerWaalsContact O-CB 3.23Å; A43-Y47 WeakPolarHBondContact O-CB 3.35Å; A43-Y47 PolarHBondContact O-N 3.48Å
44	M	94.4	Very high	91.2	Very high	115 Å²	115	88.8 Å²	88.8	57%	0.567	47%	0.473	S	S	*	.	H	α-helix	trans	-65.7	-41.4	175.6	-74.7	-58.8	160.7	0	0	112.3	T40 I41 V42 Y47 T48	T40-M44 WeakPolarHBondContact O-CG 3.49Å; T40-M44 PolarHBondContact O-N 3Å; I41-M44 PolarHBondContact O-N 3.34Å; V42-M44 VanDerWaalsContact C-N 3.31Å; V42-M44 PolarHBondContact O-N 2.76Å; M44-Y47 PolarHBondContact O-N 3.33Å; M44-T48 WeakPolarHBondContact O-CG2 3.4Å; M44-T48 PolarHBondContact O-N 3.31Å; M44-T48 PolarHBondContact O-OG1 3.38Å
45	V	95.7	Very high	91.4	Very high	87 Å²	87	89.5 Å²	89.5	53%	0.527	48%	0.48	S	S	.	.	H	α-helix	trans	-64	-42.5	175.7	172.6	0	0	0	0	111.4	I41 V42 Y47 T48 A49	I41-V45 HydrophobicContact CG2-CG2 4.48Å; I41-V45 WeakPolarHBondContact O-CG2 3.45Å; I41-V45 PolarHBondContact O-N 3.08Å; V42-V45 PolarHBondContact O-N 3.23Å; V45-Y47 VanDerWaalsContact C-N 3.35Å; V45-T48 PolarHBondContact O-N 2.82Å; V45-T48 PolarHBondContact O-OG1 2.96Å; V45-A49 VanDerWaalsContact O-CB 3.26Å; V45-A49 WeakPolarHBondContact O-CB 3.26Å; V45-A49 PolarHBondContact O-N 2.8Å
46	V	95.8	Very high	91.5	Very high	91 Å²	91	91.5 Å²	91.5	55%	0.552	49%	0.486	S	S	*	.	H	α-helix	trans	-66.4	-40.5	176.7	172.1	0	0	0	0	110.6	V42 A43 A49 Y50	V42-V46 HydrophobicContact CG1-CG2 4.29Å; V42-V46 WeakPolarHBondContact O-CB 3.25Å; V42-V46 VanDerWaalsContact O-CG2 3.3Å; V42-V46 WeakPolarHBondContact O-CG2 3.04Å; V42-V46 PolarHBondContact O-N 2.89Å; A43-V46 PolarHBondContact O-N 3.45Å; V46-A49 PolarHBondContact O-N 3.23Å; V46-Y50 VanDerWaalsContact O-CB 3.3Å; V46-Y50 WeakPolarHBondContact O-CB 3.36Å; V46-Y50 PolarHBondContact O-N 3.48Å
47	Y	94.6	Very high	91.6	Very high	147 Å²	147	93.5 Å²	93.5	58%	0.576	49%	0.493	S	S	*	.	H	α-helix	trans	-62.1	-48.1	176.3	174.6	-101.3	0	0	0	111.5	A43 M44 V45 Y50 V51	A43-Y47 VanDerWaalsContact O-CB 3.23Å; A43-Y47 WeakPolarHBondContact O-CB 3.35Å; A43-Y47 PolarHBondContact O-N 3.48Å; M44-Y47 PolarHBondContact O-N 3.33Å; V45-Y47 VanDerWaalsContact C-N 3.35Å; Y47-Y50 PolarHBondContact O-N 2.87Å; Y47-V51 HydrophobicContact CD2-CG2 4.47Å; Y47-V51 HydrophobicContact CE1-CG2 4.15Å; Y47-V51 HydrophobicContact CE2-CG2 4.06Å; Y47-V51 WeakPolarHBondContact O-CG2 3.31Å; Y47-V51 PolarHBondContact O-N 2.95Å
