A0A068BEU9_HUMAN Loading...

Truncated breast and ovarian cancer susceptibility protein 1

AlphaFold DB , UniProt , Accession A0A068BEU9, Species HUMAN (Homo sapiens, Human), Gene BRCA1, Length 37 aa.

						>A0A068BEU9_HUMAN|A0A068BEU9|BRCA1
LLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKET
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	67.4	Low	82.5	Confident	202 Å²	202	132.5 Å²	132.5	100%	1.058	66%	0.656	S	S	*	*				0	-28.9	0	-89.5	102.3	0	0	0	114.3	T3 K4 D5	L1-T3 PolarHBondContact O-N 3.24Å; L1-T3 VanDerWaalsContact C-N 3.29Å; L1-K4 PolarHBondContact O-N 3.05Å; L1-D5 PolarHBondContact O-N 3.19Å
2	L	70.1	Confident	82.9	Confident	151 Å²	151	126 Å²	126	79%	0.791	64%	0.638	S	S	*	*	H	α-helix	trans	-54.3	-36.2	-177.5	-168.8	66.5	0	0	0	115	R6	L2-R6 PolarHBondContact O-N 3.39Å; L2-R6 WeakPolarHBondContact O-CB 3.49Å
3	T	74.7	Confident	83.1	Confident	119 Å²	119	124.8 Å²	124.8	73%	0.73	63%	0.629	S	S	*	*	H	α-helix	trans	-72.3	-33.8	-177	-22	0	0	0	0	113.3	L1 M7	L1-T3 PolarHBondContact O-N 3.24Å; L1-T3 VanDerWaalsContact C-N 3.29Å; T3-M7 WeakPolarHBondContact O-CB 3.41Å; T3-M7 PolarHBondContact O-N 3.12Å; T3-M7 VanDerWaalsContact O-N 3.11Å
4	K	82.8	Confident	83	Confident	151 Å²	151	123.4 Å²	123.4	66%	0.657	62%	0.617	S	S	*	*	H	α-helix	trans	-72.6	-39.2	178.4	-166.4	81.7	175.6	-174.2	0	110.6	L1 N8	L1-K4 PolarHBondContact O-N 3.05Å; K4-N8 PolarHBondContact O-N 3.38Å
5	D	84.7	Confident	82.8	Confident	108 Å²	108	119.1 Å²	119.1	58%	0.578	60%	0.602	S	S	*	*	H	α-helix	trans	-67.4	-47.6	178.5	-152.1	-98.1	0	0	0	111.1	L1 M7 N8 V9	L1-D5 PolarHBondContact O-N 3.19Å; D5-M7 VanDerWaalsContact C-N 3.34Å; D5-M7 PolarHBondContact O-N 3.42Å; D5-N8 WeakPolarHBondContact O-CB 3.41Å; D5-N8 PolarHBondContact O-N 3.06Å; D5-V9 PolarHBondContact O-N 2.99Å; D5-V9 WeakPolarHBondContact O-CG2 3.37Å
6	R	87.4	Confident	82.8	Confident	177 Å²	177	118.7 Å²	118.7	67%	0.668	60%	0.602	S	S	*	*	H	α-helix	trans	-57.8	-43.9	174	-177.5	177.2	163	176.9	-3.7	112.6	L2 N8 V9 E10	L2-R6 PolarHBondContact O-N 3.39Å; L2-R6 WeakPolarHBondContact O-CB 3.49Å; R6-N8 VanDerWaalsContact C-N 3.3Å; R6-N8 PolarHBondContact O-N 3.13Å; R6-V9 PolarHBondContact O-N 3.38Å; R6-E10 PolarHBondContact O-N 2.94Å
7	M	89.8	Confident	82.7	Confident	115 Å²	115	119.2 Å²	119.2	57%	0.567	60%	0.599	S	S	*	*	H	α-helix	trans	-63.4	-36.6	176.5	-175.5	-175.3	-179.8	0	0	112.2	T3 D5 K11	T3-M7 WeakPolarHBondContact O-CB 3.41Å; T3-M7 PolarHBondContact O-N 3.12Å; T3-M7 VanDerWaalsContact O-N 3.11Å; D5-M7 VanDerWaalsContact C-N 3.34Å; D5-M7 PolarHBondContact O-N 3.42Å; M7-K11 WeakPolarHBondContact O-CB 3.39Å; M7-K11 PolarHBondContact O-N 3.41Å
