A0A068BI50_HUMAN Loading...

Truncated breast and ovarian cancer susceptibility protein 2

AlphaFold DB , UniProt , Accession A0A068BI50, Species HUMAN (Homo sapiens, Human), Gene BRCA2, Length 54 aa.

						>A0A068BI50_HUMAN|A0A068BI50|BRCA2
GKQVSILESSLHKVKGVLEEFDLELSIVFTIHLRLDKMYQKYFLVLIRETQSTV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	G	54.1	Low	80.4	Confident	100 Å²	100	107.4 Å²	107.4	100%	1.031	61%	0.612	S	S	*	*				0	137.6	0	0	0	0	0	0	109.6	Q3 V4	G1-Q3 PolarHBondContact O-N 3.06Å; G1-V4 PolarHBondContact O-N 2.78Å; G1-V4 VanDerWaalsContact O-N 3.14Å
2	K	70.6	Confident	81.3	Confident	187 Å²	187	110.3 Å²	110.3	81%	0.813	62%	0.616	S	S	*	*	H	α-helix	trans	-55.6	-22.8	-168.8	-75.8	-177	175.1	-179.7	0	116.5	S5	K2-S5 PolarHBondContact O-OG 2.94Å
3	Q	69.7	Low	82.2	Confident	174 Å²	174	112.8 Å²	112.8	81%	0.813	62%	0.616	S	S	*	*	H	α-helix	trans	-72.3	-38.7	176.8	-87.7	-179.1	-1.6	0	0	113.1	G1 S5 I6 L7	G1-Q3 PolarHBondContact O-N 3.06Å; Q3-S5 VanDerWaalsContact C-N 3.3Å; Q3-S5 PolarHBondContact O-N 3.46Å; Q3-I6 PolarHBondContact O-N 3.2Å; Q3-L7 PolarHBondContact O-N 3Å
4	V	74.6	Confident	83	Confident	85 Å²	85	110.8 Å²	110.8	52%	0.515	61%	0.609	S	S	.	*	H	α-helix	trans	-63.7	-39.2	-179	-179.6	0	0	0	0	110.5	G1 I6 L7 E8	G1-V4 PolarHBondContact O-N 2.78Å; G1-V4 VanDerWaalsContact O-N 3.14Å; V4-I6 VanDerWaalsContact C-N 3.33Å; V4-I6 PolarHBondContact O-N 3.27Å; V4-L7 PolarHBondContact O-N 3.37Å; V4-E8 WeakPolarHBondContact O-CG 3.44Å; V4-E8 PolarHBondContact O-N 2.88Å
5	S	81.3	Confident	83.6	Confident	65 Å²	65	111.5 Å²	111.5	46%	0.455	60%	0.604	S	S	.	*	H	α-helix	trans	-67.2	-29.2	178.2	56.8	0	0	0	0	114	K2 Q3 S9	K2-S5 PolarHBondContact O-OG 2.94Å; Q3-S5 VanDerWaalsContact C-N 3.3Å; Q3-S5 PolarHBondContact O-N 3.46Å; S5-S9 WeakPolarHBondContact O-CB 3.42Å; S5-S9 PolarHBondContact O-N 3.14Å
6	I	85.3	Confident	84.1	Confident	110 Å²	110	105.9 Å²	105.9	56%	0.564	58%	0.58	S	S	*	*	H	α-helix	trans	-73.4	-40.2	176	-66.5	169.5	0	0	0	110.2	Q3 V4 S9 S10	Q3-I6 PolarHBondContact O-N 3.2Å; V4-I6 VanDerWaalsContact C-N 3.33Å; V4-I6 PolarHBondContact O-N 3.27Å; I6-S9 PolarHBondContact O-N 3.22Å; I6-S10 WeakPolarHBondContact O-CB 3.41Å; I6-S10 PolarHBondContact O-N 3.48Å; I6-S10 PolarHBondContact O-OG 3.18Å
7	L	86.2	Confident	84.6	Confident	112 Å²	112	105.1 Å²	105.1	59%	0.586	58%	0.579	S	S	*	*	H	α-helix	trans	-63.7	-46.8	177.5	-176.2	63.2	0	0	0	111.3	Q3 V4 S9 S10 L11	Q3-L7 PolarHBondContact O-N 3Å; V4-L7 PolarHBondContact O-N 3.37Å; L7-S9 PolarHBondContact O-N 3.22Å; L7-S10 PolarHBondContact O-N 3.4Å; L7-L11 HydrophobicContact CG-CD1 4.27Å; L7-L11 WeakPolarHBondContact O-CG 3.43Å; L7-L11 PolarHBondContact O-N 3.03Å
8	E	88.8	Confident	85	Confident	123 Å²	123	105.6 Å²	105.6	58%	0.575	58%	0.58	S	S	*	*	H	α-helix	trans	-59.9	-44.5	176.9	-72.6	172	164.9	0	0	112.3	V4 S10 L11 H12	V4-E8 WeakPolarHBondContact O-CG 3.44Å; V4-E8 PolarHBondContact O-N 2.88Å; E8-S10 VanDerWaalsContact C-N 3.32Å; E8-S10 PolarHBondContact O-N 3.46Å; E8-L11 PolarHBondContact O-N 3.48Å; E8-H12 PolarHBondContact O-N 3.01Å
9	S	89.6	Confident	85.4	Confident	59 Å²	59	105.7 Å²	105.7	41%	0.413	58%	0.576	S	S	.	*	H	α-helix	trans	-62.6	-39.1	176.2	-177.4	0	0	0	0	112.3	S5 I6 L7 H12 K13	S5-S9 WeakPolarHBondContact O-CB 3.42Å; S5-S9 PolarHBondContact O-N 3.14Å; I6-S9 PolarHBondContact O-N 3.22Å; L7-S9 PolarHBondContact O-N 3.22Å; S9-H12 PolarHBondContact O-N 3.05Å; S9-K13 WeakPolarHBondContact O-CG 3.45Å; S9-K13 PolarHBondContact O-N 3.27Å
