A0A068BFU7_HUMAN Loading...

Truncated breast and ovarian cancer susceptibility protein 2

AlphaFold DB , UniProt , Accession A0A068BFU7, Species HUMAN (Homo sapiens, Human), Gene BRCA2, Length 31 aa.

						>A0A068BFU7_HUMAN|A0A068BFU7|BRCA2
YDTEIDRSRRSAIKKIMERDDTAAKTLVLCF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	Y	56.2	Low	66.2	Low	233 Å²	233	129.3 Å²	129.3	91%	0.914	61%	0.608	S	S	*	*				0	-41	0	-64.9	-65.7	0	0	0	114
2	D	60.1	Low	67.3	Low	140 Å²	140	122.6 Å²	122.6	75%	0.749	59%	0.591	S	S	*	*	H	α-helix	trans	-76.3	-37.8	177.4	-160	-100.5	0	0	0	113.5	E4 I5 D6	D2-E4 VanDerWaalsContact C-N 3.34Å; D2-E4 PolarHBondContact O-N 3.29Å; D2-I5 PolarHBondContact O-N 3.38Å; D2-D6 PolarHBondContact O-N 2.74Å; D2-D6 VanDerWaalsContact O-N 3.1Å
3	T	64.9	Low	68.2	Low	108 Å²	108	119.9 Å²	119.9	66%	0.663	58%	0.58	S	S	*	*	H	α-helix	trans	-65.5	-30.9	179.6	44	0	0	0	0	114.3	R7	T3-R7 VanDerWaalsContact O-CB 3.32Å; T3-R7 WeakPolarHBondContact O-CB 3.21Å; T3-R7 PolarHBondContact O-N 2.95Å; T3-R7 VanDerWaalsContact O-N 3.08Å
4	E	65.5	Low	69	Low	124 Å²	124	120.3 Å²	120.3	58%	0.579	58%	0.578	S	S	*	*	H	α-helix	trans	-75.5	-35.9	179.5	-67.5	173.8	104.5	0	0	111.7	D2 S8	D2-E4 VanDerWaalsContact C-N 3.34Å; D2-E4 PolarHBondContact O-N 3.29Å; E4-S8 WeakPolarHBondContact O-CB 3.25Å; E4-S8 PolarHBondContact O-N 3.48Å
5	I	64.3	Low	69.7	Low	111 Å²	111	120.6 Å²	120.6	57%	0.569	58%	0.575	S	S	*	*	H	α-helix	trans	-71.6	-43.4	176.4	-63.7	-67.6	0	0	0	110.5	D2 R7 S8 R9	D2-I5 PolarHBondContact O-N 3.38Å; I5-R7 VanDerWaalsContact C-N 3.34Å; I5-R7 PolarHBondContact O-N 3.21Å; I5-S8 PolarHBondContact O-N 3.39Å; I5-R9 VanDerWaalsContact O-CB 3.24Å; I5-R9 WeakPolarHBondContact O-CB 3.25Å; I5-R9 PolarHBondContact O-N 2.86Å
6	D	65.5	Low	70.3	Confident	57 Å²	57	119.4 Å²	119.4	31%	0.305	57%	0.572	S	S	.	*	H	α-helix	trans	-64.4	-40.4	177.1	178.1	-105.2	0	0	0	111.4	D2 R10	D2-D6 PolarHBondContact O-N 2.74Å; D2-D6 VanDerWaalsContact O-N 3.1Å; D6-R10 WeakPolarHBondContact O-CB 3.27Å; D6-R10 VanDerWaalsContact O-CG 3.23Å; D6-R10 WeakPolarHBondContact O-CG 3.16Å; D6-R10 PolarHBondContact O-N 3.22Å; D6-R10 IonicContact OD1-CZ 2.65Å; D6-R10 IonicContact OD1-NE 3.53Å; D6-R10 PolarHBondContact OD1-NE 3.34Å; D6-R10 IonicContact OD1-NH2 3Å; D6-R10 PolarHBondContact OD1-NH2 3.35Å; D6-R10 IonicContact OD2-NE 2.59Å
