A0A068BC99_HUMAN Loading...

Truncated breast and ovarian cancer susceptibility protein 1

AlphaFold DB , UniProt , Accession A0A068BC99, Species HUMAN (Homo sapiens, Human), Gene BRCA1, Length 49 aa.

						>A0A068BC99_HUMAN|A0A068BC99|BRCA1
LLTKDRMNVEKAEFCNKSKQPGLARSQHNRWLEVRKHVMIGGLPAQKKR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	71.4	Confident	87.5	Confident	203 Å²	203	131.5 Å²	131.5	100%	1.063	65%	0.65	S	S	*	*				0	-25	0	-136.2	73.7	0	0	0	113.6	T3 K4 D5	L1-T3 PolarHBondContact O-N 3.48Å; L1-K4 PolarHBondContact O-N 3.33Å; L1-D5 PolarHBondContact O-N 3.04Å
2	L	73.8	Confident	88	Confident	148 Å²	148	124.8 Å²	124.8	78%	0.775	63%	0.631	S	S	*	*	H	α-helix	trans	-57.4	-36.1	-175.7	-163.9	70.2	0	0	0	115.4	K4 D5 R6	L2-K4 PolarHBondContact O-N 3.38Å; L2-D5 PolarHBondContact O-N 3.08Å; L2-R6 WeakPolarHBondContact O-CB 3.29Å; L2-R6 PolarHBondContact O-N 2.97Å
3	T	81.2	Confident	88.2	Confident	121 Å²	121	122.8 Å²	122.8	74%	0.742	62%	0.618	S	S	*	*	H	α-helix	trans	-68.2	-34.7	-177.1	-35.5	0	0	0	0	113.1	L1 M7	L1-T3 PolarHBondContact O-N 3.48Å; T3-M7 WeakPolarHBondContact O-CB 3.37Å; T3-M7 PolarHBondContact O-N 3.13Å; T3-M7 VanDerWaalsContact O-N 3.13Å
4	K	88.5	Confident	88	Confident	152 Å²	152	123.1 Å²	123.1	66%	0.661	61%	0.614	S	S	*	*	H	α-helix	trans	-77.4	-33.7	-179.5	-167.6	146.7	179.9	170.2	0	111.6	L1 L2 N8	L1-K4 PolarHBondContact O-N 3.33Å; L2-K4 PolarHBondContact O-N 3.38Å; K4-N8 WeakPolarHBondContact O-CB 3.5Å; K4-N8 PolarHBondContact O-N 3.46Å; K4-N8 VanDerWaalsContact O-N 3.08Å
5	D	90.9	Very high	87.8	Confident	106 Å²	106	118.6 Å²	118.6	57%	0.567	60%	0.598	S	S	*	*	H	α-helix	trans	-66	-48.8	173.6	-160.8	-100.9	0	0	0	111	L1 L2 M7 N8 V9	L1-D5 PolarHBondContact O-N 3.04Å; L2-D5 PolarHBondContact O-N 3.08Å; D5-M7 PolarHBondContact O-N 3.36Å; D5-N8 WeakPolarHBondContact O-CA 3.45Å; D5-N8 WeakPolarHBondContact O-CB 3.45Å; D5-N8 PolarHBondContact O-N 3.49Å; D5-V9 WeakPolarHBondContact O-CG2 3.47Å; D5-V9 PolarHBondContact O-N 3.35Å
6	R	92.4	Very high	87.8	Confident	177 Å²	177	117.3 Å²	117.3	67%	0.668	59%	0.593	S	S	*	*	H	α-helix	trans	-57.1	-46	175.6	-172.2	176.6	175.8	168.3	1.6	112.8	L2 N8 V9 E10	L2-R6 WeakPolarHBondContact O-CB 3.29Å; L2-R6 PolarHBondContact O-N 2.97Å; R6-N8 VanDerWaalsContact C-N 3.28Å; R6-N8 PolarHBondContact O-N 3.46Å; R6-V9 PolarHBondContact O-N 3.29Å; R6-E10 PolarHBondContact O-N 3.29Å
7	M	93.9	Very high	87.7	Confident	118 Å²	118	117.4 Å²	117.4	58%	0.581	59%	0.588	S	S	*	*	H	α-helix	trans	-63.9	-34.6	176.9	-172.9	177.1	72.2	0	0	112.3	T3 D5 K11	T3-M7 WeakPolarHBondContact O-CB 3.37Å; T3-M7 PolarHBondContact O-N 3.13Å; T3-M7 VanDerWaalsContact O-N 3.13Å; D5-M7 PolarHBondContact O-N 3.36Å; M7-K11 VanDerWaalsContact O-CB 3.29Å; M7-K11 WeakPolarHBondContact O-CB 3.48Å; M7-K11 PolarHBondContact O-N 3.03Å