10	S	91.6	Very high	85.7	Confident	56 Å²	56	107 Å²	107	39%	0.392	58%	0.578	S	S	.	*	H	α-helix	trans	-68.3	-41.5	178.9	-56.4	0	0	0	0	111.5	I6 L7 E8 H12 K13 V14	I6-S10 WeakPolarHBondContact O-CB 3.41Å; I6-S10 PolarHBondContact O-N 3.48Å; I6-S10 PolarHBondContact O-OG 3.18Å; L7-S10 PolarHBondContact O-N 3.4Å; E8-S10 VanDerWaalsContact C-N 3.32Å; E8-S10 PolarHBondContact O-N 3.46Å; S10-H12 PolarHBondContact O-N 3.3Å; S10-K13 PolarHBondContact O-N 3.06Å; S10-V14 WeakPolarHBondContact O-CG2 3.35Å; S10-V14 PolarHBondContact O-N 2.91Å
11	L	92.3	Very high	86	Confident	110 Å²	110	107.5 Å²	107.5	58%	0.576	58%	0.575	S	S	*	*	H	α-helix	trans	-62.9	-41.3	175.6	-74.2	169.4	0	0	0	112.2	L7 E8 K13 V14 K15	L7-L11 HydrophobicContact CG-CD1 4.27Å; L7-L11 WeakPolarHBondContact O-CG 3.43Å; L7-L11 PolarHBondContact O-N 3.03Å; E8-L11 PolarHBondContact O-N 3.48Å; L11-K13 VanDerWaalsContact C-N 3.31Å; L11-K13 PolarHBondContact O-N 3.43Å; L11-V14 PolarHBondContact O-N 3.37Å; L11-K15 WeakPolarHBondContact O-CB 3.4Å; L11-K15 PolarHBondContact O-N 3.47Å
12	H	92.2	Very high	87.9	Confident	142 Å²	142	108.1 Å²	108.1	66%	0.657	56%	0.555	S	S	*	*	H	α-helix	trans	-62.5	-39.3	176.8	-170.2	-73.5	0	0	0	112	E8 S9 S10 K15 G16	E8-H12 PolarHBondContact O-N 3.01Å; S9-H12 PolarHBondContact O-N 3.05Å; S10-H12 PolarHBondContact O-N 3.3Å; H12-K15 PolarHBondContact O-N 3.48Å; H12-G16 PolarHBondContact O-N 3.31Å
13	K	92.8	Very high	88.9	Confident	143 Å²	143	104.4 Å²	104.4	62%	0.622	54%	0.543	S	S	*	.	H	α-helix	trans	-64.3	-45.4	175.4	-71.2	174.3	-176.7	-178.6	0	111.7	S9 S10 L11 K15 G16 V17	S9-K13 WeakPolarHBondContact O-CG 3.45Å; S9-K13 PolarHBondContact O-N 3.27Å; S10-K13 PolarHBondContact O-N 3.06Å; L11-K13 VanDerWaalsContact C-N 3.31Å; L11-K13 PolarHBondContact O-N 3.43Å; K13-K15 VanDerWaalsContact C-N 3.32Å; K13-K15 PolarHBondContact O-N 3.29Å; K13-G16 PolarHBondContact O-N 3.5Å; K13-V17 WeakPolarHBondContact O-CG2 3.48Å; K13-V17 PolarHBondContact O-N 3.02Å
14	V	92.6	Very high	90	Very high	85 Å²	85	102 Å²	102	52%	0.515	53%	0.532	S	S	.	.	H	α-helix	trans	-61.5	-42.5	177	174.3	0	0	0	0	110.9	S10 L11 G16 V17 L18	S10-V14 WeakPolarHBondContact O-CG2 3.35Å; S10-V14 PolarHBondContact O-N 2.91Å; L11-V14 PolarHBondContact O-N 3.37Å; V14-G16 PolarHBondContact O-N 3.42Å; V14-V17 PolarHBondContact O-N 3.35Å; V14-L18 HydrophobicContact CG1-CD1 4.07Å; V14-L18 HydrophobicContact CG1-CG 4.44Å; V14-L18 WeakPolarHBondContact O-CG 3.43Å; V14-L18 PolarHBondContact O-N 3.2Å
15	K	93.1	Very high	90.9	Very high	121 Å²	121	102.2 Å²	102.2	53%	0.526	53%	0.53	S	S	.	.	H	α-helix	trans	-58.5	-46.4	175.6	-170.4	177.1	-174.2	-81.7	0	111.8	L11 H12 K13 V17 L18 E19	L11-K15 WeakPolarHBondContact O-CB 3.4Å; L11-K15 PolarHBondContact O-N 3.47Å; H12-K15 PolarHBondContact O-N 3.48Å; K13-K15 VanDerWaalsContact C-N 3.32Å; K13-K15 PolarHBondContact O-N 3.29Å; K15-V17 PolarHBondContact O-N 3.48Å; K15-L18 PolarHBondContact O-N 3.24Å; K15-E19 IonicContact NZ-OE1 2.65Å; K15-E19 PolarHBondContact NZ-OE1 3.49Å; K15-E19 WeakPolarHBondContact O-CG 3.42Å; K15-E19 PolarHBondContact O-N 3.42Å
16	G	91.6	Very high	91.5	Very high	22 Å²	22	102.2 Å²	102.2	23%	0.227	53%	0.529	C	S	.	.	H	α-helix	trans	-60.1	-44.4	177.4	0	0	0	0	0	112.8	H12 K13 V14 L18 E19 E20	H12-G16 PolarHBondContact O-N 3.31Å; K13-G16 PolarHBondContact O-N 3.5Å; V14-G16 PolarHBondContact O-N 3.42Å; G16-L18 VanDerWaalsContact C-N 3.33Å; G16-L18 PolarHBondContact O-N 2.99Å; G16-E19 PolarHBondContact O-N 3.26Å; G16-E20 WeakPolarHBondContact O-CG 3.37Å; G16-E20 PolarHBondContact O-N 3.03Å
