A0A068JD88_HUMAN Loading...

Epidermal growth factor receptor

AlphaFold DB , UniProt , Accession A0A068JD88, Species HUMAN (Homo sapiens, Human), Gene EGFR, Length 52 aa.

						>A0A068JD88_HUMAN|A0A068JD88|EGFR
DMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	D	62	Low	80.5	Confident	147 Å²	147	102.6 Å²	102.6	79%	0.786	48%	0.482	S	S	*	.				0	159.9	0	-61.5	-27.7	0	0	0	111.8	N3 Y4	D1-N3 PolarHBondContact O-N 2.87Å; D1-N3 VanDerWaalsContact O-N 3.14Å; D1-Y4 VanDerWaalsContact O-CB 3.3Å; D1-Y4 WeakPolarHBondContact O-CB 3.32Å; D1-Y4 PolarHBondContact O-N 2.86Å
2	M	70.9	Confident	81.3	Confident	89 Å²	89	94.8 Å²	94.8	44%	0.438	45%	0.445	S	S	.	.	H	α-helix	trans	-52	-34.4	-175.7	-75.8	-66	107.7	0	0	113.3	Y4 L5 E6 L15 I30	M2-Y4 PolarHBondContact O-N 3.18Å; M2-L5 HydrophobicContact CE-CD1 3.59Å; M2-L5 WeakPolarHBondContact O-CB 3.18Å; M2-L5 PolarHBondContact O-N 3.3Å; M2-L5 HydrophobicContact SD-CD1 4.28Å; M2-E6 PolarHBondContact O-N 3.37Å; M2-L15 HydrophobicContact CE-CD1 3.67Å; M2-L15 HydrophobicContact CE-CD2 3.16Å; M2-L15 HydrophobicContact CE-CG 3.97Å; M2-L15 HydrophobicContact SD-CD2 3.71Å; M2-I30 HydrophobicContact CE-CD1 3.64Å
3	N	79.4	Confident	82	Confident	110 Å²	110	98.2 Å²	98.2	59%	0.588	45%	0.451	S	S	*	.	H	α-helix	trans	-55.1	-36.3	175.3	-58	8.3	0	0	0	112.4	D1 L5 E6 D7	D1-N3 PolarHBondContact O-N 2.87Å; D1-N3 VanDerWaalsContact O-N 3.14Å; N3-L5 VanDerWaalsContact C-N 3.34Å; N3-L5 PolarHBondContact O-N 3.04Å; N3-E6 PolarHBondContact O-N 3.22Å; N3-D7 WeakPolarHBondContact O-CB 3.42Å; N3-D7 PolarHBondContact O-N 2.8Å
4	Y	81.2	Confident	82.5	Confident	131 Å²	131	93.6 Å²	93.6	51%	0.514	43%	0.432	S	S	.	.	H	α-helix	trans	-66.7	-36.9	177.6	177.7	-97.8	0	0	0	112.4	D1 M2 R8	D1-Y4 VanDerWaalsContact O-CB 3.3Å; D1-Y4 WeakPolarHBondContact O-CB 3.32Å; D1-Y4 PolarHBondContact O-N 2.86Å; M2-Y4 PolarHBondContact O-N 3.18Å; Y4-R8 HydrophobicContact CE1-CG 4.37Å; Y4-R8 HydrophobicContact CE2-CG 4.47Å; Y4-R8 WeakPolarHBondContact O-CB 3.31Å; Y4-R8 WeakPolarHBondContact O-CG 3.45Å; Y4-R8 PolarHBondContact O-N 3.47Å; Y4-R8 PolarHBondContact OH-NE 3.3Å; Y4-R8 PolarHBondContact OH-NH2 2.87Å