8	N	93.3	Very high	87.3	Confident	96 Å²	96	112.9 Å²	112.9	51%	0.513	57%	0.57	S	S	.	*	H	α-helix	trans	-67.1	-39.9	175.6	-108.2	-26.2	0	0	0	111.8	K4 D5 R6 K11 A12	K4-N8 WeakPolarHBondContact O-CB 3.5Å; K4-N8 PolarHBondContact O-N 3.46Å; K4-N8 VanDerWaalsContact O-N 3.08Å; D5-N8 WeakPolarHBondContact O-CA 3.45Å; D5-N8 WeakPolarHBondContact O-CB 3.45Å; D5-N8 PolarHBondContact O-N 3.49Å; R6-N8 VanDerWaalsContact C-N 3.28Å; R6-N8 PolarHBondContact O-N 3.46Å; N8-K11 PolarHBondContact O-N 3.35Å; N8-A12 WeakPolarHBondContact O-CB 3.41Å; N8-A12 PolarHBondContact O-N 2.99Å
9	V	92.8	Very high	87	Confident	73 Å²	73	115.1 Å²	115.1	44%	0.442	58%	0.575	S	S	.	*	H	α-helix	trans	-61.7	-49.7	173.9	175.6	0	0	0	0	110.6	D5 R6 K11 A12 E13	D5-V9 WeakPolarHBondContact O-CG2 3.47Å; D5-V9 PolarHBondContact O-N 3.35Å; R6-V9 PolarHBondContact O-N 3.29Å; V9-K11 VanDerWaalsContact C-N 3.28Å; V9-K11 PolarHBondContact O-N 2.95Å; V9-A12 PolarHBondContact O-N 3.19Å; V9-A12 VanDerWaalsContact O-N 3.12Å; V9-E13 PolarHBondContact O-N 3.12Å
10	E	93.7	Very high	87	Confident	115 Å²	115	115.4 Å²	115.4	54%	0.537	58%	0.575	S	S	.	*	H	α-helix	trans	-59.3	-40	178	-71.8	179.8	92.1	0	0	112.1	R6 E13 F14	R6-E10 PolarHBondContact O-N 3.29Å; E10-E13 PolarHBondContact O-N 2.92Å; E10-F14 WeakPolarHBondContact O-CB 3.46Å; E10-F14 PolarHBondContact O-N 3.31Å
11	K	91	Very high	86.6	Confident	138 Å²	138	115.2 Å²	115.2	60%	0.6	58%	0.582	S	S	*	*	H	α-helix	trans	-66.4	-40.9	176.5	-166.3	176.3	-175.9	-179.6	0	111.9	M7 N8 V9 F14 C15	M7-K11 VanDerWaalsContact O-CB 3.29Å; M7-K11 WeakPolarHBondContact O-CB 3.48Å; M7-K11 PolarHBondContact O-N 3.03Å; N8-K11 PolarHBondContact O-N 3.35Å; V9-K11 VanDerWaalsContact C-N 3.28Å; V9-K11 PolarHBondContact O-N 2.95Å; K11-F14 PolarHBondContact O-N 3.49Å; K11-C15 WeakPolarHBondContact O-CB 3.24Å; K11-C15 PolarHBondContact O-N 2.98Å; K11-C15 PolarHBondContact O-SG 3.42Å
12	A	92.9	Very high	87	Confident	51 Å²	51	108.2 Å²	108.2	42%	0.421	56%	0.559	S	S	.	*	H	α-helix	trans	-64.6	-44	177.1	0	0	0	0	0	111.6	N8 V9 F14 C15 N16	N8-A12 WeakPolarHBondContact O-CB 3.41Å; N8-A12 PolarHBondContact O-N 2.99Å; V9-A12 PolarHBondContact O-N 3.19Å; V9-A12 VanDerWaalsContact O-N 3.12Å; A12-F14 PolarHBondContact O-N 3.41Å; A12-C15 PolarHBondContact O-N 3.47Å; A12-N16 VanDerWaalsContact O-CG 3.28Å; A12-N16 PolarHBondContact O-N 2.94Å; A12-N16 PolarHBondContact O-ND2 3.49Å
13	E	90.8	Very high	87.2	Confident	99 Å²	99	104.2 Å²	104.2	46%	0.463	54%	0.538	S	S	.	.	H	α-helix	trans	-61.3	-43.7	174.9	-72.2	-170.7	-179.5	0	0	112.2	V9 E10 N16 K17	V9-E13 PolarHBondContact O-N 3.12Å; E10-E13 PolarHBondContact O-N 2.92Å; E13-N16 PolarHBondContact O-N 3.07Å; E13-K17 WeakPolarHBondContact O-CG 3.49Å; E13-K17 PolarHBondContact O-N 3.3Å; E13-K17 IonicContact OE2-NZ 3.96Å