17	V	92.1	Very high	91.9	Very high	93 Å²	93	101.1 Å²	101.1	56%	0.564	52%	0.524	S	S	*	.	H	α-helix	trans	-62.6	-39.8	176.9	173.5	0	0	0	0	111.8	K13 V14 K15 E20 F21	K13-V17 WeakPolarHBondContact O-CG2 3.48Å; K13-V17 PolarHBondContact O-N 3.02Å; V14-V17 PolarHBondContact O-N 3.35Å; K15-V17 PolarHBondContact O-N 3.48Å; V17-E20 PolarHBondContact O-N 3.02Å; V17-F21 WeakPolarHBondContact O-CB 3.47Å; V17-F21 PolarHBondContact O-N 3Å
18	L	91.3	Very high	92.3	Very high	114 Å²	114	100.4 Å²	100.4	60%	0.597	52%	0.524	S	S	*	.	H	α-helix	trans	-66.5	-38.5	176.9	-69.8	172.3	0	0	0	112.1	V14 K15 G16 F21 D22	V14-L18 HydrophobicContact CG1-CD1 4.07Å; V14-L18 HydrophobicContact CG1-CG 4.44Å; V14-L18 WeakPolarHBondContact O-CG 3.43Å; V14-L18 PolarHBondContact O-N 3.2Å; K15-L18 PolarHBondContact O-N 3.24Å; G16-L18 VanDerWaalsContact C-N 3.33Å; G16-L18 PolarHBondContact O-N 2.99Å; L18-F21 PolarHBondContact O-N 3.27Å; L18-D22 PolarHBondContact O-N 3.04Å
19	E	92.6	Very high	92.5	Very high	108 Å²	108	100.6 Å²	100.6	51%	0.505	52%	0.523	S	S	.	.	H	α-helix	trans	-67.1	-40.8	176.5	-72.2	170.4	176.5	0	0	112	K15 G16 D22 L23	K15-E19 IonicContact NZ-OE1 2.65Å; K15-E19 PolarHBondContact NZ-OE1 3.49Å; K15-E19 WeakPolarHBondContact O-CG 3.42Å; K15-E19 PolarHBondContact O-N 3.42Å; G16-E19 PolarHBondContact O-N 3.26Å; E19-D22 PolarHBondContact O-N 3.44Å; E19-L23 PolarHBondContact O-N 3.33Å; E19-L23 VanDerWaalsContact O-N 3.11Å
20	E	91.8	Very high	92.8	Very high	130 Å²	130	100.5 Å²	100.5	61%	0.607	52%	0.52	S	S	*	.	H	α-helix	trans	-62	-45.3	173.8	-74.1	174.9	-175.4	0	0	111.6	G16 V17 D22 L23 E24	G16-E20 WeakPolarHBondContact O-CG 3.37Å; G16-E20 PolarHBondContact O-N 3.03Å; V17-E20 PolarHBondContact O-N 3.02Å; E20-D22 PolarHBondContact O-N 2.97Å; E20-L23 WeakPolarHBondContact O-CB 3.38Å; E20-L23 PolarHBondContact O-N 3.03Å; E20-E24 WeakPolarHBondContact O-CG 3.35Å; E20-E24 PolarHBondContact O-N 3.43Å
21	F	92.1	Very high	92.9	Very high	119 Å²	119	102.3 Å²	102.3	52%	0.522	52%	0.524	S	S	.	.	H	α-helix	trans	-63.8	-39.2	178.7	-171.7	-105.2	0	0	0	112.9	V17 L18 L23 E24 L25	V17-F21 WeakPolarHBondContact O-CB 3.47Å; V17-F21 PolarHBondContact O-N 3Å; L18-F21 PolarHBondContact O-N 3.27Å; F21-L23 VanDerWaalsContact C-N 3.35Å; F21-E24 PolarHBondContact O-N 3.46Å; F21-L25 HydrophobicContact CD1-CD1 3.84Å; F21-L25 HydrophobicContact CD1-CG 4.49Å; F21-L25 HydrophobicContact CE1-CD1 3.48Å; F21-L25 VanDerWaalsContact CE1-CD1 3.48Å; F21-L25 HydrophobicContact CE1-CG 4.17Å; F21-L25 HydrophobicContact CZ-CD1 4.15Å; F21-L25 HydrophobicContact CZ-CG 4.42Å; F21-L25 PolarHBondContact O-N 2.89Å
22	D	92.9	Very high	92.9	Very high	113 Å²	113	102.7 Å²	102.7	60%	0.604	52%	0.523	S	S	*	.	H	α-helix	trans	-64.9	-39.8	176	-167	51.4	0	0	0	111.7	L18 E19 E20 L25 S26	L18-D22 PolarHBondContact O-N 3.04Å; E19-D22 PolarHBondContact O-N 3.44Å; E20-D22 PolarHBondContact O-N 2.97Å; D22-L25 PolarHBondContact O-N 3.26Å; D22-S26 WeakPolarHBondContact O-CB 3.45Å; D22-S26 PolarHBondContact O-N 3.27Å
