A0A068BEU4_HUMAN Loading...

Truncated breast and ovarian cancer susceptibility protein 2

AlphaFold DB , UniProt , Accession A0A068BEU4, Species HUMAN (Homo sapiens, Human), Gene BRCA2, Length 58 aa.

						>A0A068BEU4_HUMAN|A0A068BEU4|BRCA2
LITSLQNARDIQDMRIKKETKATRLSTARQSVSCKNIHSASNLSESSSRRPSSLCVFS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	65.1	Low	76.6	Confident	180 Å²	180	111.1 Å²	111.1	94%	0.942	59%	0.588	S	S	*	*				0	-54.8	0	-88.6	155	0	0	0	112	T3 S4 L5	L1-T3 PolarHBondContact O-N 3.28Å; L1-S4 PolarHBondContact O-N 3.03Å; L1-L5 PolarHBondContact O-N 2.97Å
2	I	75.8	Confident	76.8	Confident	128 Å²	128	110.5 Å²	110.5	66%	0.656	58%	0.58	S	S	*	*	H	α-helix	trans	-59.2	-45.7	178.9	-66.8	165.2	0	0	0	112.4	S4 L5 Q6	I2-S4 VanDerWaalsContact C-N 3.25Å; I2-S4 PolarHBondContact O-N 3.08Å; I2-L5 WeakPolarHBondContact O-CB 3.45Å; I2-L5 PolarHBondContact O-N 3.12Å; I2-Q6 VanDerWaalsContact CG2-OE1 3.24Å; I2-Q6 PolarHBondContact O-N 3.19Å; I2-Q6 VanDerWaalsContact O-N 3.08Å; I2-Q6 PolarHBondContact O-OE1 3.48Å
3	T	72.6	Confident	77.1	Confident	108 Å²	108	108.2 Å²	108.2	66%	0.663	57%	0.569	S	S	*	*	H	α-helix	trans	-58.2	-33.2	179	-4.9	0	0	0	0	114	L1 N7	L1-T3 PolarHBondContact O-N 3.28Å; T3-N7 PolarHBondContact O-N 3.45Å; T3-N7 VanDerWaalsContact O-N 3.12Å
4	S	72.3	Confident	77.5	Confident	81 Å²	81	108.1 Å²	108.1	57%	0.566	57%	0.566	S	S	*	*	H	α-helix	trans	-72.8	-31.7	178.4	-48.9	0	0	0	0	112.1	L1 I2 A8	L1-S4 PolarHBondContact O-N 3.03Å; I2-S4 VanDerWaalsContact C-N 3.25Å; I2-S4 PolarHBondContact O-N 3.08Å; S4-A8 PolarHBondContact O-N 3.09Å
5	L	78.5	Confident	77.5	Confident	119 Å²	119	112.6 Å²	112.6	62%	0.623	57%	0.572	S	S	*	*	H	α-helix	trans	-74.5	-40.1	175.4	-65.1	172.3	0	0	0	111.2	L1 I2 A8 R9	L1-L5 PolarHBondContact O-N 2.97Å; I2-L5 WeakPolarHBondContact O-CB 3.45Å; I2-L5 PolarHBondContact O-N 3.12Å; L5-A8 PolarHBondContact O-N 3.1Å; L5-R9 WeakPolarHBondContact O-CG 3.23Å; L5-R9 PolarHBondContact O-N 3.33Å; L5-R9 VanDerWaalsContact O-N 3.1Å
6	Q	74.1	Confident	77.3	Confident	108 Å²	108	111.6 Å²	111.6	51%	0.505	57%	0.567	S	S	.	*	H	α-helix	trans	-57.9	-50	171.8	-106.7	78.8	23	0	0	111.7	I2 A8 R9 D10	I2-Q6 VanDerWaalsContact CG2-OE1 3.24Å; I2-Q6 PolarHBondContact O-N 3.19Å; I2-Q6 VanDerWaalsContact O-N 3.08Å; I2-Q6 PolarHBondContact O-OE1 3.48Å; Q6-A8 VanDerWaalsContact C-N 3.29Å; Q6-A8 PolarHBondContact O-N 3.28Å; Q6-R9 WeakPolarHBondContact O-CB 3.42Å; Q6-R9 PolarHBondContact O-N 3.22Å; Q6-R9 VanDerWaalsContact O-N 3.09Å; Q6-D10 PolarHBondContact O-N 3.15Å