5	L	80.8	Confident	83	Confident	10 Å²	10	92.9 Å²	92.9	5%	0.052	43%	0.432	C	S	.	.	H	α-helix	trans	-72.3	-39.8	177.2	-65.4	-178.6	0	0	0	110.6	M2 N3 R8 R9 L10 H12 I30 F33	M2-L5 HydrophobicContact CE-CD1 3.59Å; M2-L5 WeakPolarHBondContact O-CB 3.18Å; M2-L5 PolarHBondContact O-N 3.3Å; M2-L5 HydrophobicContact SD-CD1 4.28Å; N3-L5 VanDerWaalsContact C-N 3.34Å; N3-L5 PolarHBondContact O-N 3.04Å; L5-R8 CarbonylContact O-C 3.55Å; L5-R8 PolarHBondContact O-N 2.87Å; L5-R9 PolarHBondContact O-N 2.78Å; L5-L10 WeakPolarHBondContact CB-O 3.4Å; L5-L10 HydrophobicContact CD2-CD2 3.87Å; L5-L10 HydrophobicContact CD2-CG 4.44Å; L5-L10 PolarHBondContact O-N 2.91Å; L5-H12 HydrophobicContact CD1-CB 4.11Å; L5-I30 HydrophobicContact CD1-CD1 3.85Å; L5-I30 HydrophobicContact CG-CD1 4.43Å; L5-F33 HydrophobicContact CD2-CE1 3.95Å; L5-F33 HydrophobicContact CD2-CZ 4.41Å
6	E	81.1	Confident	83.4	Confident	141 Å²	141	88.8 Å²	88.8	66%	0.659	42%	0.419	S	S	*	.	H	α-helix	trans	-62.1	-49.2	175.5	-174.4	178.8	-169.8	0	0	112.5	M2 N3 R8 R9	M2-E6 PolarHBondContact O-N 3.37Å; N3-E6 PolarHBondContact O-N 3.22Å; E6-R8 PolarHBondContact O-N 3.14Å; E6-R8 VanDerWaalsContact O-N 3.12Å; E6-R9 WeakPolarHBondContact O-CA 3.03Å; E6-R9 PolarHBondContact O-N 2.84Å
7	D	83.6	Confident	84	Confident	136 Å²	136	88.9 Å²	88.9	73%	0.727	44%	0.438	S	S	*	.	H	α-helix	trans	-57.1	-31.1	176.6	-74.1	-17.8	0	0	0	112.1	N3 R9	N3-D7 WeakPolarHBondContact O-CB 3.42Å; N3-D7 PolarHBondContact O-N 2.8Å; D7-R9 VanDerWaalsContact C-N 3.3Å
8	R	84.1	Confident	84.6	Confident	152 Å²	152	93 Å²	93	57%	0.574	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.1	0.6	179.1	-64.1	-93.4	-103.1	-168.7	-2.1	112.6	Y4 L5 E6 L10 L38	Y4-R8 HydrophobicContact CE1-CG 4.37Å; Y4-R8 HydrophobicContact CE2-CG 4.47Å; Y4-R8 WeakPolarHBondContact O-CB 3.31Å; Y4-R8 WeakPolarHBondContact O-CG 3.45Å; Y4-R8 PolarHBondContact O-N 3.47Å; Y4-R8 PolarHBondContact OH-NE 3.3Å; Y4-R8 PolarHBondContact OH-NH2 2.87Å; L5-R8 CarbonylContact O-C 3.55Å; L5-R8 PolarHBondContact O-N 2.87Å; E6-R8 PolarHBondContact O-N 3.14Å; E6-R8 VanDerWaalsContact O-N 3.12Å; R8-L10 HydrophobicContact CB-CB 4.26Å; R8-L10 PolarHBondContact O-N 2.82Å; R8-L38 WeakPolarHBondContact O-CD1 3.3Å
9	R	86	Confident	85.1	Confident	128 Å²	128	88.6 Å²	88.6	48%	0.483	43%	0.427	S	S	.	.	T	Hydrogen-bonded Turn	trans	50.9	38.4	-172.6	-55.5	-170.7	-171.9	-158.2	3.6	112.3	L5 E6 D7 L39 A41	L5-R9 PolarHBondContact O-N 2.78Å; E6-R9 WeakPolarHBondContact O-CA 3.03Å; E6-R9 PolarHBondContact O-N 2.84Å; D7-R9 VanDerWaalsContact C-N 3.3Å; R9-L39 HydrophobicContact CB-CB 4.23Å; R9-L39 PolarHBondContact O-N 3.14Å; R9-A41 PolarHBondContact NH1-O 3.18Å