23	L	92.9	Very high	92.9	Very high	109 Å²	109	100.1 Å²	100.1	57%	0.571	51%	0.514	S	S	*	.	H	α-helix	trans	-61.9	-45.5	173.7	-179.8	64.1	0	0	0	111.8	E19 E20 F21 L25 S26 I27	E19-L23 PolarHBondContact O-N 3.33Å; E19-L23 VanDerWaalsContact O-N 3.11Å; E20-L23 WeakPolarHBondContact O-CB 3.38Å; E20-L23 PolarHBondContact O-N 3.03Å; F21-L23 VanDerWaalsContact C-N 3.35Å; L23-L25 PolarHBondContact O-N 2.97Å; L23-S26 WeakPolarHBondContact O-CB 3.47Å; L23-S26 PolarHBondContact O-N 3.5Å; L23-I27 HydrophobicContact CD1-CD1 4.37Å; L23-I27 HydrophobicContact CG-CD1 4.12Å; L23-I27 WeakPolarHBondContact O-CG1 3.41Å; L23-I27 PolarHBondContact O-N 3Å
24	E	93.1	Very high	93.1	Very high	122 Å²	122	102.1 Å²	102.1	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-59.3	-46.4	177.1	-73	-177.4	168.7	0	0	111.7	E20 F21 S26 I27 V28	E20-E24 WeakPolarHBondContact O-CG 3.35Å; E20-E24 PolarHBondContact O-N 3.43Å; F21-E24 PolarHBondContact O-N 3.46Å; E24-S26 VanDerWaalsContact C-N 3.33Å; E24-S26 PolarHBondContact O-N 3.42Å; E24-I27 PolarHBondContact O-N 3.43Å; E24-V28 WeakPolarHBondContact O-CG2 3.07Å; E24-V28 PolarHBondContact O-N 2.99Å
25	L	92.3	Very high	93.1	Very high	91 Å²	91	101.8 Å²	101.8	48%	0.476	51%	0.512	S	S	.	.	H	α-helix	trans	-59.8	-42.9	175.8	-79.6	171.4	0	0	0	112.2	F21 D22 L23 I27 V28 F29	F21-L25 HydrophobicContact CD1-CD1 3.84Å; F21-L25 HydrophobicContact CD1-CG 4.49Å; F21-L25 HydrophobicContact CE1-CD1 3.48Å; F21-L25 VanDerWaalsContact CE1-CD1 3.48Å; F21-L25 HydrophobicContact CE1-CG 4.17Å; F21-L25 HydrophobicContact CZ-CD1 4.15Å; F21-L25 HydrophobicContact CZ-CG 4.42Å; F21-L25 PolarHBondContact O-N 2.89Å; D22-L25 PolarHBondContact O-N 3.26Å; L23-L25 PolarHBondContact O-N 2.97Å; L25-I27 VanDerWaalsContact C-N 3.35Å; L25-I27 PolarHBondContact O-N 3.47Å; L25-V28 PolarHBondContact O-N 3.11Å; L25-F29 WeakPolarHBondContact O-CB 3.48Å; L25-F29 PolarHBondContact O-N 2.65Å
26	S	93.5	Very high	93	Very high	64 Å²	64	99.5 Å²	99.5	45%	0.448	51%	0.506	S	S	.	.	H	α-helix	trans	-62.3	-40.5	177.7	-176	0	0	0	0	112.5	D22 L23 E24 T30	D22-S26 WeakPolarHBondContact O-CB 3.45Å; D22-S26 PolarHBondContact O-N 3.27Å; L23-S26 WeakPolarHBondContact O-CB 3.47Å; L23-S26 PolarHBondContact O-N 3.5Å; E24-S26 VanDerWaalsContact C-N 3.33Å; E24-S26 PolarHBondContact O-N 3.42Å; S26-T30 WeakPolarHBondContact O-CB 3.43Å; S26-T30 PolarHBondContact O-N 3.29Å; S26-T30 PolarHBondContact O-OG1 3Å
27	I	94.8	Very high	93	Very high	87 Å²	87	106 Å²	106	45%	0.446	53%	0.528	S	S	.	.	H	α-helix	trans	-63.7	-49.2	175	-68.8	166.7	0	0	0	110.5	L23 E24 L25 F29 T30 I31	L23-I27 HydrophobicContact CD1-CD1 4.37Å; L23-I27 HydrophobicContact CG-CD1 4.12Å; L23-I27 WeakPolarHBondContact O-CG1 3.41Å; L23-I27 PolarHBondContact O-N 3Å; E24-I27 PolarHBondContact O-N 3.43Å; L25-I27 VanDerWaalsContact C-N 3.35Å; L25-I27 PolarHBondContact O-N 3.47Å; I27-F29 VanDerWaalsContact C-N 3.34Å; I27-F29 PolarHBondContact O-N 2.93Å; I27-T30 PolarHBondContact O-N 3.38Å; I27-I31 HydrophobicContact CG2-CD1 3.86Å; I27-I31 WeakPolarHBondContact O-CG1 3.35Å; I27-I31 PolarHBondContact O-N 3.3Å
28	V	93.6	Very high	93	Very high	97 Å²	97	106.1 Å²	106.1	59%	0.588	52%	0.523	S	S	*	.	H	α-helix	trans	-59.3	-46.3	179.4	171.9	0	0	0	0	110.9	E24 L25 T30 I31 H32	E24-V28 WeakPolarHBondContact O-CG2 3.07Å; E24-V28 PolarHBondContact O-N 2.99Å; L25-V28 PolarHBondContact O-N 3.11Å; V28-T30 PolarHBondContact O-N 3.47Å; V28-I31 PolarHBondContact O-N 2.96Å; V28-H32 WeakPolarHBondContact O-CB 3.49Å; V28-H32 PolarHBondContact O-N 3.33Å