8	N	89.6	Confident	82.2	Confident	100 Å²	100	114 Å²	114	54%	0.535	58%	0.576	S	S	.	*	H	α-helix	trans	-67.3	-39.8	176.1	-100.1	-37.3	0	0	0	112.1	K4 D5 R6 K11 A12	K4-N8 PolarHBondContact O-N 3.38Å; D5-N8 WeakPolarHBondContact O-CB 3.41Å; D5-N8 PolarHBondContact O-N 3.06Å; R6-N8 VanDerWaalsContact C-N 3.3Å; R6-N8 PolarHBondContact O-N 3.13Å; N8-K11 PolarHBondContact O-N 3.11Å; N8-A12 WeakPolarHBondContact O-CB 3.39Å; N8-A12 PolarHBondContact O-N 3.38Å
9	V	88.1	Confident	81.7	Confident	80 Å²	80	116.4 Å²	116.4	49%	0.485	58%	0.583	S	S	.	*	H	α-helix	trans	-61.3	-48.5	173.9	174.4	0	0	0	0	110.6	D5 R6 K11 A12 E13	D5-V9 PolarHBondContact O-N 2.99Å; D5-V9 WeakPolarHBondContact O-CG2 3.37Å; R6-V9 PolarHBondContact O-N 3.38Å; V9-K11 VanDerWaalsContact C-N 3.32Å; V9-K11 PolarHBondContact O-N 2.91Å; V9-A12 PolarHBondContact O-N 3.43Å; V9-A12 VanDerWaalsContact O-N 3.11Å; V9-E13 PolarHBondContact O-N 3.04Å
10	E	87	Confident	81.5	Confident	123 Å²	123	116.8 Å²	116.8	58%	0.575	58%	0.582	S	S	*	*	H	α-helix	trans	-61.5	-40.4	179.4	-134.6	179.4	100.1	0	0	111.9	R6 F14	R6-E10 PolarHBondContact O-N 2.94Å; E10-F14 WeakPolarHBondContact O-CB 3.33Å; E10-F14 PolarHBondContact O-N 3.3Å
11	K	86.3	Confident	80.9	Confident	132 Å²	132	116.4 Å²	116.4	57%	0.574	59%	0.588	S	S	*	*	H	α-helix	trans	-61.2	-45.3	172	-92.6	-111.4	-168.3	-178.8	0	112.3	M7 N8 V9 F14 C15	M7-K11 WeakPolarHBondContact O-CB 3.39Å; M7-K11 PolarHBondContact O-N 3.41Å; N8-K11 PolarHBondContact O-N 3.11Å; V9-K11 VanDerWaalsContact C-N 3.32Å; V9-K11 PolarHBondContact O-N 2.91Å; K11-F14 PolarHBondContact O-N 2.98Å; K11-C15 WeakPolarHBondContact O-CB 3.3Å; K11-C15 PolarHBondContact O-N 3.44Å; K11-C15 PolarHBondContact O-SG 3.11Å
12	A	87	Confident	80.9	Confident	54 Å²	54	109.7 Å²	109.7	45%	0.446	57%	0.568	S	S	.	*	H	α-helix	trans	-66	-42.7	-178.4	0	0	0	0	0	111.7	N8 V9 C15 N16	N8-A12 WeakPolarHBondContact O-CB 3.39Å; N8-A12 PolarHBondContact O-N 3.38Å; V9-A12 PolarHBondContact O-N 3.43Å; V9-A12 VanDerWaalsContact O-N 3.11Å; A12-C15 PolarHBondContact O-N 2.98Å; A12-N16 PolarHBondContact O-N 3.23Å
13	E	85.5	Confident	80.8	Confident	110 Å²	110	105.7 Å²	105.7	51%	0.514	55%	0.547	S	S	.	.	H	α-helix	trans	-63.3	-41.4	174.3	-70.7	-161.9	134.3	0	0	112.1	V9 N16 K17	V9-E13 PolarHBondContact O-N 3.04Å; E13-N16 PolarHBondContact O-N 3.21Å; E13-K17 WeakPolarHBondContact O-CG 3.35Å; E13-K17 PolarHBondContact O-N 3.28Å; E13-K17 VanDerWaalsContact O-N 3.13Å
