A0A061IPA8_CRIGR Loading...

Mitochondrial import receptor subunit TOM6 homolog

AlphaFold DB , UniProt , Accession A0A061IPA8, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Tomm6, Length 74 aa.

						>A0A061IPA8_CRIGR|A0A061IPA8|Tomm6
MASSGVTVSASGAASEAPEVPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.9	Very low	45.7	Very low	246 Å²	246	122.4 Å²	122.4	100%	1.212	82%	0.818	S	S	*	*				0	110.6	0	-77	-67.5	-177.5	0	0	108.2
2	A	40.6	Very low	45.1	Very low	100 Å²	100	119.1 Å²	119.1	83%	0.826	82%	0.821	S	S	*	*			trans	159.9	70.4	165.4	0	0	0	0	0	105.3
3	S	40.1	Very low	44.9	Very low	122 Å²	122	116.5 Å²	116.5	85%	0.853	81%	0.813	S	S	*	*				73.2	103.7	91.3	-166.3	0	0	0	0	112.6
4	S	49.6	Very low	45.1	Very low	124 Å²	124	113.4 Å²	113.4	87%	0.867	80%	0.797	S	S	*	*			trans	-50.9	152.9	171	-45.2	0	0	0	0	113.3
5	G	47.7	Very low	45.5	Very low	68 Å²	68	114.1 Å²	114.1	70%	0.701	80%	0.802	S	S	*	*			trans	-167	60.4	167.7	0	0	0	0	0	110.6	T7	G5-T7 PolarHBondContact O-N 3.05Å
6	V	48.8	Very low	46	Very low	134 Å²	134	117.6 Å²	117.6	81%	0.812	80%	0.802	S	S	*	*			trans	-60.7	105.6	157.7	151.6	0	0	0	0	106.2	V8	V6-V8 HydrophobicContact CG1-CG2 3.72Å; V6-V8 PolarHBondContact O-N 3.07Å
7	T	46.3	Very low	46.4	Very low	130 Å²	130	114.8 Å²	114.8	80%	0.798	79%	0.789	S	S	*	*			trans	-85.1	94.9	161.5	50.2	0	0	0	0	106.9	G5 S9	G5-T7 PolarHBondContact O-N 3.05Å; T7-S9 PolarHBondContact O-N 2.78Å
8	V	45.1	Very low	46.6	Very low	117 Å²	117	114.8 Å²	114.8	71%	0.709	79%	0.786	S	S	*	*			trans	-56.2	104.9	157.3	174.1	0	0	0	0	106.4	V6 A10	V6-V8 HydrophobicContact CG1-CG2 3.72Å; V6-V8 PolarHBondContact O-N 3.07Å; V8-A10 HydrophobicContact CG1-CB 4.15Å; V8-A10 PolarHBondContact O-N 3.25Å
9	S	43.1	Very low	47.3	Very low	127 Å²	127	118.6 Å²	118.6	89%	0.888	79%	0.791	S	S	*	*			trans	-78.8	83	166.4	-146	0	0	0	0	106.7	T7	T7-S9 PolarHBondContact O-N 2.78Å
10	A	45.9	Very low	48.2	Very low	69 Å²	69	118 Å²	118	57%	0.57	78%	0.783	S	S	*	*			trans	-75.9	143.7	166.6	0	0	0	0	0	109	V8	V8-A10 HydrophobicContact CG1-CB 4.15Å; V8-A10 PolarHBondContact O-N 3.25Å
11	S	48.1	Very low	48.9	Very low	109 Å²	109	116.5 Å²	116.5	76%	0.762	77%	0.773	S	S	*	*			trans	65.2	66	157.2	68.4	0	0	0	0	117.3	A13	S11-A13 PolarHBondContact O-N 3.28Å
12	G	38	Very low	50	Low	83 Å²	83	110 Å²	110	86%	0.856	74%	0.743	S	S	*	*				-79.1	82.9	129.1	0	0	0	0	0	106.8	A14	G12-A14 PolarHBondContact O-N 3.19Å
13	A	42.8	Very low	52	Low	86 Å²	86	110.4 Å²	110.4	71%	0.711	73%	0.731	S	S	*	*			trans	-54.7	108.2	170.1	0	0	0	0	0	106.2	S11 S15	S11-A13 PolarHBondContact O-N 3.28Å; A13-S15 PolarHBondContact O-N 2.92Å; A13-S15 VanDerWaalsContact O-N 3.12Å
14	A	46.8	Very low	54.3	Low	72 Å²	72	110 Å²	110	60%	0.595	72%	0.723	S	S	*	*			trans	-49.9	124.5	158.8	0	0	0	0	0	104.8	G12 E16	G12-A14 PolarHBondContact O-N 3.19Å; A14-E16 HydrophobicContact CB-CG 4.11Å; A14-E16 PolarHBondContact O-N 3.31Å
15	S	51.8	Low	56.3	Low	125 Å²	125	105.9 Å²	105.9	87%	0.874	70%	0.701	S	S	*	*			trans	-64.2	72.8	154.4	-70.6	0	0	0	0	106.1	A13 A17	A13-S15 PolarHBondContact O-N 2.92Å; A13-S15 VanDerWaalsContact O-N 3.12Å; S15-A17 PolarHBondContact O-N 3.3Å
16	E	52.9	Low	58.3	Low	170 Å²	170	107.6 Å²	107.6	79%	0.794	69%	0.694	S	S	*	*			trans	-64.4	81.4	147.3	-74.3	177	158.4	0	0	103.2	A14	A14-E16 HydrophobicContact CB-CG 4.11Å; A14-E16 PolarHBondContact O-N 3.31Å
17	A	53.1	Low	60.3	Low	70 Å²	70	109.3 Å²	109.3	58%	0.579	69%	0.686	S	S	*	*			trans	-44.1	129.6	149.7	0	0	0	0	0	104.6	S15 E19	S15-A17 PolarHBondContact O-N 3.3Å; A17-E19 PolarHBondContact O-N 2.98Å