29	F	93.7	Very high	93	Very high	127 Å²	127	108.4 Å²	108.4	56%	0.557	53%	0.525	S	S	*	.	H	α-helix	trans	-61.4	-42.9	177.8	-176.7	-106.1	0	0	0	112.1	L25 I27 I31 H32 L33	L25-F29 WeakPolarHBondContact O-CB 3.48Å; L25-F29 PolarHBondContact O-N 2.65Å; I27-F29 VanDerWaalsContact C-N 3.34Å; I27-F29 PolarHBondContact O-N 2.93Å; F29-I31 PolarHBondContact O-N 3.23Å; F29-H32 PolarHBondContact O-N 2.97Å; F29-L33 HydrophobicContact CD1-CD1 3.9Å; F29-L33 HydrophobicContact CD1-CG 4.43Å; F29-L33 HydrophobicContact CE1-CD1 3.33Å; F29-L33 HydrophobicContact CE1-CG 4.05Å; F29-L33 HydrophobicContact CE2-CG 4.44Å; F29-L33 HydrophobicContact CZ-CD1 3.7Å; F29-L33 HydrophobicContact CZ-CD2 4.25Å; F29-L33 HydrophobicContact CZ-CG 4.05Å; F29-L33 PolarHBondContact O-N 2.81Å
30	T	95.3	Very high	92.9	Very high	58 Å²	58	108.8 Å²	108.8	36%	0.356	53%	0.527	S	S	.	.	H	α-helix	trans	-63.2	-42.4	177.8	-62	0	0	0	0	112.1	S26 I27 V28 R34	S26-T30 WeakPolarHBondContact O-CB 3.43Å; S26-T30 PolarHBondContact O-N 3.29Å; S26-T30 PolarHBondContact O-OG1 3Å; I27-T30 PolarHBondContact O-N 3.38Å; V28-T30 PolarHBondContact O-N 3.47Å; T30-R34 WeakPolarHBondContact O-CG 3.38Å; T30-R34 PolarHBondContact O-N 3.45Å; T30-R34 VanDerWaalsContact O-N 3.13Å
31	I	94.4	Very high	92.7	Very high	93 Å²	93	109.9 Å²	109.9	48%	0.477	53%	0.53	S	S	.	.	H	α-helix	trans	-62.6	-46.6	175.7	-69.2	169	0	0	0	110	I27 V28 F29 L33 R34 L35	I27-I31 HydrophobicContact CG2-CD1 3.86Å; I27-I31 WeakPolarHBondContact O-CG1 3.35Å; I27-I31 PolarHBondContact O-N 3.3Å; V28-I31 PolarHBondContact O-N 2.96Å; F29-I31 PolarHBondContact O-N 3.23Å; I31-L33 PolarHBondContact O-N 3.24Å; I31-R34 PolarHBondContact O-N 2.96Å; I31-L35 HydrophobicContact CG2-CD1 3.88Å; I31-L35 HydrophobicContact CG2-CG 4.33Å; I31-L35 WeakPolarHBondContact O-CG 3.48Å; I31-L35 PolarHBondContact O-N 3.49Å
32	H	91.3	Very high	92.5	Very high	119 Å²	119	111.7 Å²	111.7	55%	0.551	53%	0.534	S	S	*	.	H	α-helix	trans	-56.6	-49.8	178.7	179.7	73.2	0	0	0	111.9	V28 F29 R34 L35 D36	V28-H32 WeakPolarHBondContact O-CB 3.49Å; V28-H32 PolarHBondContact O-N 3.33Å; F29-H32 PolarHBondContact O-N 2.97Å; H32-R34 VanDerWaalsContact C-N 3.34Å; H32-R34 PolarHBondContact O-N 3.13Å; H32-L35 PolarHBondContact O-N 3.46Å; H32-D36 WeakPolarHBondContact O-CB 3.46Å; H32-D36 PolarHBondContact O-N 2.96Å
33	L	93.6	Very high	92.3	Very high	88 Å²	88	112.6 Å²	112.6	46%	0.461	53%	0.533	S	S	.	.	H	α-helix	trans	-60.7	-40	178	-74	180	0	0	0	113.1	F29 I31 K37	F29-L33 HydrophobicContact CD1-CD1 3.9Å; F29-L33 HydrophobicContact CD1-CG 4.43Å; F29-L33 HydrophobicContact CE1-CD1 3.33Å; F29-L33 HydrophobicContact CE1-CG 4.05Å; F29-L33 HydrophobicContact CE2-CG 4.44Å; F29-L33 HydrophobicContact CZ-CD1 3.7Å; F29-L33 HydrophobicContact CZ-CD2 4.25Å; F29-L33 HydrophobicContact CZ-CG 4.05Å; F29-L33 PolarHBondContact O-N 2.81Å; I31-L33 PolarHBondContact O-N 3.24Å; L33-K37 WeakPolarHBondContact O-CB 3.47Å; L33-K37 PolarHBondContact O-N 3.47Å; L33-K37 VanDerWaalsContact O-N 3.08Å
34	R	95.5	Very high	92.1	Very high	184 Å²	184	112 Å²	112	69%	0.694	53%	0.53	S	S	*	.	H	α-helix	trans	-66.5	-43.3	178.2	-78.1	-178.4	178	-174.3	1.1	111.7	T30 I31 H32 M38	T30-R34 WeakPolarHBondContact O-CG 3.38Å; T30-R34 PolarHBondContact O-N 3.45Å; T30-R34 VanDerWaalsContact O-N 3.13Å; I31-R34 PolarHBondContact O-N 2.96Å; H32-R34 VanDerWaalsContact C-N 3.34Å; H32-R34 PolarHBondContact O-N 3.13Å; R34-M38 WeakPolarHBondContact O-CG 3.33Å; R34-M38 PolarHBondContact O-N 3.43Å