7	R	65.8	Low	70.8	Confident	185 Å²	185	119.9 Å²	119.9	70%	0.698	58%	0.576	S	S	*	*	H	α-helix	trans	-66.3	-40.8	172.9	-168.8	179.4	-176.2	-173.3	1.6	112.2	T3 I5 S11	T3-R7 VanDerWaalsContact O-CB 3.32Å; T3-R7 WeakPolarHBondContact O-CB 3.21Å; T3-R7 PolarHBondContact O-N 2.95Å; T3-R7 VanDerWaalsContact O-N 3.08Å; I5-R7 VanDerWaalsContact C-N 3.34Å; I5-R7 PolarHBondContact O-N 3.21Å; R7-S11 WeakPolarHBondContact O-CB 3.39Å; R7-S11 PolarHBondContact O-N 2.99Å; R7-S11 PolarHBondContact O-OG 3.39Å
8	S	66.8	Low	71.1	Confident	77 Å²	77	118.9 Å²	118.9	54%	0.538	57%	0.57	S	S	.	*	H	α-helix	trans	-67.6	-44.4	179.4	-173.7	0	0	0	0	111.6	E4 I5 S11 A12	E4-S8 WeakPolarHBondContact O-CB 3.25Å; E4-S8 PolarHBondContact O-N 3.48Å; I5-S8 PolarHBondContact O-N 3.39Å; S8-S11 PolarHBondContact O-N 3.46Å; S8-A12 WeakPolarHBondContact O-CB 3.44Å; S8-A12 PolarHBondContact O-N 3.21Å
9	R	72.3	Confident	71.4	Confident	162 Å²	162	121.9 Å²	121.9	61%	0.611	58%	0.575	S	S	*	*	H	α-helix	trans	-67.7	-44	177.8	-161.9	174.6	83.4	-169.7	4.9	111.6	I5 S11 A12 I13	I5-R9 VanDerWaalsContact O-CB 3.24Å; I5-R9 WeakPolarHBondContact O-CB 3.25Å; I5-R9 PolarHBondContact O-N 2.86Å; R9-S11 VanDerWaalsContact C-N 3.27Å; R9-S11 PolarHBondContact O-N 3.32Å; R9-A12 PolarHBondContact O-N 3.4Å; R9-I13 HydrophobicContact CG-CD1 4.23Å; R9-I13 WeakPolarHBondContact O-CG1 3.32Å; R9-I13 PolarHBondContact O-N 3.31Å
10	R	71.8	Confident	71.5	Confident	159 Å²	159	121 Å²	121	60%	0.6	57%	0.574	S	S	*	*	H	α-helix	trans	-60.8	-37.9	172.2	-74.9	-169.1	-79	156.4	-5.5	111.5	D6 K14	D6-R10 WeakPolarHBondContact O-CB 3.27Å; D6-R10 VanDerWaalsContact O-CG 3.23Å; D6-R10 WeakPolarHBondContact O-CG 3.16Å; D6-R10 PolarHBondContact O-N 3.22Å; D6-R10 IonicContact OD1-CZ 2.65Å; D6-R10 IonicContact OD1-NE 3.53Å; D6-R10 PolarHBondContact OD1-NE 3.34Å; D6-R10 IonicContact OD1-NH2 3Å; D6-R10 PolarHBondContact OD1-NH2 3.35Å; D6-R10 IonicContact OD2-NE 2.59Å; R10-K14 WeakPolarHBondContact O-CB 3.48Å; R10-K14 PolarHBondContact O-N 3.01Å
11	S	75.1	Confident	71.5	Confident	66 Å²	66	119.1 Å²	119.1	46%	0.462	57%	0.567	S	S	.	*	H	α-helix	trans	-70.6	-37.4	177	-59.1	0	0	0	0	112.7	R7 S8 R9 K15	R7-S11 WeakPolarHBondContact O-CB 3.39Å; R7-S11 PolarHBondContact O-N 2.99Å; R7-S11 PolarHBondContact O-OG 3.39Å; S8-S11 PolarHBondContact O-N 3.46Å; R9-S11 VanDerWaalsContact C-N 3.27Å; R9-S11 PolarHBondContact O-N 3.32Å; S11-K15 VanDerWaalsContact O-CB 3.23Å; S11-K15 WeakPolarHBondContact O-CB 3.3Å; S11-K15 PolarHBondContact O-N 3.4Å