14	F	86	Confident	87	Confident	127 Å²	127	100.7 Å²	100.7	56%	0.557	52%	0.521	S	S	*	.	H	α-helix	trans	-61.2	-46.9	176.1	179.3	-96.3	0	0	0	111.7	E10 K11 A12 N16 K17 S18	E10-F14 WeakPolarHBondContact O-CB 3.46Å; E10-F14 PolarHBondContact O-N 3.31Å; K11-F14 PolarHBondContact O-N 3.49Å; A12-F14 PolarHBondContact O-N 3.41Å; F14-N16 VanDerWaalsContact C-N 3.29Å; F14-N16 PolarHBondContact O-N 3.41Å; F14-K17 PolarHBondContact O-N 3.01Å; F14-S18 WeakPolarHBondContact O-CB 3.21Å; F14-S18 PolarHBondContact O-N 3.22Å
15	C	85.1	Confident	86.6	Confident	55 Å²	55	102.3 Å²	102.3	37%	0.372	52%	0.523	S	S	.	.	H	α-helix	trans	-60.8	-38.3	177.3	-72.6	0	0	0	0	112.1	K11 A12 S18 K19	K11-C15 WeakPolarHBondContact O-CB 3.24Å; K11-C15 PolarHBondContact O-N 2.98Å; K11-C15 PolarHBondContact O-SG 3.42Å; A12-C15 PolarHBondContact O-N 3.47Å; C15-S18 PolarHBondContact O-N 3.12Å; C15-K19 VanDerWaalsContact O-CG 3.24Å; C15-K19 WeakPolarHBondContact O-CG 3.39Å; C15-K19 PolarHBondContact O-N 3Å; C15-K19 VanDerWaalsContact O-N 3.07Å
16	N	87.6	Confident	86	Confident	98 Å²	98	100.6 Å²	100.6	52%	0.524	52%	0.519	S	S	.	.	H	α-helix	trans	-67.8	-41.2	177.4	-71.5	-28	0	0	0	112.2	A12 E13 F14 K19	A12-N16 VanDerWaalsContact O-CG 3.28Å; A12-N16 PolarHBondContact O-N 2.94Å; A12-N16 PolarHBondContact O-ND2 3.49Å; E13-N16 PolarHBondContact O-N 3.07Å; F14-N16 VanDerWaalsContact C-N 3.29Å; F14-N16 PolarHBondContact O-N 3.41Å; N16-K19 PolarHBondContact O-N 3.31Å
17	K	85	Confident	85.5	Confident	119 Å²	119	96.3 Å²	96.3	52%	0.517	51%	0.507	S	S	.	.	H	α-helix	trans	-63.8	-43.4	173	-68.1	169.7	-172.9	169.7	0	110.9	E13 F14 K19 Q20 L23	E13-K17 WeakPolarHBondContact O-CG 3.49Å; E13-K17 PolarHBondContact O-N 3.3Å; E13-K17 IonicContact OE2-NZ 3.96Å; F14-K17 PolarHBondContact O-N 3.01Å; K17-K19 VanDerWaalsContact C-N 3.27Å; K17-K19 PolarHBondContact O-N 3.11Å; K17-Q20 WeakPolarHBondContact O-CB 3.36Å; K17-Q20 WeakPolarHBondContact O-CG 3.42Å; K17-Q20 PolarHBondContact O-N 3.34Å; K17-Q20 VanDerWaalsContact O-N 3.12Å; K17-L23 WeakPolarHBondContact O-CD2 3.42Å
18	S	80.6	Confident	85	Confident	37 Å²	37	95.4 Å²	95.4	26%	0.259	50%	0.501	S	S	.	.	H	α-helix	trans	-67.1	-21.6	179.9	-170.8	0	0	0	0	114.5	F14 C15 Q20 Q27	F14-S18 WeakPolarHBondContact O-CB 3.21Å; F14-S18 PolarHBondContact O-N 3.22Å; C15-S18 PolarHBondContact O-N 3.12Å; S18-Q20 PolarHBondContact O-N 3.41Å; S18-Q27 PolarHBondContact OG-NE2 2.94Å