7	N	79.3	Confident	77	Confident	101 Å²	101	112.5 Å²	112.5	54%	0.54	57%	0.566	S	S	.	*	H	α-helix	trans	-59.2	-38.3	177.9	-92.7	33	0	0	0	113	T3 R9 I11	T3-N7 PolarHBondContact O-N 3.45Å; T3-N7 VanDerWaalsContact O-N 3.12Å; N7-R9 VanDerWaalsContact C-N 3.35Å; N7-I11 WeakPolarHBondContact O-CD1 3.47Å; N7-I11 VanDerWaalsContact O-CG1 3.23Å; N7-I11 WeakPolarHBondContact O-CG1 3.35Å; N7-I11 PolarHBondContact O-N 3.01Å; N7-I11 VanDerWaalsContact O-N 3.15Å
8	A	77	Confident	76.4	Confident	48 Å²	48	114.4 Å²	114.4	40%	0.397	57%	0.57	S	S	.	*	H	α-helix	trans	-66.5	-37.1	177.7	0	0	0	0	0	112.2	S4 L5 Q6 Q12	S4-A8 PolarHBondContact O-N 3.09Å; L5-A8 PolarHBondContact O-N 3.1Å; Q6-A8 VanDerWaalsContact C-N 3.29Å; Q6-A8 PolarHBondContact O-N 3.28Å; A8-Q12 WeakPolarHBondContact O-CG 3.29Å; A8-Q12 PolarHBondContact O-N 3.15Å; A8-Q12 VanDerWaalsContact O-N 3.15Å
9	R	82.6	Confident	76	Confident	169 Å²	169	115.4 Å²	115.4	64%	0.638	57%	0.573	S	S	*	*	H	α-helix	trans	-66.3	-45.8	175.5	-69.3	-66	-168.9	171	4	111.7	L5 Q6 N7 I11 Q12 D13	L5-R9 WeakPolarHBondContact O-CG 3.23Å; L5-R9 PolarHBondContact O-N 3.33Å; L5-R9 VanDerWaalsContact O-N 3.1Å; Q6-R9 WeakPolarHBondContact O-CB 3.42Å; Q6-R9 PolarHBondContact O-N 3.22Å; Q6-R9 VanDerWaalsContact O-N 3.09Å; N7-R9 VanDerWaalsContact C-N 3.35Å; R9-I11 VanDerWaalsContact C-N 3.3Å; R9-I11 PolarHBondContact O-N 3.08Å; R9-Q12 PolarHBondContact O-N 3.33Å; R9-Q12 VanDerWaalsContact O-N 3.13Å; R9-D13 PolarHBondContact O-N 2.97Å
10	D	82	Confident	75.3	Confident	92 Å²	92	113.3 Å²	113.3	49%	0.492	57%	0.567	S	S	.	*	H	α-helix	trans	-62.4	-38.8	179.8	-66.3	-31.6	0	0	0	112	Q6 D13 M14	Q6-D10 PolarHBondContact O-N 3.15Å; D10-D13 PolarHBondContact O-N 2.94Å; D10-M14 WeakPolarHBondContact O-CB 3.29Å; D10-M14 VanDerWaalsContact O-CG 3.24Å; D10-M14 WeakPolarHBondContact O-CG 3.38Å; D10-M14 PolarHBondContact O-N 2.89Å
11	I	83.3	Confident	74.6	Confident	88 Å²	88	115 Å²	115	45%	0.451	57%	0.571	S	S	.	*	H	α-helix	trans	-65.5	-41.1	176	-68	167	0	0	0	111	N7 R9 R15	N7-I11 WeakPolarHBondContact O-CD1 3.47Å; N7-I11 VanDerWaalsContact O-CG1 3.23Å; N7-I11 WeakPolarHBondContact O-CG1 3.35Å; N7-I11 PolarHBondContact O-N 3.01Å; N7-I11 VanDerWaalsContact O-N 3.15Å; R9-I11 VanDerWaalsContact C-N 3.3Å; R9-I11 PolarHBondContact O-N 3.08Å; I11-R15 VanDerWaalsContact O-CG 3.29Å; I11-R15 WeakPolarHBondContact O-CG 3.48Å; I11-R15 PolarHBondContact O-N 3.15Å; I11-R15 VanDerWaalsContact O-N 3.15Å