18	P	49.8	Very low	62.5	Low	114 Å²	114	108.2 Å²	108.2	74%	0.74	68%	0.675	S	S	*	*			trans	-51.5	113.9	176.2	22.6	-31.6	0	0	0	105.1	V20	P18-V20 PolarHBondContact O-N 3.36Å
19	E	61.2	Low	64.5	Low	188 Å²	188	111.1 Å²	111.1	88%	0.879	67%	0.673	S	S	*	*			trans	-56.2	101.9	171.9	-71.9	-168.8	147.4	0	0	103	A17 P21	A17-E19 PolarHBondContact O-N 2.98Å; E19-P21 VanDerWaalsContact O-CD 3.29Å; E19-P21 WeakPolarHBondContact O-CD 3.43Å
20	V	63.7	Low	66.6	Low	105 Å²	105	107 Å²	107	64%	0.636	65%	0.65	S	S	*	*			trans	-55.2	119.9	175.3	173.2	0	0	0	0	102.4	P18 D22	P18-V20 PolarHBondContact O-N 3.36Å; V20-D22 VanDerWaalsContact C-N 3.26Å; V20-D22 PolarHBondContact O-N 2.78Å
21	P	63.3	Low	68.6	Low	87 Å²	87	107 Å²	107	57%	0.565	64%	0.643	S	S	*	*			trans	-65.8	100.3	-174.2	25.4	-33	0	0	0	106.1	E19 N23	E19-P21 VanDerWaalsContact O-CD 3.29Å; E19-P21 WeakPolarHBondContact O-CD 3.43Å; P21-N23 PolarHBondContact O-N 3.29Å; P21-N23 PolarHBondContact O-ND2 3.42Å
22	D	71.4	Confident	70.4	Confident	109 Å²	109	109.6 Å²	109.6	58%	0.583	64%	0.637	S	S	*	*			trans	-76.7	56.4	177.3	-73.8	-24	0	0	0	107.3	V20 V24 G25 D26	V20-D22 VanDerWaalsContact C-N 3.26Å; V20-D22 PolarHBondContact O-N 2.78Å; D22-V24 PolarHBondContact O-N 3.02Å; D22-G25 CarbonylContact O-C 3.55Å; D22-G25 WeakPolarHBondContact O-CA 3.31Å; D22-G25 PolarHBondContact O-N 3.39Å; D22-D26 PolarHBondContact O-N 3.2Å
23	N	81.8	Confident	72.5	Confident	109 Å²	109	114 Å²	114	58%	0.583	63%	0.628	S	S	*	*	H	α-helix	trans	-54.3	-35.2	-170.1	-66.4	-59.1	0	0	0	112.1	P21 W27	P21-N23 PolarHBondContact O-N 3.29Å; P21-N23 PolarHBondContact O-ND2 3.42Å; N23-W27 WeakPolarHBondContact O-CB 3.17Å; N23-W27 PolarHBondContact O-N 3.3Å
24	V	89.1	Confident	74.4	Confident	113 Å²	113	114.2 Å²	114.2	69%	0.685	61%	0.613	S	S	*	*	H	α-helix	trans	-72.9	-40	176.5	-178.9	0	0	0	0	110.8	D22 W27 L28	D22-V24 PolarHBondContact O-N 3.02Å; V24-W27 PolarHBondContact O-N 2.93Å; V24-L28 VanDerWaalsContact O-CB 3.31Å; V24-L28 WeakPolarHBondContact O-CB 3.36Å; V24-L28 PolarHBondContact O-N 3.49Å
25	G	91.3	Very high	76	Confident	39 Å²	39	113.2 Å²	113.2	40%	0.402	61%	0.605	S	S	.	*	H	α-helix	trans	-65.3	-44.6	176.6	0	0	0	0	0	111.9	D22 L28 R29	D22-G25 CarbonylContact O-C 3.55Å; D22-G25 WeakPolarHBondContact O-CA 3.31Å; D22-G25 PolarHBondContact O-N 3.39Å; G25-L28 PolarHBondContact O-N 2.91Å; G25-R29 WeakPolarHBondContact O-CB 3.48Å; G25-R29 PolarHBondContact O-N 3.45Å
26	D	90.2	Very high	77.2	Confident	103 Å²	103	110.6 Å²	110.6	55%	0.551	58%	0.584	S	S	*	*	H	α-helix	trans	-67.7	-38.8	176.5	-72.3	-29.9	0	0	0	112.3	D22 R29 G30	D22-D26 PolarHBondContact O-N 3.2Å; D26-R29 PolarHBondContact O-N 2.93Å; D26-G30 PolarHBondContact O-N 3.01Å
27	W	91.3	Very high	78.4	Confident	170 Å²	170	105.4 Å²	105.4	64%	0.644	56%	0.561	S	S	*	*	H	α-helix	trans	-62	-47.9	171.9	178.2	81.8	0	0	0	111.6	N23 V24 R29 G30 V31	N23-W27 WeakPolarHBondContact O-CB 3.17Å; N23-W27 PolarHBondContact O-N 3.3Å; V24-W27 PolarHBondContact O-N 2.93Å; W27-R29 VanDerWaalsContact C-N 3.31Å; W27-R29 PolarHBondContact O-N 2.81Å; W27-G30 PolarHBondContact O-N 3.44Å; W27-V31 HydrophobicContact CD2-CG2 4.26Å; W27-V31 HydrophobicContact CH2-CG2 4.41Å; W27-V31 HydrophobicContact CZ2-CG2 4.01Å; W27-V31 WeakPolarHBondContact O-CG2 3.21Å; W27-V31 PolarHBondContact O-N 2.92Å
28	L	91.5	Very high	79	Confident	108 Å²	108	112.8 Å²	112.8	57%	0.565	57%	0.574	S	S	*	*	H	α-helix	trans	-62.8	-40.3	179.2	-151.9	87.6	0	0	0	111.2	V24 G25 G30 V31 Y32	V24-L28 VanDerWaalsContact O-CB 3.31Å; V24-L28 WeakPolarHBondContact O-CB 3.36Å; V24-L28 PolarHBondContact O-N 3.49Å; G25-L28 PolarHBondContact O-N 2.91Å; L28-G30 VanDerWaalsContact C-N 3.34Å; L28-V31 PolarHBondContact O-N 3.19Å; L28-Y32 WeakPolarHBondContact O-CB 3.37Å; L28-Y32 PolarHBondContact O-N 2.81Å