48	T	92.6	Very high	91.5	Very high	61 Å²	61	98 Å²	98	37%	0.374	50%	0.504	S	S	.	.	H	α-helix	trans	-62.9	-47.3	176.6	57.1	0	0	0	0	110.6	M44 V45 Y50 V51 F52	M44-T48 WeakPolarHBondContact O-CG2 3.4Å; M44-T48 PolarHBondContact O-N 3.31Å; M44-T48 PolarHBondContact O-OG1 3.38Å; V45-T48 PolarHBondContact O-N 2.82Å; V45-T48 PolarHBondContact O-OG1 2.96Å; T48-Y50 VanDerWaalsContact C-N 3.31Å; T48-Y50 PolarHBondContact O-N 3.35Å; T48-V51 PolarHBondContact O-N 2.89Å; T48-V51 VanDerWaalsContact O-N 3.08Å; T48-F52 HydrophobicContact CG2-CE2 4.49Å; T48-F52 WeakPolarHBondContact O-CB 3.4Å; T48-F52 WeakPolarHBondContact O-CD2 3.37Å; T48-F52 PolarHBondContact O-N 3.42Å
49	A	92.6	Very high	91.4	Very high	41 Å²	41	99.9 Å²	99.9	34%	0.339	51%	0.514	S	S	.	.	H	α-helix	trans	-54.8	-47	175.7	0	0	0	0	0	111.5	V45 V46 V51 F52 I53	V45-A49 VanDerWaalsContact O-CB 3.26Å; V45-A49 WeakPolarHBondContact O-CB 3.26Å; V45-A49 PolarHBondContact O-N 2.8Å; V46-A49 PolarHBondContact O-N 3.23Å; A49-V51 VanDerWaalsContact C-N 3.32Å; A49-V51 PolarHBondContact O-N 3.22Å; A49-F52 PolarHBondContact O-N 3.43Å; A49-I53 HydrophobicContact CB-CD1 4.27Å; A49-I53 VanDerWaalsContact O-CB 3.31Å; A49-I53 WeakPolarHBondContact O-CB 3.3Å; A49-I53 VanDerWaalsContact O-CD1 3.25Å; A49-I53 WeakPolarHBondContact O-CD1 3.37Å; A49-I53 WeakPolarHBondContact O-CG1 3.32Å; A49-I53 PolarHBondContact O-N 2.88Å
50	Y	92.8	Very high	91.3	Very high	174 Å²	174	96.9 Å²	96.9	68%	0.682	51%	0.507	S	S	*	.	H	α-helix	trans	-60.9	-38.5	177.4	178.7	-98.1	0	0	0	112.8	V46 Y47 T48 P54	V46-Y50 VanDerWaalsContact O-CB 3.3Å; V46-Y50 WeakPolarHBondContact O-CB 3.36Å; V46-Y50 PolarHBondContact O-N 3.48Å; Y47-Y50 PolarHBondContact O-N 2.87Å; T48-Y50 VanDerWaalsContact C-N 3.31Å; T48-Y50 PolarHBondContact O-N 3.35Å; Y50-P54 WeakPolarHBondContact O-CD 3.34Å
51	V	92.8	Very high	91.1	Very high	70 Å²	70	102.5 Å²	102.5	42%	0.424	52%	0.52	S	S	.	.	H	α-helix	trans	-70.9	-37.8	176.8	171	0	0	0	0	111.7	Y47 T48 A49 P54	Y47-V51 HydrophobicContact CD2-CG2 4.47Å; Y47-V51 HydrophobicContact CE1-CG2 4.15Å; Y47-V51 HydrophobicContact CE2-CG2 4.06Å; Y47-V51 WeakPolarHBondContact O-CG2 3.31Å; Y47-V51 PolarHBondContact O-N 2.95Å; T48-V51 PolarHBondContact O-N 2.89Å; T48-V51 VanDerWaalsContact O-N 3.08Å; A49-V51 VanDerWaalsContact C-N 3.32Å; A49-V51 PolarHBondContact O-N 3.22Å; V51-P54 WeakPolarHBondContact O-CD 3.11Å; V51-P54 WeakPolarHBondContact O-CG 3.29Å
52	F	86.9	Confident	90.7	Very high	115 Å²	115	103.9 Å²	103.9	50%	0.504	52%	0.524	S	S	.	.	H	α-helix	trans	-80.5	-37.1	-178.3	-73.4	-68.4	0	0	0	113	T48 A49 I55 H56	T48-F52 HydrophobicContact CG2-CE2 4.49Å; T48-F52 WeakPolarHBondContact O-CB 3.4Å; T48-F52 WeakPolarHBondContact O-CD2 3.37Å; T48-F52 PolarHBondContact O-N 3.42Å; A49-F52 PolarHBondContact O-N 3.43Å; F52-I55 VanDerWaalsContact O-CG2 3.24Å; F52-I55 WeakPolarHBondContact O-CG2 2.88Å; F52-I55 PolarHBondContact O-N 2.9Å; F52-I55 VanDerWaalsContact O-N 3.13Å; F52-H56 PolarHBondContact O-CD2 3.2Å; F52-H56 PolarHBondContact O-N 3.43Å; F52-H56 VanDerWaalsContact O-N 3.16Å