35	L	92.7	Very high	91.9	Very high	78 Å²	78	109.3 Å²	109.3	41%	0.408	52%	0.522	S	S	.	.	H	α-helix	trans	-63.5	-48.6	177.3	-72.5	175.9	0	0	0	110.9	I31 H32 K37 M38 Y39	I31-L35 HydrophobicContact CG2-CD1 3.88Å; I31-L35 HydrophobicContact CG2-CG 4.33Å; I31-L35 WeakPolarHBondContact O-CG 3.48Å; I31-L35 PolarHBondContact O-N 3.49Å; H32-L35 PolarHBondContact O-N 3.46Å; L35-K37 VanDerWaalsContact C-N 3.33Å; L35-K37 PolarHBondContact O-N 3.28Å; L35-M38 WeakPolarHBondContact O-CB 3.45Å; L35-M38 PolarHBondContact O-N 2.91Å; L35-M38 VanDerWaalsContact O-N 3.08Å; L35-Y39 HydrophobicContact CB-CD2 4.27Å; L35-Y39 HydrophobicContact CB-CE2 4.13Å; L35-Y39 HydrophobicContact CD2-CE2 4.3Å; L35-Y39 WeakPolarHBondContact O-CD2 3.48Å; L35-Y39 PolarHBondContact O-N 2.89Å
36	D	91.4	Very high	91.7	Very high	73 Å²	73	109.8 Å²	109.8	39%	0.39	52%	0.524	S	S	.	.	H	α-helix	trans	-55.4	-48.2	177.8	-176.9	57.2	0	0	0	111.6	H32 M38 Y39 Q40	H32-D36 WeakPolarHBondContact O-CB 3.46Å; H32-D36 PolarHBondContact O-N 2.96Å; D36-M38 VanDerWaalsContact C-N 3.34Å; D36-M38 PolarHBondContact O-N 3.47Å; D36-Y39 PolarHBondContact O-N 3.11Å; D36-Q40 WeakPolarHBondContact O-CB 3.35Å; D36-Q40 WeakPolarHBondContact O-CG 3.45Å; D36-Q40 PolarHBondContact O-N 3.08Å; D36-Q40 PolarHBondContact OD1-NE2 2.93Å; D36-Q40 PolarHBondContact OD2-NE2 2.91Å
37	K	92.8	Very high	91.4	Very high	158 Å²	158	109.8 Å²	109.8	69%	0.687	52%	0.519	S	S	*	.	H	α-helix	trans	-61.4	-39.4	176.3	-172.6	174.4	-177.5	175.4	0	113	L33 L35 K41	L33-K37 WeakPolarHBondContact O-CB 3.47Å; L33-K37 PolarHBondContact O-N 3.47Å; L33-K37 VanDerWaalsContact O-N 3.08Å; L35-K37 VanDerWaalsContact C-N 3.33Å; L35-K37 PolarHBondContact O-N 3.28Å; K37-K41 WeakPolarHBondContact O-CB 3.4Å; K37-K41 PolarHBondContact O-N 3.41Å; K37-K41 VanDerWaalsContact O-N 3.15Å
38	M	92.1	Very high	91.1	Very high	97 Å²	97	113.8 Å²	113.8	48%	0.478	53%	0.528	S	S	.	.	H	α-helix	trans	-63.9	-51.3	175.4	-81.8	-175.7	58.2	0	0	110.9	R34 L35 D36 Q40 K41 Y42	R34-M38 WeakPolarHBondContact O-CG 3.33Å; R34-M38 PolarHBondContact O-N 3.43Å; L35-M38 WeakPolarHBondContact O-CB 3.45Å; L35-M38 PolarHBondContact O-N 2.91Å; L35-M38 VanDerWaalsContact O-N 3.08Å; D36-M38 VanDerWaalsContact C-N 3.34Å; D36-M38 PolarHBondContact O-N 3.47Å; M38-Q40 PolarHBondContact O-N 2.98Å; M38-K41 WeakPolarHBondContact O-CB 3.44Å; M38-K41 PolarHBondContact O-N 3.28Å; M38-K41 VanDerWaalsContact O-N 3.11Å; M38-Y42 HydrophobicContact CB-CD2 4.4Å; M38-Y42 HydrophobicContact CB-CE2 4.33Å; M38-Y42 HydrophobicContact CE-CE2 3.71Å; M38-Y42 WeakPolarHBondContact O-CD2 3.1Å; M38-Y42 PolarHBondContact O-N 2.86Å
39	Y	90.9	Very high	90.9	Very high	161 Å²	161	114.6 Å²	114.6	63%	0.631	53%	0.525	S	S	*	.	H	α-helix	trans	-61.1	-42.4	-178.9	-75.8	-65.8	0	0	0	112.3	L35 D36 K41 Y42 F43	L35-Y39 HydrophobicContact CB-CD2 4.27Å; L35-Y39 HydrophobicContact CB-CE2 4.13Å; L35-Y39 HydrophobicContact CD2-CE2 4.3Å; L35-Y39 WeakPolarHBondContact O-CD2 3.48Å; L35-Y39 PolarHBondContact O-N 2.89Å; D36-Y39 PolarHBondContact O-N 3.11Å; Y39-K41 VanDerWaalsContact C-N 3.31Å; Y39-K41 PolarHBondContact O-N 3.15Å; Y39-Y42 PolarHBondContact O-N 3.36Å; Y39-F43 WeakPolarHBondContact O-CB 3.45Å; Y39-F43 PolarHBondContact O-N 3.36Å
40	Q	89.1	Confident	90.5	Very high	117 Å²	117	112.7 Å²	112.7	55%	0.547	53%	0.525	S	S	.	.	H	α-helix	trans	-58.4	-43.5	173.5	-73.3	177.6	6.4	0	0	111.9	D36 M38 F43 L44	D36-Q40 WeakPolarHBondContact O-CB 3.35Å; D36-Q40 WeakPolarHBondContact O-CG 3.45Å; D36-Q40 PolarHBondContact O-N 3.08Å; D36-Q40 PolarHBondContact OD1-NE2 2.93Å; D36-Q40 PolarHBondContact OD2-NE2 2.91Å; M38-Q40 PolarHBondContact O-N 2.98Å; Q40-F43 PolarHBondContact O-N 3.08Å; Q40-L44 PolarHBondContact O-N 3.33Å; Q40-L44 VanDerWaalsContact O-N 3.09Å