29	R	88.1	Confident	79.9	Confident	177 Å²	177	114.5 Å²	114.5	67%	0.668	58%	0.577	S	S	*	*	H	α-helix	trans	-68	-35.1	177	-166.8	164.8	-173.4	-179.9	-0.3	111.9	G25 D26 W27 R33	G25-R29 WeakPolarHBondContact O-CB 3.48Å; G25-R29 PolarHBondContact O-N 3.45Å; D26-R29 PolarHBondContact O-N 2.93Å; W27-R29 VanDerWaalsContact C-N 3.31Å; W27-R29 PolarHBondContact O-N 2.81Å; R29-R33 PolarHBondContact O-N 3.37Å
30	G	86.6	Confident	80.8	Confident	40 Å²	40	108.3 Å²	108.3	41%	0.412	55%	0.55	S	S	.	*	H	α-helix	trans	-63.3	-47.2	170.9	0	0	0	0	0	112.4	D26 W27 L28 Y32 R33 F34	D26-G30 PolarHBondContact O-N 3.01Å; W27-G30 PolarHBondContact O-N 3.44Å; L28-G30 VanDerWaalsContact C-N 3.34Å; G30-Y32 VanDerWaalsContact C-N 3.35Å; G30-Y32 PolarHBondContact O-N 3.49Å; G30-R33 PolarHBondContact O-N 2.87Å; G30-F34 VanDerWaalsContact O-CB 3.32Å; G30-F34 WeakPolarHBondContact O-CB 3.33Å; G30-F34 PolarHBondContact O-N 3.35Å
31	V	86.9	Confident	81.7	Confident	69 Å²	69	110.6 Å²	110.6	42%	0.418	55%	0.552	S	S	.	*	H	α-helix	trans	-62.2	-42.8	175.2	173.7	0	0	0	0	111.1	W27 L28 F34 A35	W27-V31 HydrophobicContact CD2-CG2 4.26Å; W27-V31 HydrophobicContact CH2-CG2 4.41Å; W27-V31 HydrophobicContact CZ2-CG2 4.01Å; W27-V31 WeakPolarHBondContact O-CG2 3.21Å; W27-V31 PolarHBondContact O-N 2.92Å; L28-V31 PolarHBondContact O-N 3.19Å; V31-F34 PolarHBondContact O-N 2.99Å; V31-A35 WeakPolarHBondContact O-CB 3.4Å; V31-A35 PolarHBondContact O-N 2.91Å
32	Y	86	Confident	82.7	Confident	164 Å²	164	115.4 Å²	115.4	64%	0.643	56%	0.559	S	S	*	*	H	α-helix	trans	-63	-48.4	177.6	-174.2	-102.2	0	0	0	111.5	L28 G30 F34 A35 T36	L28-Y32 WeakPolarHBondContact O-CB 3.37Å; L28-Y32 PolarHBondContact O-N 2.81Å; G30-Y32 VanDerWaalsContact C-N 3.35Å; G30-Y32 PolarHBondContact O-N 3.49Å; Y32-F34 VanDerWaalsContact C-N 3.35Å; Y32-F34 PolarHBondContact O-N 3.37Å; Y32-A35 PolarHBondContact O-N 3.48Å; Y32-T36 HydrophobicContact CD1-CG2 3.87Å; Y32-T36 HydrophobicContact CD2-CG2 4.13Å; Y32-T36 HydrophobicContact CE1-CG2 3.55Å; Y32-T36 HydrophobicContact CE2-CG2 3.82Å; Y32-T36 HydrophobicContact CG-CG2 4.16Å; Y32-T36 WeakPolarHBondContact O-CB 3.34Å; Y32-T36 WeakPolarHBondContact O-CG2 3.31Å; Y32-T36 PolarHBondContact O-N 2.9Å; Y32-T36 PolarHBondContact O-OG1 3.44Å
33	R	83.8	Confident	83.4	Confident	175 Å²	175	112.6 Å²	112.6	66%	0.66	54%	0.54	S	S	*	.	H	α-helix	trans	-57.9	-48	174.8	-85.8	-177	86.1	168.4	5.3	111.1	R29 G30 A35 T36 D37	R29-R33 PolarHBondContact O-N 3.37Å; G30-R33 PolarHBondContact O-N 2.87Å; R33-A35 VanDerWaalsContact C-N 3.27Å; R33-A35 PolarHBondContact O-N 3.38Å; R33-T36 WeakPolarHBondContact CA-OG1 3.39Å; R33-T36 PolarHBondContact O-N 2.86Å; R33-T36 VanDerWaalsContact O-N 3.1Å; R33-T36 PolarHBondContact O-OG1 3.47Å; R33-T36 VanDerWaalsContact O-OG1 3.08Å; R33-D37 VanDerWaalsContact O-CB 3.23Å; R33-D37 WeakPolarHBondContact O-CB 3.35Å; R33-D37 PolarHBondContact O-N 2.92Å
34	F	81.3	Confident	83.6	Confident	91 Å²	91	111.8 Å²	111.8	40%	0.399	54%	0.536	S	S	.	.	H	α-helix	trans	-57.4	-37.9	177.8	179.9	-99.1	0	0	0	113	G30 V31 Y32 R43 I46	G30-F34 VanDerWaalsContact O-CB 3.32Å; G30-F34 WeakPolarHBondContact O-CB 3.33Å; G30-F34 PolarHBondContact O-N 3.35Å; V31-F34 PolarHBondContact O-N 2.99Å; Y32-F34 VanDerWaalsContact C-N 3.35Å; Y32-F34 PolarHBondContact O-N 3.37Å; F34-R43 HydrophobicContact CE1-CB 4.41Å; F34-R43 HydrophobicContact CE1-CG 4.35Å; F34-R43 HydrophobicContact CE2-CB 4.19Å; F34-R43 HydrophobicContact CZ-CB 4Å; F34-R43 HydrophobicContact CZ-CG 4.42Å; F34-R43 VanDerWaalsContact O-CD 3.3Å; F34-R43 WeakPolarHBondContact O-CD 3.32Å; F34-I46 HydrophobicContact CZ-CD1 3.88Å