10	L	86.6	Confident	85.5	Confident	46 Å²	46	86.5 Å²	86.5	24%	0.241	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	118.6	-176.2	-174.7	66.6	0	0	0	110	L5 R8 F33 A36 L38	L5-L10 WeakPolarHBondContact CB-O 3.4Å; L5-L10 HydrophobicContact CD2-CD2 3.87Å; L5-L10 HydrophobicContact CD2-CG 4.44Å; L5-L10 PolarHBondContact O-N 2.91Å; R8-L10 HydrophobicContact CB-CB 4.26Å; R8-L10 PolarHBondContact O-N 2.82Å; L10-F33 HydrophobicContact CD2-CD1 3.96Å; L10-F33 HydrophobicContact CD2-CE1 3.77Å; L10-A36 HydrophobicContact CD1-CB 4.18Å; L10-L38 HydrophobicContact CD1-CB 4.48Å; L10-L38 HydrophobicContact CD1-CD1 4.31Å
11	V	89.2	Confident	86	Confident	39 Å²	39	86.9 Å²	86.9	24%	0.236	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	114.8	174.6	-173.2	0	0	0	0	108.3	R13 A36 K37 L39 Y46	V11-R13 HydrophobicContact CB-CG 4.43Å; V11-R13 HydrophobicContact CG1-CG 3.77Å; V11-A36 CarbonylContact O-C 3.5Å; V11-A36 WeakPolarHBondContact O-CA 3.42Å; V11-K37 PolarHBondContact N-O 3.43Å; V11-K37 PolarHBondContact O-N 3.12Å; V11-L39 HydrophobicContact CG2-CD1 3.83Å; V11-L39 HydrophobicContact CG2-CD2 4.21Å; V11-L39 HydrophobicContact CG2-CG 4Å; V11-Y46 HydrophobicContact CG1-CD1 4.03Å; V11-Y46 HydrophobicContact CG1-CE1 4.27Å; V11-Y46 HydrophobicContact CG1-CG 4.46Å; V11-Y46 HydrophobicContact CG2-CD1 4.47Å; V11-Y46 HydrophobicContact CG2-CG 4.14Å
12	H	90.6	Very high	87.5	Confident	8 Å²	8	84.7 Å²	84.7	4%	0.037	42%	0.415	C	S	.	.			trans	-68.3	-34.3	-177.5	-173.3	-69.8	0	0	0	113.1	L5 D14 L15 I30 T31 D32 F33 L35 A36	L5-H12 HydrophobicContact CD1-CB 4.11Å; H12-D14 PolarHBondContact CE1-O 3.26Å; H12-D14 VanDerWaalsContact CE1-O 3.27Å; H12-D14 PolarHBondContact ND1-N 2.98Å; H12-D14 PolarHBondContact ND1-O 2.97Å; H12-D14 PolarHBondContact O-N 3.28Å; H12-L15 PolarHBondContact ND1-N 3.11Å; H12-I30 WeakPolarHBondContact CD2-CG2 3.48Å; H12-T31 PolarHBondContact NE2-O 2.79Å; H12-D32 PolarHBondContact CE1-O 3.39Å; H12-D32 PolarHBondContact NE2-O 3.38Å; H12-F33 AromaticContact CD2-CD1 3.61Å; H12-F33 AromaticContact CD2-CE1 3.53Å; H12-F33 AromaticContact CD2-CZ 3.99Å; H12-L35 CarbonylContact O-C 3.53Å; H12-A36 WeakPolarHBondContact O-CA 3.41Å; H12-A36 PolarHBondContact O-N 3.23Å
13	R	90.4	Very high	88.5	Confident	139 Å²	139	88 Å²	88	53%	0.525	43%	0.427	S	S	.	.	S	Bend	trans	62.6	-11.7	-180	-64.2	-177.9	35.8	-175.3	-8.4	117.4	V11 L35 Y46	V11-R13 HydrophobicContact CB-CG 4.43Å; V11-R13 HydrophobicContact CG1-CG 3.77Å; R13-L35 HydrophobicContact CB-CB 4.32Å; R13-L35 WeakPolarHBondContact CB-O 3.27Å; R13-L35 WeakPolarHBondContact CD-O 3.45Å; R13-L35 PolarHBondContact NE-O 3.02Å; R13-Y46 WeakPolarHBondContact CD-OH 3.43Å