12	Q	78.9	Confident	74.4	Confident	104 Å²	104	109.2 Å²	109.2	49%	0.486	55%	0.549	S	S	.	.	H	α-helix	trans	-65.2	-47.1	176.5	-75.9	-178.6	-8.2	0	0	111.5	A8 R9 M14 R15 I16	A8-Q12 WeakPolarHBondContact O-CG 3.29Å; A8-Q12 PolarHBondContact O-N 3.15Å; A8-Q12 VanDerWaalsContact O-N 3.15Å; R9-Q12 PolarHBondContact O-N 3.33Å; R9-Q12 VanDerWaalsContact O-N 3.13Å; Q12-M14 VanDerWaalsContact C-N 3.29Å; Q12-M14 PolarHBondContact O-N 3.13Å; Q12-R15 WeakPolarHBondContact O-CB 3.4Å; Q12-R15 PolarHBondContact O-N 3.35Å; Q12-R15 VanDerWaalsContact O-N 3.08Å; Q12-I16 WeakPolarHBondContact O-CG1 3.33Å; Q12-I16 PolarHBondContact O-N 3.01Å
13	D	80.8	Confident	73.6	Confident	81 Å²	81	107 Å²	107	43%	0.433	54%	0.541	S	S	.	.	H	α-helix	trans	-60.7	-38.7	179.4	-82.4	6.8	0	0	0	112.1	R9 D10 K17	R9-D13 PolarHBondContact O-N 2.97Å; D10-D13 PolarHBondContact O-N 2.94Å; D13-K17 WeakPolarHBondContact O-CB 3.35Å; D13-K17 VanDerWaalsContact O-CG 3.29Å; D13-K17 WeakPolarHBondContact O-CG 3.25Å; D13-K17 PolarHBondContact O-N 3.49Å
14	M	82.4	Confident	72.9	Confident	107 Å²	107	110.8 Å²	110.8	53%	0.527	54%	0.543	S	S	.	.	H	α-helix	trans	-67	-36.7	175.5	-75	-65.9	-73.5	0	0	112.7	D10 Q12 K18	D10-M14 WeakPolarHBondContact O-CB 3.29Å; D10-M14 VanDerWaalsContact O-CG 3.24Å; D10-M14 WeakPolarHBondContact O-CG 3.38Å; D10-M14 PolarHBondContact O-N 2.89Å; Q12-M14 VanDerWaalsContact C-N 3.29Å; Q12-M14 PolarHBondContact O-N 3.13Å; M14-K18 WeakPolarHBondContact O-CG 3.24Å; M14-K18 PolarHBondContact O-N 3.3Å; M14-K18 VanDerWaalsContact O-N 3.13Å
15	R	78.5	Confident	72.2	Confident	175 Å²	175	112.1 Å²	112.1	66%	0.66	54%	0.544	S	S	*	.	H	α-helix	trans	-67.2	-47.3	175.6	-72.1	173.2	-174.9	-157.4	2.1	110.9	I11 Q12 K17 K18 E19	I11-R15 VanDerWaalsContact O-CG 3.29Å; I11-R15 WeakPolarHBondContact O-CG 3.48Å; I11-R15 PolarHBondContact O-N 3.15Å; I11-R15 VanDerWaalsContact O-N 3.15Å; Q12-R15 WeakPolarHBondContact O-CB 3.4Å; Q12-R15 PolarHBondContact O-N 3.35Å; Q12-R15 VanDerWaalsContact O-N 3.08Å; R15-K17 PolarHBondContact O-N 3.29Å; R15-K18 PolarHBondContact O-N 3.27Å; R15-K18 VanDerWaalsContact O-N 3.15Å; R15-E19 WeakPolarHBondContact O-CB 3.4Å; R15-E19 PolarHBondContact O-N 2.92Å
16	I	74.3	Confident	71.2	Confident	96 Å²	96	109.1 Å²	109.1	49%	0.492	53%	0.533	S	S	.	.	H	α-helix	trans	-60.4	-44.6	178.4	-65.6	165.1	0	0	0	110.9	Q12 K18 E19 T20	Q12-I16 WeakPolarHBondContact O-CG1 3.33Å; Q12-I16 PolarHBondContact O-N 3.01Å; I16-K18 VanDerWaalsContact C-N 3.33Å; I16-K18 PolarHBondContact O-N 2.96Å; I16-E19 PolarHBondContact O-N 3.41Å; I16-T20 WeakPolarHBondContact O-CB 3.4Å; I16-T20 PolarHBondContact O-N 3.41Å; I16-T20 PolarHBondContact O-OG1 3.15Å
17	K	71.8	Confident	70.5	Confident	127 Å²	127	108 Å²	108	55%	0.552	53%	0.534	S	S	*	.	H	α-helix	trans	-62.5	-37.5	176.8	-76.8	173.5	-177.9	170.3	0	112.7	D13 R15 K21	D13-K17 WeakPolarHBondContact O-CB 3.35Å; D13-K17 VanDerWaalsContact O-CG 3.29Å; D13-K17 WeakPolarHBondContact O-CG 3.25Å; D13-K17 PolarHBondContact O-N 3.49Å; R15-K17 PolarHBondContact O-N 3.29Å; K17-K21 WeakPolarHBondContact O-CG 3.49Å; K17-K21 PolarHBondContact O-N 3.42Å