35	A	80.4	Confident	83.6	Confident	51 Å²	51	110.9 Å²	110.9	42%	0.421	53%	0.526	S	S	.	.	H	α-helix	trans	-76	-33.5	176.3	0	0	0	0	0	113.1	V31 Y32 R33 R43	V31-A35 WeakPolarHBondContact O-CB 3.4Å; V31-A35 PolarHBondContact O-N 2.91Å; Y32-A35 PolarHBondContact O-N 3.48Å; R33-A35 VanDerWaalsContact C-N 3.27Å; R33-A35 PolarHBondContact O-N 3.38Å; A35-R43 PolarHBondContact O-NE 3.38Å; A35-R43 PolarHBondContact O-NH1 2.92Å; A35-R43 PolarHBondContact O-NH2 3.08Å
36	T	78.5	Confident	83.6	Confident	70 Å²	70	113.7 Å²	113.7	43%	0.429	53%	0.531	S	S	.	.	H	α-helix	trans	-84	-27.2	-178.2	65.7	0	0	0	0	113	Y32 R33 R38	Y32-T36 HydrophobicContact CD1-CG2 3.87Å; Y32-T36 HydrophobicContact CD2-CG2 4.13Å; Y32-T36 HydrophobicContact CE1-CG2 3.55Å; Y32-T36 HydrophobicContact CE2-CG2 3.82Å; Y32-T36 HydrophobicContact CG-CG2 4.16Å; Y32-T36 WeakPolarHBondContact O-CB 3.34Å; Y32-T36 WeakPolarHBondContact O-CG2 3.31Å; Y32-T36 PolarHBondContact O-N 2.9Å; Y32-T36 PolarHBondContact O-OG1 3.44Å; R33-T36 WeakPolarHBondContact CA-OG1 3.39Å; R33-T36 PolarHBondContact O-N 2.86Å; R33-T36 VanDerWaalsContact O-N 3.1Å; R33-T36 PolarHBondContact O-OG1 3.47Å; R33-T36 VanDerWaalsContact O-OG1 3.08Å; T36-R38 PolarHBondContact O-N 3.4Å
37	D	76.7	Confident	83.6	Confident	61 Å²	61	113.1 Å²	113.1	33%	0.326	53%	0.528	S	S	.	.			trans	-70.6	102.3	-179.9	-161.4	-30	0	0	0	108.5	R33 N39 D40 R43	R33-D37 VanDerWaalsContact O-CB 3.23Å; R33-D37 WeakPolarHBondContact O-CB 3.35Å; R33-D37 PolarHBondContact O-N 2.92Å; D37-N39 VanDerWaalsContact C-N 3.28Å; D37-N39 PolarHBondContact OD1-N 2.89Å; D37-D40 WeakPolarHBondContact CB-OD2 3.25Å; D37-R43 WeakPolarHBondContact O-CD 3.29Å; D37-R43 PolarHBondContact O-NH1 3.43Å
38	R	66.1	Low	83.6	Confident	225 Å²	225	109.1 Å²	109.1	85%	0.849	52%	0.519	S	S	*	.	S	Bend	trans	-80.2	-12.1	179.1	-79.1	-164.3	-177.2	-151.4	4.3	112.2	T36 R43	T36-R38 PolarHBondContact O-N 3.4Å; R38-R43 VanDerWaalsContact CG-NH1 3.35Å
39	N	69.9	Low	83.8	Confident	150 Å²	150	109.4 Å²	109.4	80%	0.802	52%	0.521	S	S	*	.	S	Bend	trans	-93.5	-4.8	-175.3	-162.2	63	0	0	0	112.7	D37 F41	D37-N39 VanDerWaalsContact C-N 3.28Å; D37-N39 PolarHBondContact OD1-N 2.89Å; N39-F41 PolarHBondContact O-N 2.83Å
40	D	79.8	Confident	84.2	Confident	59 Å²	59	103 Å²	103	32%	0.316	51%	0.509	S	S	.	.			trans	-77	108.9	176.9	-80.7	-49.5	0	0	0	112.3	D37 R42 R43 N44	D37-D40 WeakPolarHBondContact CB-OD2 3.25Å; D40-R42 PolarHBondContact O-N 3.43Å; D40-R42 VanDerWaalsContact O-N 3.14Å; D40-R43 HydrophobicContact CB-CB 3.99Å; D40-R43 PolarHBondContact O-N 3.26Å; D40-R43 VanDerWaalsContact O-N 3.08Å; D40-N44 PolarHBondContact O-N 3.44Å
41	F	82.6	Confident	84.6	Confident	152 Å²	152	107 Å²	107	67%	0.667	52%	0.521	S	S	*	.	H	α-helix	trans	-49.8	-38.1	169.6	176.1	-97.9	0	0	0	111.9	N39 N44 L45	N39-F41 PolarHBondContact O-N 2.83Å; F41-N44 PolarHBondContact O-N 3.14Å; F41-L45 HydrophobicContact CE1-CD2 4.06Å; F41-L45 WeakPolarHBondContact O-CB 3.2Å; F41-L45 PolarHBondContact O-N 2.75Å
42	R	83.7	Confident	85.1	Confident	189 Å²	189	110.5 Å²	110.5	71%	0.713	53%	0.531	S	S	*	.	H	α-helix	trans	-62.1	-46.5	178.9	-66.6	-179	-175.8	-105.6	0.9	112.1	D40 L45 I46	D40-R42 PolarHBondContact O-N 3.43Å; D40-R42 VanDerWaalsContact O-N 3.14Å; R42-L45 PolarHBondContact O-N 3.46Å; R42-I46 WeakPolarHBondContact O-CB 3.43Å; R42-I46 WeakPolarHBondContact O-CD1 3.29Å; R42-I46 VanDerWaalsContact O-CG1 3.25Å; R42-I46 WeakPolarHBondContact O-CG1 3.4Å; R42-I46 PolarHBondContact O-N 3.41Å