14	D	89.3	Confident	89.2	Confident	34 Å²	34	85.9 Å²	85.9	18%	0.182	42%	0.418	C	S	.	.			trans	-138.3	50.2	174.1	-171.2	30	0	0	0	111.5	H12 A16 R18 N19 L35	H12-D14 PolarHBondContact CE1-O 3.26Å; H12-D14 VanDerWaalsContact CE1-O 3.27Å; H12-D14 PolarHBondContact ND1-N 2.98Å; H12-D14 PolarHBondContact ND1-O 2.97Å; H12-D14 PolarHBondContact O-N 3.28Å; D14-A16 PolarHBondContact O-N 2.85Å; D14-R18 IonicContact OD1-CZ 3.61Å; D14-R18 IonicContact OD1-NH2 2.65Å; D14-R18 PolarHBondContact OD1-NH2 2.79Å; D14-R18 IonicContact OD2-CZ 3.62Å; D14-R18 IonicContact OD2-NE 3.95Å; D14-R18 IonicContact OD2-NH2 2.67Å; D14-R18 PolarHBondContact OD2-NH2 3.02Å; D14-N19 PolarHBondContact O-ND2 3.21Å; D14-N19 PolarHBondContact OD2-ND2 2.84Å; D14-L35 HydrophobicContact CB-CD1 4.01Å
15	L	89.4	Confident	89.6	Confident	83 Å²	83	85 Å²	85	44%	0.435	43%	0.428	S	S	.	.			trans	-78	94.9	176.4	-171.2	80.1	0	0	0	109.9	M2 H12 V20 I30	M2-L15 HydrophobicContact CE-CD1 3.67Å; M2-L15 HydrophobicContact CE-CD2 3.16Å; M2-L15 HydrophobicContact CE-CG 3.97Å; M2-L15 HydrophobicContact SD-CD2 3.71Å; H12-L15 PolarHBondContact ND1-N 3.11Å; L15-V20 HydrophobicContact CD1-CG2 4.37Å; L15-I30 HydrophobicContact CD1-CD1 4.03Å; L15-I30 HydrophobicContact CD1-CG1 4.21Å; L15-I30 HydrophobicContact CD1-CG2 3.88Å
16	A	90.3	Very high	90.1	Very high	27 Å²	27	92.9 Å²	92.9	22%	0.223	47%	0.465	C	S	.	.			trans	-124.5	160.8	173	0	0	0	0	0	110.6	D14 R18 N19	D14-A16 PolarHBondContact O-N 2.85Å; A16-R18 HydrophobicContact CB-CG 4Å; A16-R18 VanDerWaalsContact CB-NH1 3.29Å; A16-R18 PolarHBondContact O-N 3.23Å; A16-R18 VanDerWaalsContact O-N 3.1Å; A16-N19 WeakPolarHBondContact O-CA 3.36Å; A16-N19 WeakPolarHBondContact O-CB 3.46Å; A16-N19 PolarHBondContact O-N 2.81Å
17	A	92.6	Very high	90.5	Very high	91 Å²	91	90 Å²	90	75%	0.752	45%	0.452	S	S	*	.	G	3₁₀ helix	trans	-53.7	-34.1	179.6	0	0	0	0	0	113.1	N19 V20	A17-N19 PolarHBondContact O-N 3.1Å; A17-V20 PolarHBondContact O-N 2.85Å; A17-V20 VanDerWaalsContact O-N 3.11Å
18	R	95.2	Very high	91	Very high	163 Å²	163	86.8 Å²	86.8	62%	0.615	44%	0.436	S	S	*	.	G	3₁₀ helix	trans	-60.1	-26.4	174.2	66.2	173.7	-174.2	-81.3	-1.4	113.9	D14 A16	D14-R18 IonicContact OD1-CZ 3.61Å; D14-R18 IonicContact OD1-NH2 2.65Å; D14-R18 PolarHBondContact OD1-NH2 2.79Å; D14-R18 IonicContact OD2-CZ 3.62Å; D14-R18 IonicContact OD2-NE 3.95Å; D14-R18 IonicContact OD2-NH2 2.67Å; D14-R18 PolarHBondContact OD2-NH2 3.02Å; A16-R18 HydrophobicContact CB-CG 4Å; A16-R18 VanDerWaalsContact CB-NH1 3.29Å; A16-R18 PolarHBondContact O-N 3.23Å; A16-R18 VanDerWaalsContact O-N 3.1Å