53	I	91	Very high	90.4	Very high	90 Å²	90	106.1 Å²	106.1	46%	0.462	53%	0.527	S	S	.	.	H	α-helix	trans	-50.7	-47.7	-179.7	-74.3	161.1	0	0	0	114.2	A49 I55 H56 I57	A49-I53 HydrophobicContact CB-CD1 4.27Å; A49-I53 VanDerWaalsContact O-CB 3.31Å; A49-I53 WeakPolarHBondContact O-CB 3.3Å; A49-I53 VanDerWaalsContact O-CD1 3.25Å; A49-I53 WeakPolarHBondContact O-CD1 3.37Å; A49-I53 WeakPolarHBondContact O-CG1 3.32Å; A49-I53 PolarHBondContact O-N 2.88Å; I53-I55 VanDerWaalsContact C-N 3.32Å; I53-I55 PolarHBondContact O-N 3.09Å; I53-H56 PolarHBondContact O-N 2.93Å; I53-I57 HydrophobicContact CG2-CD1 3.47Å; I53-I57 VanDerWaalsContact CG2-CD1 3.47Å; I53-I57 HydrophobicContact CG2-CG1 4.25Å; I53-I57 WeakPolarHBondContact O-CG1 3.24Å; I53-I57 PolarHBondContact O-N 3.16Å
54	P	86.3	Confident	89.8	Confident	65 Å²	65	110.5 Å²	110.5	42%	0.422	54%	0.537	S	S	.	.	H	α-helix	trans	-66	-32.6	-178.7	24.8	-34.2	0	0	0	112.6	Y50 V51 R58	Y50-P54 WeakPolarHBondContact O-CD 3.34Å; V51-P54 WeakPolarHBondContact O-CD 3.11Å; V51-P54 WeakPolarHBondContact O-CG 3.29Å; P54-R58 WeakPolarHBondContact O-CG 2.99Å; P54-R58 PolarHBondContact O-N 3.13Å; P54-R58 VanDerWaalsContact O-N 3.09Å
55	I	87.6	Confident	89.3	Confident	108 Å²	108	108.4 Å²	108.4	55%	0.554	53%	0.534	S	S	*	.	H	α-helix	trans	-66	-42.8	175.1	-145.2	79.5	0	0	0	110.2	F52 I53 R58 L59	F52-I55 VanDerWaalsContact O-CG2 3.24Å; F52-I55 WeakPolarHBondContact O-CG2 2.88Å; F52-I55 PolarHBondContact O-N 2.9Å; F52-I55 VanDerWaalsContact O-N 3.13Å; I53-I55 VanDerWaalsContact C-N 3.32Å; I53-I55 PolarHBondContact O-N 3.09Å; I55-R58 PolarHBondContact O-N 2.85Å; I55-L59 PolarHBondContact O-N 2.91Å; I55-L59 VanDerWaalsContact O-N 3.08Å
56	H	87.8	Confident	88.5	Confident	115 Å²	115	111.3 Å²	111.3	53%	0.532	54%	0.539	S	S	.	.	H	α-helix	trans	-68.5	-38.4	-179.7	-68.4	-59.7	0	0	0	112.1	F52 I53 L59 A60	F52-H56 PolarHBondContact O-CD2 3.2Å; F52-H56 PolarHBondContact O-N 3.43Å; F52-H56 VanDerWaalsContact O-N 3.16Å; I53-H56 PolarHBondContact O-N 2.93Å; H56-L59 PolarHBondContact O-N 2.88Å; H56-A60 VanDerWaalsContact O-CB 3.26Å; H56-A60 WeakPolarHBondContact O-CB 3.5Å; H56-A60 PolarHBondContact O-N 3.43Å