18	K	66.3	Low	69.3	Low	148 Å²	148	105.8 Å²	105.8	64%	0.643	53%	0.529	S	S	*	.	H	α-helix	trans	-70.8	-44.3	177.4	-76.8	-179.8	178.8	-175.3	0	111.8	M14 R15 I16 K21 A22	M14-K18 WeakPolarHBondContact O-CG 3.24Å; M14-K18 PolarHBondContact O-N 3.3Å; M14-K18 VanDerWaalsContact O-N 3.13Å; R15-K18 PolarHBondContact O-N 3.27Å; R15-K18 VanDerWaalsContact O-N 3.15Å; I16-K18 VanDerWaalsContact C-N 3.33Å; I16-K18 PolarHBondContact O-N 2.96Å; K18-K21 PolarHBondContact O-N 3.02Å; K18-A22 PolarHBondContact O-N 2.74Å
19	E	67.8	Low	68.2	Low	133 Å²	133	112.9 Å²	112.9	62%	0.621	55%	0.545	S	S	*	.	H	α-helix	trans	-62	-45.7	177.6	-170.9	173.9	-179.3	0	0	111.2	R15 I16 K21 A22 T23	R15-E19 WeakPolarHBondContact O-CB 3.4Å; R15-E19 PolarHBondContact O-N 2.92Å; I16-E19 PolarHBondContact O-N 3.41Å; E19-K21 VanDerWaalsContact C-N 3.3Å; E19-K21 PolarHBondContact O-N 2.95Å; E19-A22 PolarHBondContact O-N 2.92Å; E19-A22 VanDerWaalsContact O-N 3.12Å; E19-T23 PolarHBondContact O-N 3.42Å; E19-T23 PolarHBondContact O-OG1 3.05Å
20	T	63.8	Low	66.9	Low	72 Å²	72	110.4 Å²	110.4	44%	0.442	54%	0.541	S	S	.	.	H	α-helix	trans	-59.8	-39.5	177.4	-53.5	0	0	0	0	112.2	I16 R24	I16-T20 WeakPolarHBondContact O-CB 3.4Å; I16-T20 PolarHBondContact O-N 3.41Å; I16-T20 PolarHBondContact O-OG1 3.15Å; T20-R24 WeakPolarHBondContact O-CB 3.37Å; T20-R24 VanDerWaalsContact O-CG 3.25Å; T20-R24 WeakPolarHBondContact O-CG 3.39Å; T20-R24 PolarHBondContact O-N 3.13Å
21	K	60.8	Low	65.5	Low	150 Å²	150	109 Å²	109	65%	0.652	54%	0.538	S	S	*	.	H	α-helix	trans	-68.4	-41.3	176.6	-75.5	179.4	-179.7	-175	0	111.7	K17 K18 E19 L25	K17-K21 WeakPolarHBondContact O-CG 3.49Å; K17-K21 PolarHBondContact O-N 3.42Å; K18-K21 PolarHBondContact O-N 3.02Å; E19-K21 VanDerWaalsContact C-N 3.3Å; E19-K21 PolarHBondContact O-N 2.95Å; K21-L25 WeakPolarHBondContact O-CB 3.37Å; K21-L25 WeakPolarHBondContact O-CG 3.38Å; K21-L25 PolarHBondContact O-N 3.19Å
22	A	60.1	Low	64.2	Low	59 Å²	59	109 Å²	109	49%	0.488	54%	0.542	S	S	.	.	H	α-helix	trans	-63.9	-43.9	176	0	0	0	0	0	111.6	K18 E19 L25 S26	K18-A22 PolarHBondContact O-N 2.74Å; E19-A22 PolarHBondContact O-N 2.92Å; E19-A22 VanDerWaalsContact O-N 3.12Å; A22-L25 PolarHBondContact O-N 2.92Å; A22-S26 WeakPolarHBondContact O-CB 3.33Å; A22-S26 PolarHBondContact O-N 3.12Å