41	K	88.5	Confident	89.8	Confident	153 Å²	153	116.5 Å²	116.5	67%	0.665	54%	0.538	S	S	*	.	H	α-helix	trans	-64.5	-44.9	177.2	-172.7	-178.8	178.5	-174.6	0	111.7	K37 M38 Y39 F43 L44 V45	K37-K41 WeakPolarHBondContact O-CB 3.4Å; K37-K41 PolarHBondContact O-N 3.41Å; K37-K41 VanDerWaalsContact O-N 3.15Å; M38-K41 WeakPolarHBondContact O-CB 3.44Å; M38-K41 PolarHBondContact O-N 3.28Å; M38-K41 VanDerWaalsContact O-N 3.11Å; Y39-K41 VanDerWaalsContact C-N 3.31Å; Y39-K41 PolarHBondContact O-N 3.15Å; K41-F43 VanDerWaalsContact C-N 3.35Å; K41-L44 PolarHBondContact O-N 3Å; K41-V45 WeakPolarHBondContact O-CG2 3.4Å; K41-V45 PolarHBondContact O-N 3.1Å; K41-V45 VanDerWaalsContact O-N 3.14Å
42	Y	88.9	Confident	88.9	Confident	156 Å²	156	116.5 Å²	116.5	61%	0.612	55%	0.546	S	S	*	.	H	α-helix	trans	-61	-44.4	177.3	-81.9	-71	0	0	0	111.8	M38 Y39 L44 V45 L46	M38-Y42 HydrophobicContact CB-CD2 4.4Å; M38-Y42 HydrophobicContact CB-CE2 4.33Å; M38-Y42 HydrophobicContact CE-CE2 3.71Å; M38-Y42 WeakPolarHBondContact O-CD2 3.1Å; M38-Y42 PolarHBondContact O-N 2.86Å; Y39-Y42 PolarHBondContact O-N 3.36Å; Y42-L44 VanDerWaalsContact C-N 3.33Å; Y42-L44 PolarHBondContact O-N 2.98Å; Y42-V45 PolarHBondContact O-N 3.2Å; Y42-L46 PolarHBondContact O-N 3.09Å
43	F	87.7	Confident	87.9	Confident	132 Å²	132	116.5 Å²	116.5	58%	0.579	56%	0.555	S	S	*	*	H	α-helix	trans	-61.1	-41.8	178.5	-171.3	-106.3	0	0	0	112	Y39 Q40 K41 V45 L46 I47	Y39-F43 WeakPolarHBondContact O-CB 3.45Å; Y39-F43 PolarHBondContact O-N 3.36Å; Q40-F43 PolarHBondContact O-N 3.08Å; K41-F43 VanDerWaalsContact C-N 3.35Å; F43-V45 PolarHBondContact O-N 2.74Å; F43-L46 PolarHBondContact O-N 3.48Å; F43-I47 HydrophobicContact CD1-CD1 3.76Å; F43-I47 HydrophobicContact CE1-CD1 3.37Å; F43-I47 HydrophobicContact CE1-CG1 4.3Å; F43-I47 HydrophobicContact CZ-CD1 3.89Å; F43-I47 HydrophobicContact CZ-CG1 4.47Å; F43-I47 WeakPolarHBondContact O-CG1 3.4Å; F43-I47 PolarHBondContact O-N 3.01Å; F43-I47 VanDerWaalsContact O-N 3.09Å
44	L	87.9	Confident	86.2	Confident	96 Å²	96	120.8 Å²	120.8	50%	0.503	58%	0.584	S	S	.	*	H	α-helix	trans	-62.7	-40.6	176.2	-169.9	78.4	0	0	0	112.6	Q40 K41 Y42 R48	Q40-L44 PolarHBondContact O-N 3.33Å; Q40-L44 VanDerWaalsContact O-N 3.09Å; K41-L44 PolarHBondContact O-N 3Å; Y42-L44 VanDerWaalsContact C-N 3.33Å; Y42-L44 PolarHBondContact O-N 2.98Å; L44-R48 WeakPolarHBondContact O-CG 3.47Å; L44-R48 PolarHBondContact O-N 3.22Å
45	V	90	Very high	85.8	Confident	66 Å²	66	117.6 Å²	117.6	40%	0.4	58%	0.579	S	S	.	*	H	α-helix	trans	-63.5	-47.6	176.9	172.7	0	0	0	0	110.3	K41 Y42 F43 I47 R48 E49	K41-V45 WeakPolarHBondContact O-CG2 3.4Å; K41-V45 PolarHBondContact O-N 3.1Å; K41-V45 VanDerWaalsContact O-N 3.14Å; Y42-V45 PolarHBondContact O-N 3.2Å; F43-V45 PolarHBondContact O-N 2.74Å; V45-I47 VanDerWaalsContact C-N 3.31Å; V45-I47 PolarHBondContact O-N 2.98Å; V45-R48 PolarHBondContact O-N 3.14Å; V45-R48 VanDerWaalsContact O-N 3.1Å; V45-E49 HydrophobicContact CG1-CG 4.4Å; V45-E49 PolarHBondContact O-N 3.33Å
46	L	88.8	Confident	85.4	Confident	102 Å²	102	119.7 Å²	119.7	53%	0.534	59%	0.588	S	S	.	*	H	α-helix	trans	-56.7	-43.8	179.1	-166.6	88.2	0	0	0	112	Y42 F43 E49 T50	Y42-L46 PolarHBondContact O-N 3.09Å; F43-L46 PolarHBondContact O-N 3.48Å; L46-E49 PolarHBondContact O-N 3.36Å; L46-T50 WeakPolarHBondContact O-CB 3.41Å; L46-T50 PolarHBondContact O-N 3.42Å; L46-T50 PolarHBondContact O-OG1 3.09Å