19	K	82.7	Confident	84.3	Confident	153 Å²	153	94.7 Å²	94.7	67%	0.665	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74	-12.3	173.9	-74.9	167.2	-173	175.9	0	113.1	C15 N16 K17 P21	C15-K19 VanDerWaalsContact O-CG 3.24Å; C15-K19 WeakPolarHBondContact O-CG 3.39Å; C15-K19 PolarHBondContact O-N 3Å; C15-K19 VanDerWaalsContact O-N 3.07Å; N16-K19 PolarHBondContact O-N 3.31Å; K17-K19 VanDerWaalsContact C-N 3.27Å; K17-K19 PolarHBondContact O-N 3.11Å; K19-P21 WeakPolarHBondContact O-CD 3.37Å
20	Q	87.1	Confident	83.9	Confident	122 Å²	122	100.4 Å²	100.4	57%	0.57	51%	0.511	S	S	*	.	S	Bend	trans	-62.7	124	176.7	-70.2	-171.9	-24.8	0	0	109.9	K17 S18 G22 L23 A24	K17-Q20 WeakPolarHBondContact O-CB 3.36Å; K17-Q20 WeakPolarHBondContact O-CG 3.42Å; K17-Q20 PolarHBondContact O-N 3.34Å; K17-Q20 VanDerWaalsContact O-N 3.12Å; S18-Q20 PolarHBondContact O-N 3.41Å; Q20-G22 PolarHBondContact O-N 3.38Å; Q20-G22 VanDerWaalsContact O-N 3.13Å; Q20-L23 HydrophobicContact CB-CB 4.25Å; Q20-L23 PolarHBondContact O-N 3.27Å; Q20-A24 PolarHBondContact O-N 2.97Å
21	P	77.7	Confident	83.2	Confident	112 Å²	112	101 Å²	101	73%	0.727	51%	0.508	S	S	*	.	H	α-helix	trans	-59.7	-31.1	-173.6	17.4	-28.6	0	0	0	112.9	K19 R25	K19-P21 WeakPolarHBondContact O-CD 3.37Å; P21-R25 WeakPolarHBondContact O-CB 3.42Å; P21-R25 PolarHBondContact O-N 3.46Å; P21-R25 VanDerWaalsContact O-N 3.08Å
22	G	79.9	Confident	82.8	Confident	55 Å²	55	96.8 Å²	96.8	57%	0.567	49%	0.492	S	S	*	.	H	α-helix	trans	-66.3	-39	173.7	0	0	0	0	0	113.6	Q20 S26	Q20-G22 PolarHBondContact O-N 3.38Å; Q20-G22 VanDerWaalsContact O-N 3.13Å; G22-S26 PolarHBondContact O-N 2.98Å
23	L	78.3	Confident	82.2	Confident	65 Å²	65	98.4 Å²	98.4	34%	0.34	49%	0.491	S	S	.	.	H	α-helix	trans	-75.4	-38	178.7	-174.1	57.5	0	0	0	111.6	K17 Q20 R25 S26 Q27	K17-L23 WeakPolarHBondContact O-CD2 3.42Å; Q20-L23 HydrophobicContact CB-CB 4.25Å; Q20-L23 PolarHBondContact O-N 3.27Å; L23-R25 VanDerWaalsContact C-N 3.31Å; L23-R25 PolarHBondContact O-N 3.08Å; L23-S26 PolarHBondContact O-N 3.37Å; L23-Q27 HydrophobicContact CD1-CG 4.36Å; L23-Q27 WeakPolarHBondContact O-CB 3.34Å; L23-Q27 WeakPolarHBondContact O-CG 3.42Å; L23-Q27 PolarHBondContact O-N 2.84Å
24	A	77.6	Confident	81.8	Confident	47 Å²	47	97.5 Å²	97.5	39%	0.388	49%	0.492	S	S	.	.	H	α-helix	trans	-60.1	-42.2	173.1	0	0	0	0	0	111.5	Q20 H28	Q20-A24 PolarHBondContact O-N 2.97Å; A24-H28 WeakPolarHBondContact O-CB 3.44Å; A24-H28 PolarHBondContact O-N 3.13Å
25	R	78.5	Confident	81.4	Confident	185 Å²	185	93.6 Å²	93.6	70%	0.698	47%	0.473	S	S	*	.	H	α-helix	trans	-66.8	-40.7	176.4	-167.1	175.8	-174.9	-174.8	0.8	112.5	P21 L23 H28 N29	P21-R25 WeakPolarHBondContact O-CB 3.42Å; P21-R25 PolarHBondContact O-N 3.46Å; P21-R25 VanDerWaalsContact O-N 3.08Å; L23-R25 VanDerWaalsContact C-N 3.31Å; L23-R25 PolarHBondContact O-N 3.08Å; R25-H28 PolarHBondContact O-N 2.82Å; R25-N29 WeakPolarHBondContact O-CB 3.44Å; R25-N29 PolarHBondContact O-N 3.43Å; R25-N29 PolarHBondContact O-ND2 3.49Å