23	T	58.6	Low	62.8	Low	80 Å²	80	107.1 Å²	107.1	49%	0.491	54%	0.541	S	S	.	.	H	α-helix	trans	-63.1	-47	176.6	-55.9	0	0	0	0	111.3	E19 L25 S26 T27	E19-T23 PolarHBondContact O-N 3.42Å; E19-T23 PolarHBondContact O-OG1 3.05Å; T23-L25 VanDerWaalsContact C-N 3.32Å; T23-L25 PolarHBondContact O-N 2.84Å; T23-S26 PolarHBondContact O-N 3.37Å; T23-T27 PolarHBondContact O-N 3.32Å; T23-T27 PolarHBondContact O-OG1 2.98Å; T23-T27 VanDerWaalsContact O-OG1 3.05Å
24	R	57.7	Low	61.6	Low	188 Å²	188	107.4 Å²	107.4	71%	0.709	55%	0.548	S	S	*	.	H	α-helix	trans	-61.6	-38.1	176.4	-72	-179.8	76.2	178.3	4.3	112.7	T20 A28	T20-R24 WeakPolarHBondContact O-CB 3.37Å; T20-R24 VanDerWaalsContact O-CG 3.25Å; T20-R24 WeakPolarHBondContact O-CG 3.39Å; T20-R24 PolarHBondContact O-N 3.13Å; R24-A28 VanDerWaalsContact O-CB 3.24Å; R24-A28 WeakPolarHBondContact O-CB 3.27Å; R24-A28 PolarHBondContact O-N 3.12Å
25	L	57.6	Low	60.2	Low	109 Å²	109	109.2 Å²	109.2	57%	0.571	55%	0.553	S	S	*	*	H	α-helix	trans	-69.3	-37.6	175.3	-81.1	163.8	0	0	0	112.5	K21 A22 T23 R29	K21-L25 WeakPolarHBondContact O-CB 3.37Å; K21-L25 WeakPolarHBondContact O-CG 3.38Å; K21-L25 PolarHBondContact O-N 3.19Å; A22-L25 PolarHBondContact O-N 2.92Å; T23-L25 VanDerWaalsContact C-N 3.32Å; T23-L25 PolarHBondContact O-N 2.84Å; L25-R29 WeakPolarHBondContact O-CB 3.24Å; L25-R29 VanDerWaalsContact O-CG 3.32Å; L25-R29 WeakPolarHBondContact O-CG 3.32Å; L25-R29 PolarHBondContact O-N 3.02Å
26	S	58.3	Low	59	Low	57 Å²	57	106.2 Å²	106.2	40%	0.399	55%	0.55	S	S	.	.	H	α-helix	trans	-63.7	-50.1	174.8	-171.4	0	0	0	0	110.8	A22 T23 A28 R29 Q30	A22-S26 WeakPolarHBondContact O-CB 3.33Å; A22-S26 PolarHBondContact O-N 3.12Å; T23-S26 PolarHBondContact O-N 3.37Å; S26-A28 PolarHBondContact O-N 3.39Å; S26-R29 PolarHBondContact O-N 2.94Å; S26-Q30 WeakPolarHBondContact O-CB 3.27Å; S26-Q30 VanDerWaalsContact O-CG 3.27Å; S26-Q30 WeakPolarHBondContact O-CG 3.46Å; S26-Q30 PolarHBondContact O-N 3.49Å; S26-Q30 PolarHBondContact OG-NE2 2.86Å
27	T	58.3	Low	57.9	Low	85 Å²	85	106.6 Å²	106.6	52%	0.521	55%	0.552	S	S	.	*	H	α-helix	trans	-61.7	-41.5	176.6	-51	0	0	0	0	112	T23 Q30 S31	T23-T27 PolarHBondContact O-N 3.32Å; T23-T27 PolarHBondContact O-OG1 2.98Å; T23-T27 VanDerWaalsContact O-OG1 3.05Å; T27-Q30 PolarHBondContact O-N 3.35Å; T27-S31 VanDerWaalsContact O-CB 3.27Å; T27-S31 WeakPolarHBondContact O-CB 3.41Å; T27-S31 PolarHBondContact O-N 2.87Å
28	A	55.4	Low	56.7	Low	53 Å²	53	106.7 Å²	106.7	44%	0.438	55%	0.554	S	S	.	*	H	α-helix	trans	-66.1	-42.5	177.7	0	0	0	0	0	112.4	R24 S26 S31 V32	R24-A28 VanDerWaalsContact O-CB 3.24Å; R24-A28 WeakPolarHBondContact O-CB 3.27Å; R24-A28 PolarHBondContact O-N 3.12Å; S26-A28 PolarHBondContact O-N 3.39Å; A28-S31 PolarHBondContact O-N 3.5Å; A28-V32 WeakPolarHBondContact O-CG2 3.34Å; A28-V32 PolarHBondContact O-N 3.31Å; A28-V32 VanDerWaalsContact O-N 3.12Å