12	A	79.6	Confident	72.1	Confident	49 Å²	49	112.1 Å²	112.1	41%	0.405	55%	0.549	S	S	.	.	H	α-helix	trans	-66.5	-47.9	176.7	0	0	0	0	0	111.5	S8 R9 K15 I16	S8-A12 WeakPolarHBondContact O-CB 3.44Å; S8-A12 PolarHBondContact O-N 3.21Å; R9-A12 PolarHBondContact O-N 3.4Å; A12-K15 PolarHBondContact O-N 3.48Å; A12-I16 VanDerWaalsContact O-CG1 3.27Å; A12-I16 WeakPolarHBondContact O-CG1 3.34Å; A12-I16 PolarHBondContact O-N 2.87Å
13	I	78.4	Confident	72.7	Confident	88 Å²	88	108.2 Å²	108.2	45%	0.451	54%	0.536	S	S	.	.	H	α-helix	trans	-61.9	-46.1	176.8	-64.6	168.4	0	0	0	110.1	R9 K15 I16 M17	R9-I13 HydrophobicContact CG-CD1 4.23Å; R9-I13 WeakPolarHBondContact O-CG1 3.32Å; R9-I13 PolarHBondContact O-N 3.31Å; I13-K15 VanDerWaalsContact C-N 3.33Å; I13-K15 PolarHBondContact O-N 3.31Å; I13-I16 PolarHBondContact O-N 2.83Å; I13-M17 HydrophobicContact CG2-CG 4.33Å; I13-M17 HydrophobicContact CG2-SD 3.99Å; I13-M17 VanDerWaalsContact O-CG 3.32Å; I13-M17 WeakPolarHBondContact O-CG 3.49Å; I13-M17 PolarHBondContact O-N 2.85Å
14	K	79.6	Confident	72.9	Confident	125 Å²	125	105.3 Å²	105.3	54%	0.543	52%	0.523	S	S	.	.	H	α-helix	trans	-58.2	-44.4	176.3	-175	177.7	176.8	-175.6	0	111.9	R10 I16 M17 E18	R10-K14 WeakPolarHBondContact O-CB 3.48Å; R10-K14 PolarHBondContact O-N 3.01Å; K14-I16 VanDerWaalsContact C-N 3.33Å; K14-I16 PolarHBondContact O-N 3.27Å; K14-M17 PolarHBondContact O-N 2.65Å; K14-E18 WeakPolarHBondContact CE-OE1 3.31Å; K14-E18 HydrophobicContact CG-CG 4.36Å; K14-E18 WeakPolarHBondContact O-CB 3.23Å; K14-E18 VanDerWaalsContact O-CG 3.26Å; K14-E18 WeakPolarHBondContact O-CG 3.21Å; K14-E18 PolarHBondContact O-N 2.88Å
15	K	79.5	Confident	73	Confident	125 Å²	125	105.3 Å²	105.3	54%	0.543	52%	0.521	S	S	.	.	H	α-helix	trans	-66.3	-33.4	179.1	-166.1	174.9	-162.1	173.8	0	113	S11 A12 I13 R19	S11-K15 VanDerWaalsContact O-CB 3.23Å; S11-K15 WeakPolarHBondContact O-CB 3.3Å; S11-K15 PolarHBondContact O-N 3.4Å; A12-K15 PolarHBondContact O-N 3.48Å; I13-K15 VanDerWaalsContact C-N 3.33Å; I13-K15 PolarHBondContact O-N 3.31Å; K15-R19 WeakPolarHBondContact O-CG 3.48Å; K15-R19 PolarHBondContact O-N 3.08Å
16	I	79.9	Confident	73	Confident	102 Å²	102	104 Å²	104	52%	0.523	52%	0.518	S	S	.	.	H	α-helix	trans	-68.1	-51	172.3	-66.6	162.4	0	0	0	109.1	A12 I13 K14 E18 R19 D20	A12-I16 VanDerWaalsContact O-CG1 3.27Å; A12-I16 WeakPolarHBondContact O-CG1 3.34Å; A12-I16 PolarHBondContact O-N 2.87Å; I13-I16 PolarHBondContact O-N 2.83Å; K14-I16 VanDerWaalsContact C-N 3.33Å; K14-I16 PolarHBondContact O-N 3.27Å; I16-E18 VanDerWaalsContact C-N 3.3Å; I16-E18 PolarHBondContact O-N 3.25Å; I16-R19 PolarHBondContact O-N 2.83Å; I16-D20 PolarHBondContact O-N 3.05Å