26	S	79.9	Confident	81	Confident	70 Å²	70	96.2 Å²	96.2	49%	0.49	48%	0.478	S	S	.	.	H	α-helix	trans	-65.4	-45.4	176.6	-177.8	0	0	0	0	112.3	G22 L23 H28 N29 R30	G22-S26 PolarHBondContact O-N 2.98Å; L23-S26 PolarHBondContact O-N 3.37Å; S26-H28 PolarHBondContact O-N 3.12Å; S26-N29 PolarHBondContact O-N 2.9Å; S26-R30 WeakPolarHBondContact O-CB 3.33Å; S26-R30 PolarHBondContact O-N 2.85Å
27	Q	81.6	Confident	80.4	Confident	88 Å²	88	97.9 Å²	97.9	41%	0.411	48%	0.483	S	S	.	.	H	α-helix	trans	-63.8	-40.5	174.7	-72.7	-172.6	88.8	0	0	112	S18 L23 R30 W31	S18-Q27 PolarHBondContact OG-NE2 2.94Å; L23-Q27 HydrophobicContact CD1-CG 4.36Å; L23-Q27 WeakPolarHBondContact O-CB 3.34Å; L23-Q27 WeakPolarHBondContact O-CG 3.42Å; L23-Q27 PolarHBondContact O-N 2.84Å; Q27-R30 PolarHBondContact O-N 2.9Å; Q27-W31 WeakPolarHBondContact O-CB 3.4Å; Q27-W31 PolarHBondContact O-N 3.32Å
28	H	82	Confident	80	Confident	98 Å²	98	97 Å²	97	45%	0.454	49%	0.487	S	S	.	.	H	α-helix	trans	-61.4	-46.7	174	-174.4	105.8	0	0	0	111.6	A24 R25 S26 R30 W31 L32	A24-H28 WeakPolarHBondContact O-CB 3.44Å; A24-H28 PolarHBondContact O-N 3.13Å; R25-H28 PolarHBondContact O-N 2.82Å; S26-H28 PolarHBondContact O-N 3.12Å; H28-R30 PolarHBondContact O-N 3.23Å; H28-W31 PolarHBondContact O-N 3.5Å; H28-L32 VanDerWaalsContact CD2-CD1 3.44Å; H28-L32 WeakPolarHBondContact CD2-CD1 3.1Å; H28-L32 WeakPolarHBondContact NE2-CD1 3.37Å; H28-L32 WeakPolarHBondContact O-CG 3.13Å; H28-L32 PolarHBondContact O-N 3.42Å
29	N	80.4	Confident	79.1	Confident	81 Å²	81	98.4 Å²	98.4	43%	0.433	49%	0.49	S	S	.	.	H	α-helix	trans	-60.5	-46.5	176.4	-72.5	-15.8	0	0	0	111.2	R25 S26 W31 L32 E33	R25-N29 WeakPolarHBondContact O-CB 3.44Å; R25-N29 PolarHBondContact O-N 3.43Å; R25-N29 PolarHBondContact O-ND2 3.49Å; S26-N29 PolarHBondContact O-N 2.9Å; N29-W31 VanDerWaalsContact C-N 3.3Å; N29-W31 PolarHBondContact O-N 3.41Å; N29-L32 CarbonylContact O-C 3.57Å; N29-L32 WeakPolarHBondContact O-CB 3.45Å; N29-L32 PolarHBondContact O-N 2.87Å; N29-L32 VanDerWaalsContact O-N 3.12Å; N29-E33 WeakPolarHBondContact O-CG 3.42Å; N29-E33 PolarHBondContact O-N 3.32Å
30	R	84.2	Confident	78.2	Confident	194 Å²	194	98.1 Å²	98.1	73%	0.732	50%	0.495	S	S	*	.	H	α-helix	trans	-60.7	-40.3	176	-174.2	174.6	179.9	-141.1	0.1	111.9	S26 Q27 H28 L32 E33 V34	S26-R30 WeakPolarHBondContact O-CB 3.33Å; S26-R30 PolarHBondContact O-N 2.85Å; Q27-R30 PolarHBondContact O-N 2.9Å; H28-R30 PolarHBondContact O-N 3.23Å; R30-L32 VanDerWaalsContact C-N 3.35Å; R30-E33 PolarHBondContact O-N 3.06Å; R30-V34 WeakPolarHBondContact O-CB 3.12Å; R30-V34 VanDerWaalsContact O-CG2 3.29Å; R30-V34 WeakPolarHBondContact O-CG2 3.47Å; R30-V34 PolarHBondContact O-N 3.09Å