29	R	54.3	Low	55.9	Low	197 Å²	197	103.9 Å²	103.9	74%	0.743	55%	0.553	S	S	*	*	H	α-helix	trans	-67.2	-38.8	176.7	-77.1	-179.8	137.1	169.8	-4.7	112.3	L25 S26 V32 S33	L25-R29 WeakPolarHBondContact O-CB 3.24Å; L25-R29 VanDerWaalsContact O-CG 3.32Å; L25-R29 WeakPolarHBondContact O-CG 3.32Å; L25-R29 PolarHBondContact O-N 3.02Å; S26-R29 PolarHBondContact O-N 2.94Å; R29-V32 PolarHBondContact O-N 3.47Å; R29-S33 WeakPolarHBondContact O-CB 3.38Å; R29-S33 PolarHBondContact O-N 3.25Å
30	Q	55.1	Low	54.8	Low	117 Å²	117	101 Å²	101	55%	0.547	55%	0.552	S	S	.	*	H	α-helix	trans	-69.7	-39	175.8	-70.5	175.7	1.1	0	0	111.8	S26 T27 V32 S33 C34	S26-Q30 WeakPolarHBondContact O-CB 3.27Å; S26-Q30 VanDerWaalsContact O-CG 3.27Å; S26-Q30 WeakPolarHBondContact O-CG 3.46Å; S26-Q30 PolarHBondContact O-N 3.49Å; S26-Q30 PolarHBondContact OG-NE2 2.86Å; T27-Q30 PolarHBondContact O-N 3.35Å; Q30-V32 VanDerWaalsContact C-N 3.31Å; Q30-V32 PolarHBondContact O-N 2.97Å; Q30-S33 WeakPolarHBondContact O-CB 3.44Å; Q30-S33 PolarHBondContact O-N 3.45Å; Q30-S33 VanDerWaalsContact O-N 3.16Å; Q30-C34 PolarHBondContact O-N 3.3Å; Q30-C34 PolarHBondContact O-SG 3.34Å
31	S	52.3	Low	54.1	Low	62 Å²	62	100.6 Å²	100.6	43%	0.434	55%	0.552	S	S	.	*	H	α-helix	trans	-62.1	-36.7	174.9	-173.7	0	0	0	0	112.7	T27 A28 K35	T27-S31 VanDerWaalsContact O-CB 3.27Å; T27-S31 WeakPolarHBondContact O-CB 3.41Å; T27-S31 PolarHBondContact O-N 2.87Å; A28-S31 PolarHBondContact O-N 3.5Å; S31-K35 WeakPolarHBondContact O-CG 3.48Å; S31-K35 PolarHBondContact O-N 2.9Å
32	V	54.9	Low	53.5	Low	88 Å²	88	99.1 Å²	99.1	53%	0.533	55%	0.551	S	S	.	*	H	α-helix	trans	-73.4	-37.2	173.8	176.8	0	0	0	0	111.3	A28 R29 Q30 K35 N36	A28-V32 WeakPolarHBondContact O-CG2 3.34Å; A28-V32 PolarHBondContact O-N 3.31Å; A28-V32 VanDerWaalsContact O-N 3.12Å; R29-V32 PolarHBondContact O-N 3.47Å; Q30-V32 VanDerWaalsContact C-N 3.31Å; Q30-V32 PolarHBondContact O-N 2.97Å; V32-K35 PolarHBondContact O-N 3.44Å; V32-N36 PolarHBondContact O-N 2.89Å
33	S	50.9	Low	53	Low	66 Å²	66	103.8 Å²	103.8	46%	0.462	57%	0.568	S	S	.	*	H	α-helix	trans	-63.3	-42.1	175.9	-165	0	0	0	0	112.4	R29 Q30 K35 N36 I37	R29-S33 WeakPolarHBondContact O-CB 3.38Å; R29-S33 PolarHBondContact O-N 3.25Å; Q30-S33 WeakPolarHBondContact O-CB 3.44Å; Q30-S33 PolarHBondContact O-N 3.45Å; Q30-S33 VanDerWaalsContact O-N 3.16Å; S33-K35 VanDerWaalsContact C-N 3.34Å; S33-K35 PolarHBondContact O-N 3.31Å; S33-N36 PolarHBondContact O-N 3.16Å; S33-I37 PolarHBondContact O-N 3.34Å