19	N	93.5	Very high	91.4	Very high	9 Å²	9	85.3 Å²	85.3	5%	0.048	43%	0.434	C	S	.	.	G	3₁₀ helix	trans	-99	14.2	-179.2	-66.3	-17	0	0	0	112	D14 A16 A17 T31 D32	D14-N19 PolarHBondContact O-ND2 3.21Å; D14-N19 PolarHBondContact OD2-ND2 2.84Å; A16-N19 WeakPolarHBondContact O-CA 3.36Å; A16-N19 WeakPolarHBondContact O-CB 3.46Å; A16-N19 PolarHBondContact O-N 2.81Å; A17-N19 PolarHBondContact O-N 3.1Å; N19-T31 HydrophobicContact CB-CG2 4.4Å; N19-T31 WeakPolarHBondContact O-CG2 3.35Å; N19-T31 PolarHBondContact O-N 3.03Å; N19-D32 HydrophobicContact CB-CB 4.49Å
20	V	93.7	Very high	91.7	Very high	47 Å²	47	81.3 Å²	81.3	29%	0.285	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	113.7	174.3	-178.2	0	0	0	0	109.2	L15 A17 V28	L15-V20 HydrophobicContact CD1-CG2 4.37Å; A17-V20 PolarHBondContact O-N 2.85Å; A17-V20 VanDerWaalsContact O-N 3.11Å; V20-V28 HydrophobicContact CG1-CB 4.01Å; V20-V28 HydrophobicContact CG1-CG1 4.42Å
21	L	95.3	Very high	92	Very high	95 Å²	95	81.7 Å²	81.7	50%	0.497	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	121.2	177.3	-55.5	180	0	0	0	109.8	V28 K29 T31	L21-V28 CarbonylContact O-C 3.48Å; L21-V28 VanDerWaalsContact O-CA 3.31Å; L21-V28 WeakPolarHBondContact O-CA 3.41Å; L21-K29 HydrophobicContact CB-CB 4.43Å; L21-K29 PolarHBondContact N-O 2.99Å; L21-K29 PolarHBondContact O-N 2.96Å; L21-T31 HydrophobicContact CD1-CG2 4.14Å; L21-T31 HydrophobicContact CD2-CG2 4.15Å; L21-T31 HydrophobicContact CG-CG2 3.85Å
22	V	95.1	Very high	92.1	Very high	101 Å²	101	83.7 Å²	83.7	61%	0.612	44%	0.436	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.7	117.4	177.1	-174.7	0	0	0	0	109.2	T24 V28	V22-T24 VanDerWaalsContact CG1-O 3.32Å; V22-T24 WeakPolarHBondContact CG1-O 3.42Å; V22-V28 HydrophobicContact CG1-CG1 4.43Å; V22-V28 HydrophobicContact CG2-CG1 4.09Å
23	K	90.9	Very high	92.1	Very high	158 Å²	158	87.6 Å²	87.6	69%	0.687	45%	0.453	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90	-43.3	171.6	-173.4	179.1	178.9	-177.1	0	110.9	H27	K23-H27 HydrophobicContact CB-CB 4.4Å; K23-H27 PolarHBondContact N-O 3.43Å