17	M	78.4	Confident	73	Confident	128 Å²	128	106.4 Å²	106.4	63%	0.631	53%	0.53	S	S	*	.	H	α-helix	trans	-57.1	-40.5	177.3	-69.1	178.2	74.4	0	0	112.6	I13 K14 R19 D20 D21	I13-M17 HydrophobicContact CG2-CG 4.33Å; I13-M17 HydrophobicContact CG2-SD 3.99Å; I13-M17 VanDerWaalsContact O-CG 3.32Å; I13-M17 WeakPolarHBondContact O-CG 3.49Å; I13-M17 PolarHBondContact O-N 2.85Å; K14-M17 PolarHBondContact O-N 2.65Å; M17-R19 VanDerWaalsContact C-N 3.33Å; M17-R19 PolarHBondContact O-N 2.9Å; M17-D20 PolarHBondContact O-N 3.26Å; M17-D21 VanDerWaalsContact O-CB 3.31Å; M17-D21 WeakPolarHBondContact O-CB 3.43Å; M17-D21 PolarHBondContact O-N 3.31Å
18	E	76.3	Confident	72.9	Confident	102 Å²	102	103 Å²	103	48%	0.477	53%	0.53	S	S	.	.	H	α-helix	trans	-64.7	-36	176.7	-74.9	171.7	143.4	0	0	112.3	K14 I16 T22	K14-E18 WeakPolarHBondContact CE-OE1 3.31Å; K14-E18 HydrophobicContact CG-CG 4.36Å; K14-E18 WeakPolarHBondContact O-CB 3.23Å; K14-E18 VanDerWaalsContact O-CG 3.26Å; K14-E18 WeakPolarHBondContact O-CG 3.21Å; K14-E18 PolarHBondContact O-N 2.88Å; I16-E18 VanDerWaalsContact C-N 3.3Å; I16-E18 PolarHBondContact O-N 3.25Å; E18-T22 PolarHBondContact O-N 3.41Å; E18-T22 PolarHBondContact O-OG1 2.92Å
19	R	77.3	Confident	72.8	Confident	176 Å²	176	106.3 Å²	106.3	66%	0.664	54%	0.541	S	S	*	.	H	α-helix	trans	-73.9	-41.6	174.3	-75.7	176.6	178.6	-157.4	-3.2	112.1	K15 I16 M17 T22 A23	K15-R19 WeakPolarHBondContact O-CG 3.48Å; K15-R19 PolarHBondContact O-N 3.08Å; I16-R19 PolarHBondContact O-N 2.83Å; M17-R19 VanDerWaalsContact C-N 3.33Å; M17-R19 PolarHBondContact O-N 2.9Å; R19-T22 WeakPolarHBondContact O-CB 3.24Å; R19-T22 PolarHBondContact O-N 3.25Å; R19-A23 WeakPolarHBondContact O-CB 3.33Å; R19-A23 PolarHBondContact O-N 2.59Å
20	D	72.8	Confident	72.1	Confident	103 Å²	103	103.7 Å²	103.7	55%	0.551	55%	0.546	S	S	*	.	H	α-helix	trans	-64	-41	176.5	-105.1	-82.6	0	0	0	111.5	I16 M17 T22 A23 A24	I16-D20 PolarHBondContact O-N 3.05Å; M17-D20 PolarHBondContact O-N 3.26Å; D20-T22 VanDerWaalsContact C-N 3.28Å; D20-T22 PolarHBondContact O-N 2.74Å; D20-A23 PolarHBondContact O-N 2.91Å; D20-A24 WeakPolarHBondContact O-CB 3.27Å; D20-A24 PolarHBondContact O-N 2.96Å
21	D	70.9	Confident	71.3	Confident	82 Å²	82	107 Å²	107	44%	0.439	57%	0.566	S	S	.	*	H	α-helix	trans	-61	-39.3	174.3	179.5	-99.5	0	0	0	111.6	M17 K25	M17-D21 VanDerWaalsContact O-CB 3.31Å; M17-D21 WeakPolarHBondContact O-CB 3.43Å; M17-D21 PolarHBondContact O-N 3.31Å; D21-K25 WeakPolarHBondContact O-CB 3.47Å; D21-K25 WeakPolarHBondContact O-CD 3.18Å; D21-K25 VanDerWaalsContact O-CG 3.25Å; D21-K25 WeakPolarHBondContact O-CG 3.43Å; D21-K25 PolarHBondContact O-N 3.29Å; D21-K25 WeakPolarHBondContact OD1-CE 3.4Å; D21-K25 IonicContact OD1-NZ 3.77Å; D21-K25 PolarHBondContact OD1-NZ 2.92Å; D21-K25 IonicContact OD2-NZ 2.74Å