31	W	78.8	Confident	77.3	Confident	127 Å²	127	95.8 Å²	95.8	48%	0.481	50%	0.503	S	S	.	.	H	α-helix	trans	-65.9	-38.1	175.2	-170.4	85.8	0	0	0	111.8	Q27 H28 N29 R35 Q46	Q27-W31 WeakPolarHBondContact O-CB 3.4Å; Q27-W31 PolarHBondContact O-N 3.32Å; H28-W31 PolarHBondContact O-N 3.5Å; N29-W31 VanDerWaalsContact C-N 3.3Å; N29-W31 PolarHBondContact O-N 3.41Å; W31-R35 HydrophobicContact CZ3-CB 4.49Å; W31-R35 WeakPolarHBondContact O-CB 3.44Å; W31-R35 PolarHBondContact O-N 2.72Å; W31-Q46 HydrophobicContact CZ3-CG 4.38Å
32	L	83.2	Confident	76.7	Confident	49 Å²	49	93 Å²	93	26%	0.257	49%	0.494	S	S	.	.	H	α-helix	trans	-66.2	-40.1	172.4	-71.8	-179.4	0	0	0	112.2	H28 N29 R30 R35 K36	H28-L32 VanDerWaalsContact CD2-CD1 3.44Å; H28-L32 WeakPolarHBondContact CD2-CD1 3.1Å; H28-L32 WeakPolarHBondContact NE2-CD1 3.37Å; H28-L32 WeakPolarHBondContact O-CG 3.13Å; H28-L32 PolarHBondContact O-N 3.42Å; N29-L32 CarbonylContact O-C 3.57Å; N29-L32 WeakPolarHBondContact O-CB 3.45Å; N29-L32 PolarHBondContact O-N 2.87Å; N29-L32 VanDerWaalsContact O-N 3.12Å; R30-L32 VanDerWaalsContact C-N 3.35Å; L32-R35 CarbonylContact O-C 3.55Å; L32-R35 PolarHBondContact O-N 3.47Å; L32-K36 WeakPolarHBondContact O-CB 3.41Å; L32-K36 WeakPolarHBondContact O-CG 3.29Å; L32-K36 PolarHBondContact O-N 3.35Å
33	E	79.9	Confident	75.4	Confident	86 Å²	86	96.8 Å²	96.8	40%	0.402	50%	0.501	S	S	.	.	H	α-helix	trans	-65	-48.8	175.6	-67.9	-49.9	110.3	0	0	110.8	N29 R30 R35 K36 H37	N29-E33 WeakPolarHBondContact O-CG 3.42Å; N29-E33 PolarHBondContact O-N 3.32Å; R30-E33 PolarHBondContact O-N 3.06Å; E33-R35 VanDerWaalsContact C-N 3.27Å; E33-R35 PolarHBondContact O-N 3.09Å; E33-K36 WeakPolarHBondContact O-CB 3.34Å; E33-K36 PolarHBondContact O-N 2.78Å; E33-K36 VanDerWaalsContact O-N 3.09Å; E33-K36 WeakPolarHBondContact OE1-CD 3.39Å; E33-K36 IonicContact OE1-NZ 2.71Å; E33-K36 PolarHBondContact OE1-NZ 2.71Å; E33-H37 PolarHBondContact O-CD2 2.81Å; E33-H37 PolarHBondContact O-N 2.88Å
34	V	82	Confident	74.8	Confident	80 Å²	80	98.3 Å²	98.3	49%	0.485	52%	0.515	S	S	.	.	H	α-helix	trans	-57.8	-44.2	173.3	171.4	0	0	0	0	110.2	R30 K36 H37 V38	R30-V34 WeakPolarHBondContact O-CB 3.12Å; R30-V34 VanDerWaalsContact O-CG2 3.29Å; R30-V34 WeakPolarHBondContact O-CG2 3.47Å; R30-V34 PolarHBondContact O-N 3.09Å; V34-K36 PolarHBondContact O-N 3.35Å; V34-H37 PolarHBondContact O-N 3.34Å; V34-V38 HydrophobicContact CG1-CG2 4.13Å; V34-V38 VanDerWaalsContact O-CB 3.24Å; V34-V38 WeakPolarHBondContact O-CB 3.5Å; V34-V38 WeakPolarHBondContact O-CG2 3.13Å; V34-V38 PolarHBondContact O-N 3.39Å