57	I	89.6	Confident	87.9	Confident	107 Å²	107	112.5 Å²	112.5	55%	0.549	54%	0.541	S	S	.	.	H	α-helix	trans	-64.1	-43.9	175.9	-71.7	166.7	0	0	0	111.1	I53 A60 W61	I53-I57 HydrophobicContact CG2-CD1 3.47Å; I53-I57 VanDerWaalsContact CG2-CD1 3.47Å; I53-I57 HydrophobicContact CG2-CG1 4.25Å; I53-I57 WeakPolarHBondContact O-CG1 3.24Å; I53-I57 PolarHBondContact O-N 3.16Å; I57-A60 PolarHBondContact O-N 3.37Å; I57-W61 VanDerWaalsContact O-CB 3.29Å; I57-W61 WeakPolarHBondContact O-CB 3.28Å; I57-W61 PolarHBondContact O-N 3.03Å
58	R	87.6	Confident	86.8	Confident	192 Å²	192	108.7 Å²	108.7	73%	0.725	54%	0.535	S	S	*	.	H	α-helix	trans	-59.6	-48	176.8	-69.1	-96.5	-175	-163.5	-1.1	111	P54 I55 W61 E62	P54-R58 WeakPolarHBondContact O-CG 2.99Å; P54-R58 PolarHBondContact O-N 3.13Å; P54-R58 VanDerWaalsContact O-N 3.09Å; I55-R58 PolarHBondContact O-N 2.85Å; R58-W61 PolarHBondContact O-N 3.47Å; R58-E62 WeakPolarHBondContact O-CG 3.5Å; R58-E62 PolarHBondContact O-N 2.84Å
59	L	87.4	Confident	85.4	Confident	94 Å²	94	107.7 Å²	107.7	49%	0.492	54%	0.537	S	S	.	.	H	α-helix	trans	-63.3	-46.7	179.4	-135.7	79.3	0	0	0	111.5	I55 H56 W61 E62 F63	I55-L59 PolarHBondContact O-N 2.91Å; I55-L59 VanDerWaalsContact O-N 3.08Å; H56-L59 PolarHBondContact O-N 2.88Å; L59-W61 VanDerWaalsContact C-N 3.29Å; L59-W61 PolarHBondContact O-N 3.28Å; L59-E62 PolarHBondContact O-N 2.86Å; L59-F63 HydrophobicContact CD2-CE2 4.41Å; L59-F63 HydrophobicContact CG-CD2 4.42Å; L59-F63 HydrophobicContact CG-CE2 4.42Å; L59-F63 WeakPolarHBondContact O-CD2 3.24Å; L59-F63 PolarHBondContact O-N 3.38Å
60	A	88.4	Confident	83.8	Confident	60 Å²	60	113.9 Å²	113.9	50%	0.496	55%	0.553	S	S	.	*	H	α-helix	trans	-59.8	-40.8	177.6	0	0	0	0	0	111.6	H56 I57 F64	H56-A60 VanDerWaalsContact O-CB 3.26Å; H56-A60 WeakPolarHBondContact O-CB 3.5Å; H56-A60 PolarHBondContact O-N 3.43Å; I57-A60 PolarHBondContact O-N 3.37Å; A60-F64 VanDerWaalsContact O-CB 3.28Å; A60-F64 WeakPolarHBondContact O-CB 3.26Å; A60-F64 PolarHBondContact O-N 2.87Å
61	W	87.4	Confident	82	Confident	193 Å²	193	112.6 Å²	112.6	73%	0.731	55%	0.553	S	S	*	*	H	α-helix	trans	-63.8	-46.1	175.9	-174.2	-90.8	0	0	0	112.5	I57 R58 L59 F64 S65	I57-W61 VanDerWaalsContact O-CB 3.29Å; I57-W61 WeakPolarHBondContact O-CB 3.28Å; I57-W61 PolarHBondContact O-N 3.03Å; R58-W61 PolarHBondContact O-N 3.47Å; L59-W61 VanDerWaalsContact C-N 3.29Å; L59-W61 PolarHBondContact O-N 3.28Å; W61-F64 PolarHBondContact O-N 3.37Å; W61-S65 VanDerWaalsContact O-CB 3.25Å; W61-S65 WeakPolarHBondContact O-CB 3.25Å; W61-S65 PolarHBondContact O-N 3.26Å