47	I	85.9	Confident	85.1	Confident	64 Å²	64	122.3 Å²	122.3	33%	0.328	60%	0.599	S	S	.	*	H	α-helix	trans	-60.6	-46.9	176.6	-71.2	172.7	0	0	0	110.9	F43 V45 T50 Q51	F43-I47 HydrophobicContact CD1-CD1 3.76Å; F43-I47 HydrophobicContact CE1-CD1 3.37Å; F43-I47 HydrophobicContact CE1-CG1 4.3Å; F43-I47 HydrophobicContact CZ-CD1 3.89Å; F43-I47 HydrophobicContact CZ-CG1 4.47Å; F43-I47 WeakPolarHBondContact O-CG1 3.4Å; F43-I47 PolarHBondContact O-N 3.01Å; F43-I47 VanDerWaalsContact O-N 3.09Å; V45-I47 VanDerWaalsContact C-N 3.31Å; V45-I47 PolarHBondContact O-N 2.98Å; I47-T50 PolarHBondContact O-N 3.36Å; I47-Q51 HydrophobicContact CG2-CG 4.46Å; I47-Q51 WeakPolarHBondContact O-CG 3.46Å; I47-Q51 PolarHBondContact O-N 3.47Å
48	R	89.6	Confident	84.6	Confident	170 Å²	170	120.2 Å²	120.2	64%	0.642	59%	0.593	S	S	*	*	H	α-helix	trans	-62.6	-44.1	-179.1	-74.3	-178.7	179.1	-150.3	-0.9	112	L44 V45 Q51 S52	L44-R48 WeakPolarHBondContact O-CG 3.47Å; L44-R48 PolarHBondContact O-N 3.22Å; V45-R48 PolarHBondContact O-N 3.14Å; V45-R48 VanDerWaalsContact O-N 3.1Å; R48-Q51 PolarHBondContact O-N 2.71Å; R48-S52 WeakPolarHBondContact O-CB 3.5Å; R48-S52 PolarHBondContact O-N 2.79Å; R48-S52 PolarHBondContact O-OG 3.1Å
49	E	89	Confident	84.2	Confident	114 Å²	114	121.6 Å²	121.6	53%	0.533	60%	0.601	S	S	.	*	H	α-helix	trans	-61.6	-46.5	176.9	-71.7	-179.1	168.5	0	0	110.7	V45 L46 Q51 S52 T53	V45-E49 HydrophobicContact CG1-CG 4.4Å; V45-E49 PolarHBondContact O-N 3.33Å; L46-E49 PolarHBondContact O-N 3.36Å; E49-Q51 VanDerWaalsContact C-N 3.31Å; E49-Q51 PolarHBondContact O-N 3.26Å; E49-S52 PolarHBondContact O-N 3.4Å; E49-S52 VanDerWaalsContact O-N 3.1Å; E49-S52 PolarHBondContact O-OG 3.03Å; E49-T53 PolarHBondContact O-N 3.33Å; E49-T53 PolarHBondContact O-OG1 3.36Å
50	T	84.6	Confident	83.7	Confident	88 Å²	88	119 Å²	119	54%	0.54	60%	0.599	S	S	.	*	H	α-helix	trans	-59.5	-41.2	178.4	-50.7	0	0	0	0	111.9	L46 I47	L46-T50 WeakPolarHBondContact O-CB 3.41Å; L46-T50 PolarHBondContact O-N 3.42Å; L46-T50 PolarHBondContact O-OG1 3.09Å; I47-T50 PolarHBondContact O-N 3.36Å
51	Q	80.7	Confident	83.3	Confident	138 Å²	138	119.1 Å²	119.1	65%	0.645	60%	0.602	S	S	*	*	H	α-helix	trans	-71.7	-25.6	177.4	-72.3	178.9	-14.6	0	0	114	I47 R48 E49	I47-Q51 HydrophobicContact CG2-CG 4.46Å; I47-Q51 WeakPolarHBondContact O-CG 3.46Å; I47-Q51 PolarHBondContact O-N 3.47Å; R48-Q51 PolarHBondContact O-N 2.71Å; E49-Q51 VanDerWaalsContact C-N 3.31Å; E49-Q51 PolarHBondContact O-N 3.26Å
52	S	75.4	Confident	82.9	Confident	92 Å²	92	116.5 Å²	116.5	64%	0.643	60%	0.597	S	S	*	*	H	α-helix	trans	-82.6	-14.1	178.8	68.2	0	0	0	0	114.3	R48 E49	R48-S52 WeakPolarHBondContact O-CB 3.5Å; R48-S52 PolarHBondContact O-N 2.79Å; R48-S52 PolarHBondContact O-OG 3.1Å; E49-S52 PolarHBondContact O-N 3.4Å; E49-S52 VanDerWaalsContact O-N 3.1Å; E49-S52 PolarHBondContact O-OG 3.03Å
53	T	70.8	Confident	82.4	Confident	120 Å²	120	113.3 Å²	113.3	74%	0.736	60%	0.596	S	S	*	*			trans	-97.6	-5.8	-177.2	-29.1	0	0	0	0	112.6	E49	E49-T53 PolarHBondContact O-N 3.33Å; E49-T53 PolarHBondContact O-OG1 3.36Å
54	V	58.7	Low	81.9	Confident	177 Å²	177	111.5 Å²	111.5	100%	1.073	60%	0.598	S	S	*	*			trans	-103	0	172.5	-177.6	0	0	0	0	108.5

Retrieved 54 of 54 residues in 44.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).