35	R	78.4	Confident	73.8	Confident	45 Å²	45	99.6 Å²	99.6	17%	0.17	53%	0.525	C	S	.	.	H	α-helix	trans	-63.5	-39.8	176.1	-172.1	-178.3	-177.3	167.5	11.7	111.8	W31 L32 E33 V38 M39 L43 A45	W31-R35 HydrophobicContact CZ3-CB 4.49Å; W31-R35 WeakPolarHBondContact O-CB 3.44Å; W31-R35 PolarHBondContact O-N 2.72Å; L32-R35 CarbonylContact O-C 3.55Å; L32-R35 PolarHBondContact O-N 3.47Å; E33-R35 VanDerWaalsContact C-N 3.27Å; E33-R35 PolarHBondContact O-N 3.09Å; R35-V38 CarbonylContact O-C 3.56Å; R35-V38 PolarHBondContact O-N 2.68Å; R35-M39 HydrophobicContact CG-CE 4.11Å; R35-M39 HydrophobicContact CG-CG 4.02Å; R35-M39 HydrophobicContact CG-SD 4.12Å; R35-M39 WeakPolarHBondContact O-CA 3.16Å; R35-M39 WeakPolarHBondContact O-CB 3.24Å; R35-M39 WeakPolarHBondContact O-CG 3.48Å; R35-M39 PolarHBondContact O-N 3.37Å; R35-L43 PolarHBondContact NH2-O 3.31Å; R35-L43 VanDerWaalsContact NH2-O 3.09Å; R35-A45 PolarHBondContact NH1-O 2.79Å; R35-A45 PolarHBondContact NH2-O 2.85Å; R35-A45 VanDerWaalsContact NH2-O 3.11Å
36	K	75.9	Confident	73.2	Confident	109 Å²	109	96.6 Å²	96.6	47%	0.474	52%	0.519	S	S	.	.	H	α-helix	trans	-64.4	-44.6	176.7	-76.9	167.8	-174.3	175.3	0	111	L32 E33 V34 M39 I40	L32-K36 WeakPolarHBondContact O-CB 3.41Å; L32-K36 WeakPolarHBondContact O-CG 3.29Å; L32-K36 PolarHBondContact O-N 3.35Å; E33-K36 WeakPolarHBondContact O-CB 3.34Å; E33-K36 PolarHBondContact O-N 2.78Å; E33-K36 VanDerWaalsContact O-N 3.09Å; E33-K36 WeakPolarHBondContact OE1-CD 3.39Å; E33-K36 IonicContact OE1-NZ 2.71Å; E33-K36 PolarHBondContact OE1-NZ 2.71Å; V34-K36 PolarHBondContact O-N 3.35Å; K36-M39 HydrophobicContact CG-CE 4.14Å; K36-M39 PolarHBondContact O-N 3Å; K36-I40 PolarHBondContact O-N 2.95Å
37	H	74.4	Confident	72.2	Confident	133 Å²	133	102.2 Å²	102.2	62%	0.616	54%	0.535	S	S	*	.	H	α-helix	trans	-65.4	-37.9	174.9	-79.2	-76.8	0	0	0	112.1	E33 V34 I40	E33-H37 PolarHBondContact O-CD2 2.81Å; E33-H37 PolarHBondContact O-N 2.88Å; V34-H37 PolarHBondContact O-N 3.34Å; H37-I40 WeakPolarHBondContact O-CB 3.47Å; H37-I40 WeakPolarHBondContact O-CG1 3.49Å
38	V	77.1	Confident	71.2	Confident	102 Å²	102	107.7 Å²	107.7	62%	0.618	56%	0.557	S	S	*	*	H	α-helix	trans	-73.9	-31.4	174.7	170.8	0	0	0	0	111.8	V34 R35 I40 G41	V34-V38 HydrophobicContact CG1-CG2 4.13Å; V34-V38 VanDerWaalsContact O-CB 3.24Å; V34-V38 WeakPolarHBondContact O-CB 3.5Å; V34-V38 WeakPolarHBondContact O-CG2 3.13Å; V34-V38 PolarHBondContact O-N 3.39Å; R35-V38 CarbonylContact O-C 3.56Å; R35-V38 PolarHBondContact O-N 2.68Å; V38-I40 PolarHBondContact O-N 2.9Å; V38-G41 PolarHBondContact O-N 3.06Å