22	T	70.1	Confident	71.1	Confident	86 Å²	86	109.1 Å²	109.1	53%	0.528	57%	0.571	S	S	.	*	H	α-helix	trans	-65.6	-47.2	174.1	-55.8	0	0	0	0	111.2	E18 R19 D20 A24 K25 T26	E18-T22 PolarHBondContact O-N 3.41Å; E18-T22 PolarHBondContact O-OG1 2.92Å; R19-T22 WeakPolarHBondContact O-CB 3.24Å; R19-T22 PolarHBondContact O-N 3.25Å; D20-T22 VanDerWaalsContact C-N 3.28Å; D20-T22 PolarHBondContact O-N 2.74Å; T22-A24 VanDerWaalsContact C-N 3.35Å; T22-A24 PolarHBondContact O-N 3Å; T22-K25 PolarHBondContact O-N 2.78Å; T22-T26 PolarHBondContact O-N 2.96Å; T22-T26 PolarHBondContact O-OG1 3.1Å; T22-T26 VanDerWaalsContact O-OG1 3.08Å
23	A	71.9	Confident	70.6	Confident	57 Å²	57	112.3 Å²	112.3	47%	0.471	58%	0.58	S	S	.	*	H	α-helix	trans	-64	-39.4	178.8	0	0	0	0	0	112.1	R19 D20 T26 L27	R19-A23 WeakPolarHBondContact O-CB 3.33Å; R19-A23 PolarHBondContact O-N 2.59Å; D20-A23 PolarHBondContact O-N 2.91Å; A23-T26 PolarHBondContact O-N 2.83Å; A23-L27 WeakPolarHBondContact O-CB 3.32Å; A23-L27 PolarHBondContact O-N 3.35Å
24	A	70.2	Confident	70.2	Confident	48 Å²	48	113.6 Å²	113.6	40%	0.397	59%	0.587	S	S	.	*	H	α-helix	trans	-64.4	-45.1	176.1	0	0	0	0	0	111.1	D20 T22 T26 L27 V28	D20-A24 WeakPolarHBondContact O-CB 3.27Å; D20-A24 PolarHBondContact O-N 2.96Å; T22-A24 VanDerWaalsContact C-N 3.35Å; T22-A24 PolarHBondContact O-N 3Å; A24-T26 VanDerWaalsContact C-N 3.3Å; A24-T26 PolarHBondContact O-N 3.44Å; A24-L27 PolarHBondContact O-N 3.36Å; A24-V28 VanDerWaalsContact O-CG2 3.25Å; A24-V28 WeakPolarHBondContact O-CG2 3.14Å; A24-V28 PolarHBondContact O-N 3.26Å
25	K	65.9	Low	69.6	Low	124 Å²	124	112.9 Å²	112.9	54%	0.539	59%	0.589	S	S	.	*	H	α-helix	trans	-60.3	-39.6	174.2	-74.9	167.8	179	167.2	0	112.2	D21 T22 L29	D21-K25 WeakPolarHBondContact O-CB 3.47Å; D21-K25 WeakPolarHBondContact O-CD 3.18Å; D21-K25 VanDerWaalsContact O-CG 3.25Å; D21-K25 WeakPolarHBondContact O-CG 3.43Å; D21-K25 PolarHBondContact O-N 3.29Å; D21-K25 WeakPolarHBondContact OD1-CE 3.4Å; D21-K25 IonicContact OD1-NZ 3.77Å; D21-K25 PolarHBondContact OD1-NZ 2.92Å; D21-K25 IonicContact OD2-NZ 2.74Å; T22-K25 PolarHBondContact O-N 2.78Å; K25-L29 WeakPolarHBondContact O-CD1 3.26Å; K25-L29 VanDerWaalsContact O-CG 3.3Å; K25-L29 WeakPolarHBondContact O-CG 3.23Å; K25-L29 PolarHBondContact O-N 3.27Å