43	R	85.1	Confident	85.6	Confident	50 Å²	50	105.4 Å²	105.4	19%	0.189	52%	0.522	C	S	.	.	H	α-helix	trans	-66.8	-45.8	177.8	-178.5	-146.8	156.9	-177.3	-1.3	110.3	F34 A35 D37 R38 D40 L45 I46 L47	F34-R43 HydrophobicContact CE1-CB 4.41Å; F34-R43 HydrophobicContact CE1-CG 4.35Å; F34-R43 HydrophobicContact CE2-CB 4.19Å; F34-R43 HydrophobicContact CZ-CB 4Å; F34-R43 HydrophobicContact CZ-CG 4.42Å; F34-R43 VanDerWaalsContact O-CD 3.3Å; F34-R43 WeakPolarHBondContact O-CD 3.32Å; A35-R43 PolarHBondContact O-NE 3.38Å; A35-R43 PolarHBondContact O-NH1 2.92Å; A35-R43 PolarHBondContact O-NH2 3.08Å; D37-R43 WeakPolarHBondContact O-CD 3.29Å; D37-R43 PolarHBondContact O-NH1 3.43Å; R38-R43 VanDerWaalsContact CG-NH1 3.35Å; D40-R43 HydrophobicContact CB-CB 3.99Å; D40-R43 PolarHBondContact O-N 3.26Å; D40-R43 VanDerWaalsContact O-N 3.08Å; R43-L45 VanDerWaalsContact C-N 3.29Å; R43-L45 PolarHBondContact O-N 2.93Å; R43-I46 PolarHBondContact O-N 2.99Å; R43-L47 HydrophobicContact CG-CD1 4.04Å; R43-L47 HydrophobicContact CG-CG 4.29Å; R43-L47 VanDerWaalsContact NE-CD1 3.27Å; R43-L47 WeakPolarHBondContact O-CB 3.24Å; R43-L47 VanDerWaalsContact O-CG 3.29Å; R43-L47 WeakPolarHBondContact O-CG 3.42Å; R43-L47 PolarHBondContact O-N 3.07Å
44	N	87	Confident	86.2	Confident	92 Å²	92	99.7 Å²	99.7	49%	0.492	51%	0.513	S	S	.	.	H	α-helix	trans	-59.2	-43	177.5	-170.9	47.1	0	0	0	111.1	D40 F41 L47 N48	D40-N44 PolarHBondContact O-N 3.44Å; F41-N44 PolarHBondContact O-N 3.14Å; N44-L47 PolarHBondContact O-N 2.98Å; N44-N48 WeakPolarHBondContact O-CB 3.36Å; N44-N48 PolarHBondContact O-N 3.18Å; N44-N48 PolarHBondContact O-ND2 2.82Å; N44-N48 PolarHBondContact OD1-ND2 3.49Å
45	L	89.4	Confident	86.9	Confident	93 Å²	93	97.1 Å²	97.1	49%	0.487	51%	0.512	S	S	.	.	H	α-helix	trans	-62.3	-48.1	176.1	-178.2	65.9	0	0	0	111.9	F41 R42 R43 L47 N48 L49	F41-L45 HydrophobicContact CE1-CD2 4.06Å; F41-L45 WeakPolarHBondContact O-CB 3.2Å; F41-L45 PolarHBondContact O-N 2.75Å; R42-L45 PolarHBondContact O-N 3.46Å; R43-L45 VanDerWaalsContact C-N 3.29Å; R43-L45 PolarHBondContact O-N 2.93Å; L45-L47 VanDerWaalsContact C-N 3.33Å; L45-L47 PolarHBondContact O-N 3.41Å; L45-N48 PolarHBondContact O-N 2.91Å; L45-L49 VanDerWaalsContact O-CB 3.24Å; L45-L49 WeakPolarHBondContact O-CB 3.15Å; L45-L49 PolarHBondContact O-N 2.91Å
46	I	90.5	Very high	87.5	Confident	99 Å²	99	98.5 Å²	98.5	51%	0.508	52%	0.515	S	S	.	.	H	α-helix	trans	-62.1	-41.6	178.6	-72.7	161.9	0	0	0	111	F34 R42 R43 G50	F34-I46 HydrophobicContact CZ-CD1 3.88Å; R42-I46 WeakPolarHBondContact O-CB 3.43Å; R42-I46 WeakPolarHBondContact O-CD1 3.29Å; R42-I46 VanDerWaalsContact O-CG1 3.25Å; R42-I46 WeakPolarHBondContact O-CG1 3.4Å; R42-I46 PolarHBondContact O-N 3.41Å; R43-I46 PolarHBondContact O-N 2.99Å; I46-G50 PolarHBondContact O-N 2.94Å
47	L	89.8	Confident	88.3	Confident	91 Å²	91	102.9 Å²	102.9	48%	0.476	52%	0.524	S	S	.	.	H	α-helix	trans	-66.1	-47.5	177.7	-74	-179.9	0	0	0	112.2	R43 N44 L45 L49 G50 L51	R43-L47 HydrophobicContact CG-CD1 4.04Å; R43-L47 HydrophobicContact CG-CG 4.29Å; R43-L47 VanDerWaalsContact NE-CD1 3.27Å; R43-L47 WeakPolarHBondContact O-CB 3.24Å; R43-L47 VanDerWaalsContact O-CG 3.29Å; R43-L47 WeakPolarHBondContact O-CG 3.42Å; R43-L47 PolarHBondContact O-N 3.07Å; N44-L47 PolarHBondContact O-N 2.98Å; L45-L47 VanDerWaalsContact C-N 3.33Å; L45-L47 PolarHBondContact O-N 3.41Å; L47-L49 VanDerWaalsContact C-N 3.32Å; L47-L49 PolarHBondContact O-N 3.38Å; L47-G50 PolarHBondContact O-N 3.28Å; L47-L51 VanDerWaalsContact O-CB 3.29Å; L47-L51 WeakPolarHBondContact O-CB 3.32Å; L47-L51 PolarHBondContact O-N 2.95Å