14	F	81.9	Confident	80.3	Confident	105 Å²	105	102.2 Å²	102.2	46%	0.461	53%	0.531	S	S	.	.	H	α-helix	trans	-63	-46.3	175.6	-179.7	-95.4	0	0	0	112.1	E10 K11 N16 K17 S18	E10-F14 WeakPolarHBondContact O-CB 3.33Å; E10-F14 PolarHBondContact O-N 3.3Å; K11-F14 PolarHBondContact O-N 2.98Å; F14-N16 VanDerWaalsContact C-N 3.3Å; F14-N16 PolarHBondContact O-N 3.49Å; F14-K17 CarbonylContact O-C 3.58Å; F14-K17 PolarHBondContact O-N 3.22Å; F14-K17 VanDerWaalsContact O-N 3.12Å; F14-S18 PolarHBondContact O-N 3.47Å; F14-S18 WeakPolarHBondContact O-CB 3.25Å
15	C	79.8	Confident	79.4	Confident	59 Å²	59	104.8 Å²	104.8	40%	0.399	54%	0.536	S	S	.	.	H	α-helix	trans	-61.5	-36.4	177.8	-75	0	0	0	0	112.6	K11 A12 S18 K19	K11-C15 WeakPolarHBondContact O-CB 3.3Å; K11-C15 PolarHBondContact O-N 3.44Å; K11-C15 PolarHBondContact O-SG 3.11Å; A12-C15 PolarHBondContact O-N 2.98Å; C15-S18 PolarHBondContact O-N 3.06Å; C15-S18 PolarHBondContact O-OG 3.03Å; C15-K19 VanDerWaalsContact O-CG 3.3Å; C15-K19 WeakPolarHBondContact O-CG 3.27Å; C15-K19 PolarHBondContact O-N 3.35Å
16	N	82.8	Confident	78.5	Confident	113 Å²	113	102.4 Å²	102.4	60%	0.604	53%	0.528	S	S	*	.	H	α-helix	trans	-67	-37.8	174.4	-94.9	-31.2	0	0	0	112.2	A12 E13 F14	A12-N16 PolarHBondContact O-N 3.23Å; E13-N16 PolarHBondContact O-N 3.21Å; F14-N16 VanDerWaalsContact C-N 3.3Å; F14-N16 PolarHBondContact O-N 3.49Å
17	K	80.6	Confident	77.4	Confident	127 Å²	127	95.8 Å²	95.8	55%	0.552	51%	0.505	S	S	*	.	H	α-helix	trans	-72.1	-36.2	175.4	-68	170.7	-175.7	172.4	0	112.1	E13 F14 K19 Q20 L23	E13-K17 WeakPolarHBondContact O-CG 3.35Å; E13-K17 PolarHBondContact O-N 3.28Å; E13-K17 VanDerWaalsContact O-N 3.13Å; F14-K17 CarbonylContact O-C 3.58Å; F14-K17 PolarHBondContact O-N 3.22Å; F14-K17 VanDerWaalsContact O-N 3.12Å; K17-K19 VanDerWaalsContact C-N 3.33Å; K17-K19 PolarHBondContact O-N 3.24Å; K17-Q20 VanDerWaalsContact O-CB 3.27Å; K17-Q20 WeakPolarHBondContact O-CB 3.45Å; K17-Q20 VanDerWaalsContact O-CG 3.25Å; K17-Q20 WeakPolarHBondContact O-CG 3.48Å; K17-Q20 PolarHBondContact O-N 2.8Å; K17-L23 HydrophobicContact CB-CD2 4.43Å; K17-L23 WeakPolarHBondContact O-CD2 3.43Å
18	S	74.3	Confident	76.2	Confident	26 Å²	26	96.7 Å²	96.7	18%	0.182	51%	0.507	C	S	.	.	H	α-helix	trans	-73.6	-21.5	-178.8	76.3	0	0	0	0	114.4	F14 C15 Q20	F14-S18 PolarHBondContact O-N 3.47Å; F14-S18 WeakPolarHBondContact O-CB 3.25Å; C15-S18 PolarHBondContact O-N 3.06Å; C15-S18 PolarHBondContact O-OG 3.03Å; S18-Q20 PolarHBondContact O-N 2.91Å
19	K	72.3	Confident	75	Confident	160 Å²	160	97.7 Å²	97.7	70%	0.696	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.9	-8.3	169.6	-73.6	175.6	-175.1	-171.7	0	113.7	C15 K17	C15-K19 VanDerWaalsContact O-CG 3.3Å; C15-K19 WeakPolarHBondContact O-CG 3.27Å; C15-K19 PolarHBondContact O-N 3.35Å; K17-K19 VanDerWaalsContact C-N 3.33Å; K17-K19 PolarHBondContact O-N 3.24Å