62	E	85.6	Confident	80.1	Confident	118 Å²	118	112.6 Å²	112.6	55%	0.551	56%	0.556	S	S	*	*	H	α-helix	trans	-64	-40.9	177.5	-73.4	-167.2	160.1	0	0	112.6	R58 L59 K66	R58-E62 WeakPolarHBondContact O-CG 3.5Å; R58-E62 PolarHBondContact O-N 2.84Å; L59-E62 PolarHBondContact O-N 2.86Å; E62-K66 WeakPolarHBondContact O-CB 3.5Å; E62-K66 PolarHBondContact O-N 3.39Å
63	F	87.1	Confident	78.4	Confident	134 Å²	134	111.4 Å²	111.4	59%	0.588	56%	0.562	S	S	*	*	H	α-helix	trans	-61.8	-48	174	-96.2	-79.3	0	0	0	111.6	L59 K66 I67	L59-F63 HydrophobicContact CD2-CE2 4.41Å; L59-F63 HydrophobicContact CG-CD2 4.42Å; L59-F63 HydrophobicContact CG-CE2 4.42Å; L59-F63 WeakPolarHBondContact O-CD2 3.24Å; L59-F63 PolarHBondContact O-N 3.38Å; F63-K66 PolarHBondContact O-N 3.33Å; F63-I67 WeakPolarHBondContact O-CB 3.45Å; F63-I67 PolarHBondContact O-N 3.08Å
64	F	83.1	Confident	76.6	Confident	144 Å²	144	113.5 Å²	113.5	63%	0.632	57%	0.573	S	S	*	*	H	α-helix	trans	-66.1	-41.1	-178.5	-164.5	-95.1	0	0	0	111.9	A60 W61 I67 C68	A60-F64 VanDerWaalsContact O-CB 3.28Å; A60-F64 WeakPolarHBondContact O-CB 3.26Å; A60-F64 PolarHBondContact O-N 2.87Å; W61-F64 PolarHBondContact O-N 3.37Å; F64-I67 PolarHBondContact O-N 2.92Å; F64-C68 HydrophobicContact CE1-CB 4.49Å; F64-C68 VanDerWaalsContact O-CB 3.24Å; F64-C68 WeakPolarHBondContact O-CB 3.46Å; F64-C68 PolarHBondContact O-N 2.94Å
65	S	82.4	Confident	74.9	Confident	71 Å²	71	115.1 Å²	115.1	50%	0.497	59%	0.585	S	S	.	*	H	α-helix	trans	-61.5	-45.7	175.2	177.1	0	0	0	0	112	W61 G69	W61-S65 VanDerWaalsContact O-CB 3.25Å; W61-S65 WeakPolarHBondContact O-CB 3.25Å; W61-S65 PolarHBondContact O-N 3.26Å; S65-G69 WeakPolarHBondContact O-CA 3.38Å; S65-G69 PolarHBondContact O-N 2.98Å
66	K	79.9	Confident	72.9	Confident	148 Å²	148	119.4 Å²	119.4	64%	0.643	61%	0.61	S	S	*	*	H	α-helix	trans	-61.4	-45.6	175.5	-82.3	-170.1	169.3	81.4	0	112.1	E62 F63 Y70	E62-K66 WeakPolarHBondContact O-CB 3.5Å; E62-K66 PolarHBondContact O-N 3.39Å; F63-K66 PolarHBondContact O-N 3.33Å; K66-Y70 WeakPolarHBondContact O-CB 3.38Å; K66-Y70 PolarHBondContact O-N 3.37Å
67	I	81.9	Confident	72.2	Confident	115 Å²	115	119.7 Å²	119.7	59%	0.59	61%	0.614	S	S	*	*	H	α-helix	trans	-64.9	-46.2	179.7	-84.7	160.7	0	0	0	112	F63 F64 Y70 H71	F63-I67 WeakPolarHBondContact O-CB 3.45Å; F63-I67 PolarHBondContact O-N 3.08Å; F64-I67 PolarHBondContact O-N 2.92Å; I67-Y70 PolarHBondContact O-N 3.24Å; I67-H71 PolarHBondContact O-N 3.24Å
68	C	72	Confident	71.3	Confident	67 Å²	67	120.3 Å²	120.3	45%	0.453	62%	0.617	S	S	.	*	H	α-helix	trans	-71.9	-36.1	-179.1	-157.8	0	0	0	0	111.8	F64 H71 S72	F64-C68 HydrophobicContact CE1-CB 4.49Å; F64-C68 VanDerWaalsContact O-CB 3.24Å; F64-C68 WeakPolarHBondContact O-CB 3.46Å; F64-C68 PolarHBondContact O-N 2.94Å; C68-H71 PolarHBondContact O-N 3.45Å; C68-S72 PolarHBondContact O-N 3.22Å; C68-S72 PolarHBondContact O-OG 3.47Å