48	N	92.1	Very high	89	Confident	85 Å²	85	104.2 Å²	104.2	46%	0.455	53%	0.531	S	S	.	.	H	α-helix	trans	-63.8	-39.9	178.3	-77.8	-71.1	0	0	0	111.4	N44 L45 L51 F52	N44-N48 WeakPolarHBondContact O-CB 3.36Å; N44-N48 PolarHBondContact O-N 3.18Å; N44-N48 PolarHBondContact O-ND2 2.82Å; N44-N48 PolarHBondContact OD1-ND2 3.49Å; L45-N48 PolarHBondContact O-N 2.91Å; N48-L51 PolarHBondContact O-N 3.36Å; N48-F52 WeakPolarHBondContact O-CB 3.45Å; N48-F52 PolarHBondContact O-N 3.41Å
49	L	95.9	Very high	90.1	Very high	115 Å²	115	96.2 Å²	96.2	60%	0.602	51%	0.512	S	S	*	.	H	α-helix	trans	-67	-42.3	177.8	-171.9	62.6	0	0	0	111.8	L45 L47 F52 A53	L45-L49 VanDerWaalsContact O-CB 3.24Å; L45-L49 WeakPolarHBondContact O-CB 3.15Å; L45-L49 PolarHBondContact O-N 2.91Å; L47-L49 VanDerWaalsContact C-N 3.32Å; L47-L49 PolarHBondContact O-N 3.38Å; L49-F52 PolarHBondContact O-N 2.93Å; L49-A53 PolarHBondContact O-N 3.26Å
50	G	95.9	Very high	90.9	Very high	42 Å²	42	98.6 Å²	98.6	43%	0.433	51%	0.51	S	S	.	.	H	α-helix	trans	-63.1	-43.8	174.5	0	0	0	0	0	112.3	I46 L47 F52 A53 A54	I46-G50 PolarHBondContact O-N 2.94Å; L47-G50 PolarHBondContact O-N 3.28Å; G50-F52 VanDerWaalsContact C-N 3.34Å; G50-F52 PolarHBondContact O-N 3.25Å; G50-A53 PolarHBondContact O-N 2.93Å; G50-A54 WeakPolarHBondContact O-CB 3.42Å; G50-A54 PolarHBondContact O-N 2.79Å
51	L	96.2	Very high	91	Very high	125 Å²	125	98.2 Å²	98.2	65%	0.654	51%	0.508	S	S	*	.	H	α-helix	trans	-63.7	-40.3	177	-174.1	62.5	0	0	0	111.6	L47 N48 G55	L47-L51 VanDerWaalsContact O-CB 3.29Å; L47-L51 WeakPolarHBondContact O-CB 3.32Å; L47-L51 PolarHBondContact O-N 2.95Å; N48-L51 PolarHBondContact O-N 3.36Å; L51-G55 PolarHBondContact O-N 3.5Å
52	F	96.1	Very high	90.6	Very high	141 Å²	141	95.4 Å²	95.4	62%	0.618	50%	0.5	S	S	*	.	H	α-helix	trans	-61.8	-50.1	175.1	177.3	-101.9	0	0	0	111.6	N48 L49 G50 A54 G55 V56	N48-F52 WeakPolarHBondContact O-CB 3.45Å; N48-F52 PolarHBondContact O-N 3.41Å; L49-F52 PolarHBondContact O-N 2.93Å; G50-F52 VanDerWaalsContact C-N 3.34Å; G50-F52 PolarHBondContact O-N 3.25Å; F52-A54 PolarHBondContact O-N 2.81Å; F52-G55 PolarHBondContact O-N 2.85Å; F52-V56 HydrophobicContact CD1-CG2 4.37Å; F52-V56 HydrophobicContact CE1-CG2 3.96Å; F52-V56 HydrophobicContact CE2-CG2 4.11Å; F52-V56 HydrophobicContact CZ-CG2 3.82Å; F52-V56 WeakPolarHBondContact O-CG2 3.29Å; F52-V56 PolarHBondContact O-N 3.45Å
53	A	96.7	Very high	89.7	Confident	57 Å²	57	90.5 Å²	90.5	47%	0.471	49%	0.494	S	S	.	.	H	α-helix	trans	-61.9	-42.8	179.1	0	0	0	0	0	112.2	L49 G50 G55 V56 W57	L49-A53 PolarHBondContact O-N 3.26Å; G50-A53 PolarHBondContact O-N 2.93Å; A53-G55 VanDerWaalsContact C-N 3.33Å; A53-G55 PolarHBondContact O-N 2.85Å; A53-V56 PolarHBondContact O-N 2.71Å; A53-W57 WeakPolarHBondContact O-CB 3.33Å; A53-W57 PolarHBondContact O-N 2.86Å
54	A	96.6	Very high	88.6	Confident	55 Å²	55	94.2 Å²	94.2	46%	0.455	52%	0.518	S	S	.	.	H	α-helix	trans	-61.9	-40.9	174.8	0	0	0	0	0	111.7	G50 F52 W57 L58	G50-A54 WeakPolarHBondContact O-CB 3.42Å; G50-A54 PolarHBondContact O-N 2.79Å; F52-A54 PolarHBondContact O-N 2.81Å; A54-W57 PolarHBondContact O-N 3.35Å; A54-L58 WeakPolarHBondContact O-CB 3.3Å; A54-L58 PolarHBondContact O-N 3.06Å
55	G	95.2	Very high	87.2	Confident	38 Å²	38	95.8 Å²	95.8	39%	0.392	53%	0.525	S	S	.	.	H	α-helix	trans	-63.6	-44.5	175.3	0	0	0	0	0	113	L51 F52 A53 L58 A59	L51-G55 PolarHBondContact O-N 3.5Å; F52-G55 PolarHBondContact O-N 2.85Å; A53-G55 VanDerWaalsContact C-N 3.33Å; A53-G55 PolarHBondContact O-N 2.85Å; G55-L58 PolarHBondContact O-N 2.88Å; G55-A59 WeakPolarHBondContact O-CB 3.31Å; G55-A59 PolarHBondContact O-N 2.84Å