20	Q	78.3	Confident	73.9	Confident	123 Å²	123	103.3 Å²	103.3	58%	0.575	53%	0.525	S	S	*	.	S	Bend	trans	-64.9	125.7	171.5	-69.2	-70.2	-46.1	0	0	109.6	K17 S18 G22 L23 A24	K17-Q20 VanDerWaalsContact O-CB 3.27Å; K17-Q20 WeakPolarHBondContact O-CB 3.45Å; K17-Q20 VanDerWaalsContact O-CG 3.25Å; K17-Q20 WeakPolarHBondContact O-CG 3.48Å; K17-Q20 PolarHBondContact O-N 2.8Å; S18-Q20 PolarHBondContact O-N 2.91Å; Q20-G22 PolarHBondContact O-N 3.02Å; Q20-L23 HydrophobicContact CB-CB 4.17Å; Q20-L23 PolarHBondContact O-N 3.04Å; Q20-A24 PolarHBondContact O-N 3.3Å
21	P	67.9	Low	72.6	Confident	109 Å²	109	106 Å²	106	71%	0.708	53%	0.53	S	S	*	.	H	α-helix	trans	-54	-33.2	-175.7	-24.3	30.4	0	0	0	113.6
22	G	69.1	Low	71.4	Confident	62 Å²	62	102.8 Å²	102.8	64%	0.639	53%	0.528	S	S	*	.	H	α-helix	trans	-74.6	-28.3	176.6	0	0	0	0	0	114.8	Q20 S26	Q20-G22 PolarHBondContact O-N 3.02Å; G22-S26 PolarHBondContact O-OG 3.49Å
23	L	66.2	Low	70.2	Confident	66 Å²	66	103.3 Å²	103.3	35%	0.346	54%	0.539	S	S	.	.	H	α-helix	trans	-84.5	-36.8	178.5	-152.2	77.8	0	0	0	111.5	K17 Q20 R25 S26 Q27	K17-L23 HydrophobicContact CB-CD2 4.43Å; K17-L23 WeakPolarHBondContact O-CD2 3.43Å; Q20-L23 HydrophobicContact CB-CB 4.17Å; Q20-L23 PolarHBondContact O-N 3.04Å; L23-R25 VanDerWaalsContact C-N 3.3Å; L23-R25 PolarHBondContact O-N 3.48Å; L23-S26 PolarHBondContact O-OG 2.95Å; L23-S26 PolarHBondContact O-N 2.88Å; L23-S26 WeakPolarHBondContact CA-OG 3.49Å; L23-Q27 PolarHBondContact O-N 2.98Å
24	A	64.6	Low	69.1	Low	47 Å²	47	101.7 Å²	101.7	39%	0.388	54%	0.54	S	S	.	.	H	α-helix	trans	-57.8	-42.6	175.1	0	0	0	0	0	111.8	Q20 S26 Q27 H28	Q20-A24 PolarHBondContact O-N 3.3Å; A24-S26 PolarHBondContact O-N 3.23Å; A24-Q27 PolarHBondContact O-N 2.93Å; A24-H28 WeakPolarHBondContact O-CB 3.37Å; A24-H28 PolarHBondContact O-N 3.38Å
25	R	63.9	Low	68.2	Low	204 Å²	204	105.4 Å²	105.4	77%	0.77	56%	0.556	S	S	*	*	H	α-helix	trans	-66.7	-35	178.7	-166.6	175.5	-177.3	-175.2	0.7	113.2	L23	L23-R25 VanDerWaalsContact C-N 3.3Å; L23-R25 PolarHBondContact O-N 3.48Å
26	S	66.1	Low	67.2	Low	59 Å²	59	112 Å²	112	41%	0.413	58%	0.581	S	S	.	*	H	α-helix	trans	-80.8	-30.2	178.7	54.7	0	0	0	0	113.2	G22 L23 A24	G22-S26 PolarHBondContact O-OG 3.49Å; L23-S26 PolarHBondContact O-OG 2.95Å; L23-S26 PolarHBondContact O-N 2.88Å; L23-S26 WeakPolarHBondContact CA-OG 3.49Å; A24-S26 PolarHBondContact O-N 3.23Å
27	Q	65	Low	65.8	Low	38 Å²	38	116.8 Å²	116.8	18%	0.178	61%	0.614	C	S	.	*	H	α-helix	trans	-76.6	-34.2	172.1	-79.4	-178.1	17	0	0	113.4	L23 A24 N29 R30 W31	L23-Q27 PolarHBondContact O-N 2.98Å; A24-Q27 PolarHBondContact O-N 2.93Å; Q27-N29 PolarHBondContact O-N 2.95Å; Q27-R30 PolarHBondContact O-N 3.49Å; Q27-W31 VanDerWaalsContact O-CD1 3.27Å; Q27-W31 PolarHBondContact O-N 3.1Å; Q27-W31 VanDerWaalsContact O-N 3.1Å