34	C	54.7	Low	52.5	Low	86 Å²	86	105 Å²	105	58%	0.581	58%	0.579	S	S	*	*	H	α-helix	trans	-68.6	-29.6	177.5	-66	0	0	0	0	113.4	Q30	Q30-C34 PolarHBondContact O-N 3.3Å; Q30-C34 PolarHBondContact O-SG 3.34Å
35	K	53.9	Low	51.9	Low	146 Å²	146	102.3 Å²	102.3	64%	0.635	58%	0.575	S	S	*	*	H	α-helix	trans	-70.5	-34.2	174.3	-77	177.6	179.3	-180	0	112.5	S31 V32 S33	S31-K35 WeakPolarHBondContact O-CG 3.48Å; S31-K35 PolarHBondContact O-N 2.9Å; V32-K35 PolarHBondContact O-N 3.44Å; S33-K35 VanDerWaalsContact C-N 3.34Å; S33-K35 PolarHBondContact O-N 3.31Å
36	N	51.8	Low	51.6	Low	111 Å²	111	103.5 Å²	103.5	59%	0.594	59%	0.592	S	S	*	*	H	α-helix	trans	-75.7	-25	-180	-75.5	-2.2	0	0	0	113.4	V32 S33	V32-N36 PolarHBondContact O-N 2.89Å; S33-N36 PolarHBondContact O-N 3.16Å
37	I	51.3	Low	51.3	Low	105 Å²	105	105.2 Å²	105.2	54%	0.538	60%	0.604	S	S	.	*	H	α-helix	trans	-74.2	-35.2	176.1	-65.2	168.1	0	0	0	110.9	S33 S39 A40 S41	S33-I37 PolarHBondContact O-N 3.34Å; I37-S39 VanDerWaalsContact C-N 3.29Å; I37-S39 PolarHBondContact O-N 3.22Å; I37-A40 PolarHBondContact O-N 3.08Å; I37-S41 PolarHBondContact O-N 3.34Å; I37-S41 PolarHBondContact O-OG 3.28Å; I37-S41 VanDerWaalsContact O-OG 3.06Å
38	H	46.9	Very low	50.7	Low	128 Å²	128	106.1 Å²	106.1	59%	0.593	61%	0.614	S	S	*	*	H	α-helix	trans	-66.2	-29.8	178.2	-165.9	72.4	0	0	0	113.2	N42	H38-N42 PolarHBondContact O-ND2 3.06Å
39	S	48.6	Very low	50.7	Low	89 Å²	89	115 Å²	115	62%	0.622	64%	0.636	S	S	*	*	H	α-helix	trans	-78.4	-24.3	176.8	-55.9	0	0	0	0	113.4	I37	I37-S39 VanDerWaalsContact C-N 3.29Å; I37-S39 PolarHBondContact O-N 3.22Å
40	A	46.6	Very low	50.5	Low	73 Å²	73	116.6 Å²	116.6	60%	0.603	64%	0.642	S	S	*	*	H	α-helix	trans	-83	-23.3	176.1	0	0	0	0	0	112.8	I37	I37-A40 PolarHBondContact O-N 3.08Å
41	S	48.1	Very low	50.4	Low	64 Å²	64	116.9 Å²	116.9	45%	0.448	65%	0.654	S	S	.	*	H	α-helix	trans	-77.6	-20.2	179.3	-56.2	0	0	0	0	114.2	I37 L43	I37-S41 PolarHBondContact O-N 3.34Å; I37-S41 PolarHBondContact O-OG 3.28Å; I37-S41 VanDerWaalsContact O-OG 3.06Å; S41-L43 VanDerWaalsContact C-N 3.34Å; S41-L43 PolarHBondContact O-N 3.24Å
42	N	47.7	Very low	50.6	Low	118 Å²	118	119.9 Å²	119.9	63%	0.631	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	5.5	-178.1	-70	-37.1	0	0	0	114.4	H38	H38-N42 PolarHBondContact O-ND2 3.06Å
43	L	49.1	Very low	50.5	Low	158 Å²	158	120.9 Å²	120.9	83%	0.827	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.8	-2.9	174.2	-122.8	86.2	0	0	0	114.6	S41	S41-L43 VanDerWaalsContact C-N 3.34Å; S41-L43 PolarHBondContact O-N 3.24Å
44	S	48.7	Very low	50.5	Low	105 Å²	105	124.6 Å²	124.6	73%	0.734	70%	0.7	S	S	*	*	S	Bend	trans	-144.1	59	-176.8	-82.6	0	0	0	0	112.6