56	V	94.5	Very high	85.7	Confident	80 Å²	80	98.2 Å²	98.2	49%	0.485	54%	0.538	S	S	.	.	H	α-helix	trans	-62.5	-44.3	175.7	172.5	0	0	0	0	111	F52 A53 R60	F52-V56 HydrophobicContact CD1-CG2 4.37Å; F52-V56 HydrophobicContact CE1-CG2 3.96Å; F52-V56 HydrophobicContact CE2-CG2 4.11Å; F52-V56 HydrophobicContact CZ-CG2 3.82Å; F52-V56 WeakPolarHBondContact O-CG2 3.29Å; F52-V56 PolarHBondContact O-N 3.45Å; A53-V56 PolarHBondContact O-N 2.71Å; V56-R60 WeakPolarHBondContact O-CB 3.1Å; V56-R60 PolarHBondContact O-N 3.36Å
57	W	94	Very high	84.1	Confident	162 Å²	162	99.6 Å²	99.6	61%	0.614	55%	0.546	S	S	*	.	H	α-helix	trans	-62.9	-46.7	175.9	-178.2	88	0	0	0	111.3	A53 A54 A59 R60 N61	A53-W57 WeakPolarHBondContact O-CB 3.33Å; A53-W57 PolarHBondContact O-N 2.86Å; A54-W57 PolarHBondContact O-N 3.35Å; W57-A59 PolarHBondContact O-N 2.92Å; W57-R60 PolarHBondContact O-N 3.19Å; W57-N61 VanDerWaalsContact CD2-ND2 3.3Å; W57-N61 PolarHBondContact NE1-ND2 2.99Å; W57-N61 VanDerWaalsContact NE1-ND2 3.19Å; W57-N61 PolarHBondContact O-N 3.08Å; W57-N61 PolarHBondContact O-ND2 2.99Å
58	L	92.1	Very high	82.5	Confident	89 Å²	89	103.7 Å²	103.7	47%	0.466	57%	0.565	S	S	.	*	H	α-helix	trans	-61.6	-46.4	179.6	-178.9	64.5	0	0	0	111.3	A54 G55 R60 N61 L62	A54-L58 WeakPolarHBondContact O-CB 3.3Å; A54-L58 PolarHBondContact O-N 3.06Å; G55-L58 PolarHBondContact O-N 2.88Å; L58-R60 VanDerWaalsContact C-N 3.29Å; L58-R60 PolarHBondContact O-N 2.86Å; L58-N61 PolarHBondContact O-N 3.1Å; L58-L62 HydrophobicContact CD1-CD1 3.78Å; L58-L62 HydrophobicContact CD1-CG 3.91Å; L58-L62 HydrophobicContact CD2-CD1 4.31Å; L58-L62 HydrophobicContact CG-CD1 3.69Å; L58-L62 HydrophobicContact CG-CG 4.22Å; L58-L62 VanDerWaalsContact O-CB 3.31Å; L58-L62 WeakPolarHBondContact O-CB 3.39Å; L58-L62 WeakPolarHBondContact O-CG 3.11Å; L58-L62 PolarHBondContact O-N 2.71Å
59	A	89.7	Confident	81	Confident	56 Å²	56	102.3 Å²	102.3	46%	0.463	57%	0.565	S	S	.	*	H	α-helix	trans	-59	-42.6	175.8	0	0	0	0	0	111.3	G55 W57 S63	G55-A59 WeakPolarHBondContact O-CB 3.31Å; G55-A59 PolarHBondContact O-N 2.84Å; W57-A59 PolarHBondContact O-N 2.92Å; A59-S63 WeakPolarHBondContact O-CB 3.22Å; A59-S63 PolarHBondContact O-N 3.17Å; A59-S63 PolarHBondContact O-OG 3.44Å
60	R	85.4	Confident	79.5	Confident	200 Å²	200	102.6 Å²	102.6	76%	0.755	57%	0.574	S	S	*	*	H	α-helix	trans	-65	-40.6	178.1	-171.6	173.7	-178.5	162.8	1	113	V56 W57 L58 D64	V56-R60 WeakPolarHBondContact O-CB 3.1Å; V56-R60 PolarHBondContact O-N 3.36Å; W57-R60 PolarHBondContact O-N 3.19Å; L58-R60 VanDerWaalsContact C-N 3.29Å; L58-R60 PolarHBondContact O-N 2.86Å; R60-D64 PolarHBondContact O-N 2.77Å
61	N	81.8	Confident	78.1	Confident	51 Å²	51	109.2 Å²	109.2	27%	0.273	59%	0.593	S	S	.	*	H	α-helix	trans	-77.5	-35.2	179.7	-75.2	-100.1	0	0	0	112.1	W57 L58 D64 I65	W57-N61 VanDerWaalsContact CD2-ND2 3.3Å; W57-N61 PolarHBondContact NE1-ND2 2.99Å; W57-N61 VanDerWaalsContact NE1-ND2 3.19Å; W57-N61 PolarHBondContact O-N 3.08Å; W57-N61 PolarHBondContact O-ND2 2.99Å; L58-N61 PolarHBondContact O-N 3.1Å; N61-D64 WeakPolarHBondContact O-CB 3.23Å; N61-D64 PolarHBondContact O-N 2.86Å; N61-I65 VanDerWaalsContact O-CG1 3.31Å; N61-I65 WeakPolarHBondContact O-CG1 3.21Å; N61-I65 PolarHBondContact O-N 2.72Å