28	H	64	Low	65.1	Low	133 Å²	133	116.3 Å²	116.3	62%	0.616	62%	0.617	S	S	*	*	H	α-helix	trans	-55.1	-39.9	175.9	-175.3	-125	0	0	0	111.7	A24 R30 W31 A32	A24-H28 WeakPolarHBondContact O-CB 3.37Å; A24-H28 PolarHBondContact O-N 3.38Å; H28-R30 VanDerWaalsContact C-N 3.34Å; H28-R30 PolarHBondContact O-N 3.26Å; H28-W31 PolarHBondContact O-N 2.98Å; H28-A32 VanDerWaalsContact O-CB 3.22Å; H28-A32 WeakPolarHBondContact O-CB 3.22Å; H28-A32 PolarHBondContact O-N 3.22Å
29	N	64.1	Low	64.6	Low	122 Å²	122	121 Å²	121	65%	0.652	64%	0.64	S	S	*	*	H	α-helix	trans	-69.2	-25.9	175.6	-68.1	-24.5	0	0	0	114	Q27	Q27-N29 PolarHBondContact O-N 2.95Å
30	R	64.2	Low	64.2	Low	198 Å²	198	118.8 Å²	118.8	75%	0.747	64%	0.637	S	S	*	*	H	α-helix	trans	-76.9	-39.5	175.4	-73.3	-169.4	-162.7	-147.6	3	112.4	Q27 H28	Q27-R30 PolarHBondContact O-N 3.49Å; H28-R30 VanDerWaalsContact C-N 3.34Å; H28-R30 PolarHBondContact O-N 3.26Å
31	W	59.9	Low	63.3	Low	179 Å²	179	118.6 Å²	118.6	68%	0.678	64%	0.641	S	S	*	*	H	α-helix	trans	-84.9	-25.6	-178	-65	109.7	0	0	0	113.5	Q27 H28 G33 S34	Q27-W31 VanDerWaalsContact O-CD1 3.27Å; Q27-W31 PolarHBondContact O-N 3.1Å; Q27-W31 VanDerWaalsContact O-N 3.1Å; H28-W31 PolarHBondContact O-N 2.98Å; W31-G33 PolarHBondContact O-N 3.44Å; W31-S34 PolarHBondContact O-N 3.06Å
32	A	62.8	Low	63	Low	64 Å²	64	119.2 Å²	119.2	53%	0.529	64%	0.637	S	S	.	*	T	Hydrogen-bonded Turn	trans	-62.6	-22.9	175.1	0	0	0	0	0	113.3	H28	H28-A32 VanDerWaalsContact O-CB 3.22Å; H28-A32 WeakPolarHBondContact O-CB 3.22Å; H28-A32 PolarHBondContact O-N 3.22Å
33	G	60.7	Low	62.6	Low	66 Å²	66	123 Å²	123	68%	0.68	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90	-8.1	174	0	0	0	0	0	115.1	W31 K35	W31-G33 PolarHBondContact O-N 3.44Å; G33-K35 VanDerWaalsContact C-N 3.32Å
34	S	63.2	Low	62.4	Low	75 Å²	75	127.1 Å²	127.1	52%	0.524	66%	0.657	S	S	.	*			trans	-97.1	30.7	178.2	-66.5	0	0	0	0	112.3	W31 E36	W31-S34 PolarHBondContact O-N 3.06Å; S34-E36 PolarHBondContact O-N 3.1Å; S34-E36 VanDerWaalsContact O-N 3.1Å
35	K	61.6	Low	62.2	Low	184 Å²	184	133.2 Å²	133.2	80%	0.8	68%	0.678	S	S	*	*			trans	-59.9	117.3	161.7	-79	-165.1	174.7	-175.1	0	107.2	G33 T37	G33-K35 VanDerWaalsContact C-N 3.32Å; K35-T37 PolarHBondContact O-N 3.17Å
36	E	60.4	Low	62.1	Low	197 Å²	197	127.3 Å²	127.3	92%	0.921	67%	0.67	S	S	*	*			trans	-47.7	112.6	-178.2	-63.3	162.5	96.1	0	0	110.7	S34	S34-E36 PolarHBondContact O-N 3.1Å; S34-E36 VanDerWaalsContact O-N 3.1Å
37	T	52.7	Low	61.7	Low	213 Å²	213	133.5 Å²	133.5	100%	1.307	69%	0.694	S	S	*	*			trans	-89.8	0	148.6	41.9	0	0	0	0	108.6	K35	K35-T37 PolarHBondContact O-N 3.17Å

Retrieved 37 of 37 residues in 22.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).