26	T	64.5	Low	69	Low	83 Å²	83	112.2 Å²	112.2	51%	0.509	59%	0.592	S	S	.	*	H	α-helix	trans	-66.9	-41.5	175	-57.1	0	0	0	0	112	T22 A23 A24 L29 C30	T22-T26 PolarHBondContact O-N 2.96Å; T22-T26 PolarHBondContact O-OG1 3.1Å; T22-T26 VanDerWaalsContact O-OG1 3.08Å; A23-T26 PolarHBondContact O-N 2.83Å; A24-T26 VanDerWaalsContact C-N 3.3Å; A24-T26 PolarHBondContact O-N 3.44Å; T26-L29 PolarHBondContact O-N 2.86Å; T26-C30 PolarHBondContact O-N 2.63Å
27	L	66.2	Low	68.3	Low	107 Å²	107	112.9 Å²	112.9	56%	0.56	60%	0.597	S	S	*	*	H	α-helix	trans	-64.9	-41	179.5	-168.2	72.9	0	0	0	111.9	A23 A24 L29 C30 F31	A23-L27 WeakPolarHBondContact O-CB 3.32Å; A23-L27 PolarHBondContact O-N 3.35Å; A24-L27 PolarHBondContact O-N 3.36Å; L27-L29 VanDerWaalsContact C-N 3.27Å; L27-L29 PolarHBondContact O-N 3.48Å; L27-C30 PolarHBondContact O-N 3.08Å; L27-F31 HydrophobicContact CD1-CE2 4.05Å; L27-F31 HydrophobicContact CD1-CZ 4.43Å; L27-F31 HydrophobicContact CD2-CE2 4.18Å; L27-F31 HydrophobicContact CG-CD2 4.41Å; L27-F31 HydrophobicContact CG-CE2 3.72Å; L27-F31 VanDerWaalsContact O-CD2 3.27Å; L27-F31 WeakPolarHBondContact O-CD2 3.22Å
28	V	63.6	Low	67.6	Low	114 Å²	114	111.8 Å²	111.8	69%	0.691	59%	0.594	S	S	*	*	H	α-helix	trans	-66.7	-27.9	178.9	174.4	0	0	0	0	112.4	A24	A24-V28 VanDerWaalsContact O-CG2 3.25Å; A24-V28 WeakPolarHBondContact O-CG2 3.14Å; A24-V28 PolarHBondContact O-N 3.26Å
29	L	65.1	Low	66.9	Low	147 Å²	147	112.5 Å²	112.5	77%	0.77	60%	0.603	S	S	*	*	H	α-helix	trans	-83.5	-10.1	179.1	-69.9	170.1	0	0	0	113.9	K25 T26 L27	K25-L29 WeakPolarHBondContact O-CD1 3.26Å; K25-L29 VanDerWaalsContact O-CG 3.3Å; K25-L29 WeakPolarHBondContact O-CG 3.23Å; K25-L29 PolarHBondContact O-N 3.27Å; T26-L29 PolarHBondContact O-N 2.86Å; L27-L29 VanDerWaalsContact C-N 3.27Å; L27-L29 PolarHBondContact O-N 3.48Å
30	C	57.6	Low	66	Low	106 Å²	106	107.3 Å²	107.3	72%	0.716	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.7	14	-177.1	-69.3	0	0	0	0	114.3	T26 L27	T26-C30 PolarHBondContact O-N 2.63Å; L27-C30 PolarHBondContact O-N 3.08Å
31	F	53.5	Low	65.4	Low	230 Å²	230	107.6 Å²	107.6	100%	1.009	60%	0.603	S	S	*	*			trans	-100	0	165.8	-76.7	-66	0	0	0	111.8	L27	L27-F31 HydrophobicContact CD1-CE2 4.05Å; L27-F31 HydrophobicContact CD1-CZ 4.43Å; L27-F31 HydrophobicContact CD2-CE2 4.18Å; L27-F31 HydrophobicContact CG-CD2 4.41Å; L27-F31 HydrophobicContact CG-CE2 3.72Å; L27-F31 VanDerWaalsContact O-CD2 3.27Å; L27-F31 WeakPolarHBondContact O-CD2 3.22Å

Retrieved 31 of 31 residues in 18.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).