69	G	64.5	Low	70.4	Confident	40 Å²	40	116.3 Å²	116.3	41%	0.412	61%	0.611	S	S	.	*	H	α-helix	trans	-67.2	-37.8	173.3	0	0	0	0	0	113.2	S65 S72 S73	S65-G69 WeakPolarHBondContact O-CA 3.38Å; S65-G69 PolarHBondContact O-N 2.98Å; G69-S72 WeakPolarHBondContact O-CB 3.48Å; G69-S72 PolarHBondContact O-N 3.29Å; G69-S73 PolarHBondContact O-N 2.95Å
70	Y	57.3	Low	69.4	Low	171 Å²	171	117.6 Å²	117.6	67%	0.671	62%	0.618	S	S	*	*	H	α-helix	trans	-65.2	-39.8	175.2	-127.5	-102.3	0	0	0	112.2	K66 I67 S72 S73 I74	K66-Y70 WeakPolarHBondContact O-CB 3.38Å; K66-Y70 PolarHBondContact O-N 3.37Å; I67-Y70 PolarHBondContact O-N 3.24Å; Y70-S72 PolarHBondContact O-N 3.22Å; Y70-S73 PolarHBondContact O-N 3Å; Y70-I74 HydrophobicContact CD1-CD1 3.93Å; Y70-I74 HydrophobicContact CE1-CD1 4.33Å; Y70-I74 PolarHBondContact O-N 3.33Å
71	H	55	Low	68.2	Low	147 Å²	147	121.3 Å²	121.3	68%	0.681	63%	0.626	S	S	*	*	H	α-helix	trans	-60.3	-35.3	175	-166.5	103.9	0	0	0	112	I67 C68 S73	I67-H71 PolarHBondContact O-N 3.24Å; C68-H71 PolarHBondContact O-N 3.45Å; H71-S73 VanDerWaalsContact C-N 3.33Å; H71-S73 PolarHBondContact O-N 3.39Å
72	S	53.4	Low	66.9	Low	71 Å²	71	116.5 Å²	116.5	50%	0.497	62%	0.619	S	S	.	*	H	α-helix	trans	-70.9	-25.6	179.9	-50.9	0	0	0	0	113.6	C68 G69 Y70 N76	C68-S72 PolarHBondContact O-N 3.22Å; C68-S72 PolarHBondContact O-OG 3.47Å; G69-S72 WeakPolarHBondContact O-CB 3.48Å; G69-S72 PolarHBondContact O-N 3.29Å; Y70-S72 PolarHBondContact O-N 3.22Å; S72-N76 PolarHBondContact O-ND2 3.02Å
73	S	50.7	Low	65.6	Low	90 Å²	90	116.4 Å²	116.4	63%	0.629	62%	0.624	S	S	*	*	H	α-helix	trans	-92.8	-16.7	-179.6	-168.7	0	0	0	0	114.2	G69 Y70 H71	G69-S73 PolarHBondContact O-N 2.95Å; Y70-S73 PolarHBondContact O-N 3Å; H71-S73 VanDerWaalsContact C-N 3.33Å; H71-S73 PolarHBondContact O-N 3.39Å
74	I	54.6	Low	63.9	Low	133 Å²	133	115 Å²	115	68%	0.682	63%	0.626	S	S	*	*	H	α-helix	trans	-87.3	-16.2	175	-77.7	168.6	0	0	0	111.9	Y70	Y70-I74 HydrophobicContact CD1-CD1 3.93Å; Y70-I74 HydrophobicContact CE1-CD1 4.33Å; Y70-I74 PolarHBondContact O-N 3.33Å
75	S	49.4	Very low	62.3	Low	99 Å²	99	112.6 Å²	112.6	69%	0.692	63%	0.626	S	S	*	*			trans	-96.4	2.9	-179.6	-170.9	0	0	0	0	114.4
76	N	47	Very low	60.5	Low	199 Å²	199	116.4 Å²	116.4	100%	1.064	64%	0.638	S	S	*	*			trans	-112.3	0	168.9	-77.1	-77.1	0	0	0	109.7	S72	S72-N76 PolarHBondContact O-ND2 3.02Å

Retrieved 76 of 76 residues in 21.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).