62	L	74.8	Confident	76.6	Confident	94 Å²	94	109.3 Å²	109.3	49%	0.492	60%	0.602	S	S	.	*	H	α-helix	trans	-69.5	-37.9	174.3	-73.4	174.5	0	0	0	111.8	L58 D64 I65 D66	L58-L62 HydrophobicContact CD1-CD1 3.78Å; L58-L62 HydrophobicContact CD1-CG 3.91Å; L58-L62 HydrophobicContact CD2-CD1 4.31Å; L58-L62 HydrophobicContact CG-CD1 3.69Å; L58-L62 HydrophobicContact CG-CG 4.22Å; L58-L62 VanDerWaalsContact O-CB 3.31Å; L58-L62 WeakPolarHBondContact O-CB 3.39Å; L58-L62 WeakPolarHBondContact O-CG 3.11Å; L58-L62 PolarHBondContact O-N 2.71Å; L62-D64 PolarHBondContact O-N 3.12Å; L62-I65 PolarHBondContact O-N 3.39Å; L62-D66 WeakPolarHBondContact O-CB 3.47Å; L62-D66 PolarHBondContact O-N 2.79Å
63	S	65.2	Low	75.3	Confident	86 Å²	86	106.3 Å²	106.3	60%	0.601	61%	0.611	S	S	*	*	H	α-helix	trans	-65	-26.2	171.9	-64.3	0	0	0	0	113.3	A59	A59-S63 WeakPolarHBondContact O-CB 3.22Å; A59-S63 PolarHBondContact O-N 3.17Å; A59-S63 PolarHBondContact O-OG 3.44Å
64	D	61.1	Low	73.3	Confident	128 Å²	128	114 Å²	114	68%	0.684	65%	0.652	S	S	*	*	H	α-helix	trans	-77.7	-37.5	174.7	-159.6	42.7	0	0	0	111.5	R60 N61 L62	R60-D64 PolarHBondContact O-N 2.77Å; N61-D64 WeakPolarHBondContact O-CB 3.23Å; N61-D64 PolarHBondContact O-N 2.86Å; L62-D64 PolarHBondContact O-N 3.12Å
65	I	59.1	Low	72.2	Confident	124 Å²	124	117 Å²	117	64%	0.636	66%	0.662	S	S	*	*	H	α-helix	trans	-77.4	-34.3	177.3	-67.4	167.3	0	0	0	112.4	N61 L62 L67	N61-I65 VanDerWaalsContact O-CG1 3.31Å; N61-I65 WeakPolarHBondContact O-CG1 3.21Å; N61-I65 PolarHBondContact O-N 2.72Å; L62-I65 PolarHBondContact O-N 3.39Å; I65-L67 PolarHBondContact O-N 2.91Å
66	D	57.9	Low	71	Confident	144 Å²	144	121.2 Å²	121.2	77%	0.77	68%	0.676	S	S	*	*	S	Bend	trans	-83.2	1.1	-179.8	-155.8	33.6	0	0	0	112.6	L62 M68	L62-D66 WeakPolarHBondContact O-CB 3.47Å; L62-D66 PolarHBondContact O-N 2.79Å; D66-M68 PolarHBondContact O-N 3.36Å
67	L	55.3	Low	69.6	Low	129 Å²	129	123.4 Å²	123.4	68%	0.675	69%	0.686	S	S	*	*			trans	-90.9	47.7	166.6	-150.8	76.5	0	0	0	111.6	I65 A69	I65-L67 PolarHBondContact O-N 2.91Å; L67-A69 HydrophobicContact CD1-CB 3.68Å; L67-A69 HydrophobicContact CG-CB 3.98Å; L67-A69 PolarHBondContact O-N 3.03Å
68	M	57.2	Low	68.2	Low	177 Å²	177	121.2 Å²	121.2	87%	0.872	69%	0.691	S	S	*	*			trans	-75.7	38	140.5	-72.4	-172.5	168.3	0	0	110.3	D66 P70	D66-M68 PolarHBondContact O-N 3.36Å; M68-P70 WeakPolarHBondContact O-CD 3.48Å
69	A	61.5	Low	66.7	Low	55 Å²	55	123.2 Å²	123.2	46%	0.455	71%	0.705	S	S	.	*	P	Polyproline II helix	trans	-57.9	123	161.4	0	0	0	0	0	106.2	L67 Q71	L67-A69 HydrophobicContact CD1-CB 3.68Å; L67-A69 HydrophobicContact CG-CB 3.98Å; L67-A69 PolarHBondContact O-N 3.03Å; A69-Q71 PolarHBondContact O-N 3.03Å
70	P	62.8	Low	65.2	Low	121 Å²	121	127.7 Å²	127.7	79%	0.786	72%	0.721	S	S	*	*	P	Polyproline II helix	trans	-50.7	125	174.6	-18.8	27.5	0	0	0	107.3	M68 P72	M68-P70 WeakPolarHBondContact O-CD 3.48Å; P70-P72 VanDerWaalsContact O-N 3.12Å
71	Q	67.9	Low	63.7	Low	181 Å²	181	122.5 Å²	122.5	85%	0.846	72%	0.718	S	S	*	*	P	Polyproline II helix	trans	-52.7	125.8	169.2	-67.2	-175.8	11	0	0	106.3	A69 G73	A69-Q71 PolarHBondContact O-N 3.03Å; Q71-G73 PolarHBondContact O-N 3.06Å
72	P	64.7	Low	62.4	Low	127 Å²	127	128 Å²	128	83%	0.825	75%	0.753	S	S	*	*	P	Polyproline II helix	trans	-55.6	122.2	177	20.9	-29.9	0	0	0	107.4	P70	P70-P72 VanDerWaalsContact O-N 3.12Å
73	G	68.2	Low	61.3	Low	79 Å²	79	130.8 Å²	130.8	81%	0.814	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-52.4	141.6	-164.9	0	0	0	0	0	113.6	Q71	Q71-G73 PolarHBondContact O-N 3.06Å
74	V	55	Low	61	Low	219 Å²	219	134.9 Å²	134.9	100%	1.327	79%	0.79	S	S	*	*			trans	-98.9	0	153.4	-66.3	0	0	0	0	109.1

Retrieved 74 of 74 residues in 53.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).