39	M	61.2	Low	69.8	Low	65 Å²	65	117.6 Å²	117.6	32%	0.32	59%	0.591	S	S	.	*	G	3₁₀ helix	trans	-71	-7.5	178.1	-85.4	-170.2	-51.1	0	0	113.5	R35 K36 G41 G42 P44	R35-M39 HydrophobicContact CG-CE 4.11Å; R35-M39 HydrophobicContact CG-CG 4.02Å; R35-M39 HydrophobicContact CG-SD 4.12Å; R35-M39 WeakPolarHBondContact O-CA 3.16Å; R35-M39 WeakPolarHBondContact O-CB 3.24Å; R35-M39 WeakPolarHBondContact O-CG 3.48Å; R35-M39 PolarHBondContact O-N 3.37Å; K36-M39 HydrophobicContact CG-CE 4.14Å; K36-M39 PolarHBondContact O-N 3Å; M39-G41 PolarHBondContact O-N 3.23Å; M39-G42 PolarHBondContact O-N 3.44Å; M39-P44 HydrophobicContact SD-CB 3.76Å; M39-P44 HydrophobicContact SD-CG 4.43Å
40	I	64.5	Low	69.3	Low	148 Å²	148	119.4 Å²	119.4	76%	0.759	60%	0.599	S	S	*	*	G	3₁₀ helix	trans	-55.4	-17.7	160.6	-60	176.6	0	0	0	110.3	K36 H37 V38	K36-I40 PolarHBondContact O-N 2.95Å; H37-I40 WeakPolarHBondContact O-CB 3.47Å; H37-I40 WeakPolarHBondContact O-CG1 3.49Å; V38-I40 PolarHBondContact O-N 2.9Å
41	G	68.6	Low	68.5	Low	72 Å²	72	115.5 Å²	115.5	74%	0.742	59%	0.592	S	S	*	*	G	3₁₀ helix	trans	-110	13.8	170.4	0	0	0	0	0	117.7	V38 M39	V38-G41 PolarHBondContact O-N 3.06Å; M39-G41 PolarHBondContact O-N 3.23Å
42	G	64.5	Low	67.9	Low	53 Å²	53	114.8 Å²	114.8	55%	0.546	60%	0.598	S	S	.	*	S	Bend	trans	89.2	107	168.3	0	0	0	0	0	118.5	M39	M39-G42 PolarHBondContact O-N 3.44Å
43	L	52.3	Low	67	Low	136 Å²	136	118.7 Å²	118.7	71%	0.712	62%	0.618	S	S	*	*			trans	159.7	104.7	137.1	-97.6	142.9	0	0	0	112.3	R35	R35-L43 PolarHBondContact NH2-O 3.31Å; R35-L43 VanDerWaalsContact NH2-O 3.09Å
44	P	65.3	Low	66.2	Low	97 Å²	97	120.8 Å²	120.8	63%	0.63	63%	0.631	S	S	*	*			trans	-86.1	136.4	156.3	33.3	-25.3	0	0	0	108.2	M39	M39-P44 HydrophobicContact SD-CB 3.76Å; M39-P44 HydrophobicContact SD-CG 4.43Å
45	A	56.4	Low	65.1	Low	73 Å²	73	123.5 Å²	123.5	60%	0.603	64%	0.641	S	S	*	*				-159	156.3	81.9	0	0	0	0	0	111.5	R35	R35-A45 PolarHBondContact NH1-O 2.79Å; R35-A45 PolarHBondContact NH2-O 2.85Å; R35-A45 VanDerWaalsContact NH2-O 3.11Å
46	Q	65.6	Low	64.2	Low	122 Å²	122	129.1 Å²	129.1	57%	0.57	68%	0.675	S	S	*	*			trans	-89.7	108.9	153.1	-79.1	-68.7	-33.7	0	0	106	W31 K48	W31-Q46 HydrophobicContact CZ3-CG 4.38Å; Q46-K48 PolarHBondContact O-N 3.37Å
47	K	59	Low	63.3	Low	189 Å²	189	130.6 Å²	130.6	82%	0.822	69%	0.69	S	S	*	*			trans	-80.3	105.8	169.3	-177.6	156	-177	165.6	0	107.8	R49	K47-R49 PolarHBondContact O-N 3.16Å
48	K	62.3	Low	62.4	Low	202 Å²	202	130.4 Å²	130.4	88%	0.878	70%	0.696	S	S	*	*			trans	-74.3	118.8	170.8	-156.4	157.1	-179.6	178.1	0	107.3	Q46	Q46-K48 PolarHBondContact O-N 3.37Å
49	R	51.4	Low	61	Low	306 Å²	306	133 Å²	133	100%	1.155	70%	0.703	S	S	*	*			trans	-84.5	0	167.8	-69.8	-176.6	76	168.7	3.6	109.2	K47	K47-R49 PolarHBondContact O-N 3.16Å

Retrieved 49 of 49 residues in 15.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).