45	E	46.1	Very low	50	Low	132 Å²	132	126 Å²	126	62%	0.617	71%	0.71	S	S	*	*			trans	-147.3	58.4	162.9	-139.7	177.9	138.8	0	0	113.3	S47	E45-S47 VanDerWaalsContact CG-O 3.25Å; E45-S47 WeakPolarHBondContact CG-O 3.25Å; E45-S47 PolarHBondContact O-N 3.42Å
46	S	50	Low	49.7	Very low	134 Å²	134	124.3 Å²	124.3	94%	0.937	71%	0.711	S	S	*	*	S	Bend	trans	-80.5	54.4	140.3	-66.3	0	0	0	0	109.4
47	S	52.4	Low	49.6	Very low	93 Å²	93	128.4 Å²	128.4	65%	0.65	72%	0.724	S	S	*	*	S	Bend	trans	-170.9	114.1	163.4	-139.4	0	0	0	0	113	E45	E45-S47 VanDerWaalsContact CG-O 3.25Å; E45-S47 WeakPolarHBondContact CG-O 3.25Å; E45-S47 PolarHBondContact O-N 3.42Å
48	S	46.7	Very low	49.2	Very low	103 Å²	103	132.5 Å²	132.5	72%	0.72	76%	0.762	S	S	*	*			trans	76.8	88.4	147.3	-164	0	0	0	0	119.8	R50	S48-R50 PolarHBondContact O-N 3.46Å
49	R	55.1	Low	49.3	Very low	239 Å²	239	132.7 Å²	132.7	90%	0.902	77%	0.77	S	S	*	*			trans	2.2	108.6	144.9	-74.4	-179.2	174.4	-150.7	-1.8	115.7
50	R	50.4	Low	49.4	Very low	231 Å²	231	135 Å²	135	87%	0.872	78%	0.778	S	S	*	*			trans	-155	138.1	133.6	-82.2	-147.5	162.2	177.9	-5.8	111.7	S48	S48-R50 PolarHBondContact O-N 3.46Å
51	P	51.7	Low	49.5	Very low	123 Å²	123	138.4 Å²	138.4	80%	0.799	79%	0.788	S	S	*	*			trans	-77.7	146.2	-177.1	32.8	-31.8	0	0	0	111.2	S53	P51-S53 PolarHBondContact O-N 3.38Å
52	S	58	Low	49.6	Very low	126 Å²	126	142.8 Å²	142.8	88%	0.881	81%	0.808	S	S	*	*			trans	-49.4	118.4	-178.5	-38	0	0	0	0	113.2
53	S	51	Low	49.7	Very low	109 Å²	109	144.4 Å²	144.4	76%	0.762	82%	0.819	S	S	*	*			trans	-104	104.4	170.7	79.8	0	0	0	0	111.6	P51	P51-S53 PolarHBondContact O-N 3.38Å
54	L	51.3	Low	49.8	Very low	144 Å²	144	143.5 Å²	143.5	75%	0.754	82%	0.818	S	S	*	*			trans	42.4	107.8	145.4	-70.7	103.2	0	0	0	119	V56	L54-V56 HydrophobicContact CB-CG2 3.92Å; L54-V56 HydrophobicContact CD2-CG2 4.32Å; L54-V56 PolarHBondContact O-N 3.34Å; L54-V56 VanDerWaalsContact O-N 3.08Å
55	C	45.5	Very low	49.9	Very low	116 Å²	116	146.2 Å²	146.2	78%	0.784	82%	0.824	S	S	*	*			trans	-64.7	98.2	144.8	-58.2	0	0	0	0	108.4
56	V	48	Very low	50.2	Low	110 Å²	110	147.3 Å²	147.3	67%	0.667	84%	0.84	S	S	*	*			trans	-84.3	120.1	169.9	-179.4	0	0	0	0	108	L54	L54-V56 HydrophobicContact CB-CG2 3.92Å; L54-V56 HydrophobicContact CD2-CG2 4.32Å; L54-V56 PolarHBondContact O-N 3.34Å; L54-V56 VanDerWaalsContact O-N 3.08Å
57	F	48.2	Very low	50.2	Low	197 Å²	197	148.4 Å²	148.4	86%	0.864	83%	0.832	S	S	*	*			trans	-81.2	123.5	168.9	-67.8	-89.8	0	0	0	108.5
58	S	43.9	Very low	50	Low	190 Å²	190	153.5 Å²	153.5	100%	1.329	85%	0.848	S	S	*	*			trans	-119.4	0	163.6	-66.2	0	0	0	0	109

Retrieved 58 of 58 residues in 37.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).