24	T	94.7	Very high	92.1	Very high	65 Å²	65	84.1 Å²	84.1	40%	0.399	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.2	165.9	171.3	65.6	0	0	0	0	108.4	V22 Q26 H27	V22-T24 VanDerWaalsContact CG1-O 3.32Å; V22-T24 WeakPolarHBondContact CG1-O 3.42Å; T24-Q26 PolarHBondContact O-N 2.96Å; T24-H27 PolarHBondContact N-O 2.83Å; T24-H27 CarbonylContact O-C 3.42Å; T24-H27 PolarHBondContact O-N 3.46Å; T24-H27 WeakPolarHBondContact OG1-CB 3.5Å; T24-H27 PolarHBondContact OG1-N 3.13Å
25	P	89.1	Confident	92.1	Very high	112 Å²	112	86.8 Å²	86.8	73%	0.727	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.8	-26	-178.7	-26.7	36	0	0	0	114.4
26	Q	91	Very high	92.1	Very high	176 Å²	176	84.3 Å²	84.3	82%	0.822	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.4	1.8	175.8	-65.6	74.2	37.2	0	0	113.6	T24	T24-Q26 PolarHBondContact O-N 2.96Å
27	H	90.8	Very high	92	Very high	82 Å²	82	86.7 Å²	86.7	38%	0.38	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	103.7	-178.1	-165.9	148.3	0	0	0	110.6	K23 T24	K23-H27 HydrophobicContact CB-CB 4.4Å; K23-H27 PolarHBondContact N-O 3.43Å; T24-H27 PolarHBondContact N-O 2.83Å; T24-H27 CarbonylContact O-C 3.42Å; T24-H27 PolarHBondContact O-N 3.46Å; T24-H27 WeakPolarHBondContact OG1-CB 3.5Å; T24-H27 PolarHBondContact OG1-N 3.13Å
28	V	93	Very high	91.8	Very high	67 Å²	67	88 Å²	88	41%	0.406	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	152.9	174.7	-56.8	0	0	0	0	111	V20 L21 V22	V20-V28 HydrophobicContact CG1-CB 4.01Å; V20-V28 HydrophobicContact CG1-CG1 4.42Å; L21-V28 CarbonylContact O-C 3.48Å; L21-V28 VanDerWaalsContact O-CA 3.31Å; L21-V28 WeakPolarHBondContact O-CA 3.41Å; V22-V28 HydrophobicContact CG1-CG1 4.43Å; V22-V28 HydrophobicContact CG2-CG1 4.09Å
29	K	92	Very high	91.4	Very high	122 Å²	122	81.4 Å²	81.4	53%	0.53	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	136.1	173.4	-65.7	-173.9	176.8	-170.9	0	109.6	L21	L21-K29 HydrophobicContact CB-CB 4.43Å; L21-K29 PolarHBondContact N-O 2.99Å; L21-K29 PolarHBondContact O-N 2.96Å
30	I	92.9	Very high	90.8	Very high	44 Å²	44	82.6 Å²	82.6	23%	0.226	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	134.4	172.8	-58	173	0	0	0	107.8	M2 L5 H12 L15 F33	M2-I30 HydrophobicContact CE-CD1 3.64Å; L5-I30 HydrophobicContact CD1-CD1 3.85Å; L5-I30 HydrophobicContact CG-CD1 4.43Å; H12-I30 WeakPolarHBondContact CD2-CG2 3.48Å; L15-I30 HydrophobicContact CD1-CD1 4.03Å; L15-I30 HydrophobicContact CD1-CG1 4.21Å; L15-I30 HydrophobicContact CD1-CG2 3.88Å; I30-F33 HydrophobicContact CB-CZ 4.3Å; I30-F33 HydrophobicContact CG2-CE2 4.43Å; I30-F33 HydrophobicContact CG2-CZ 3.99Å; I30-F33 WeakPolarHBondContact O-CE2 3.18Å
31	T	92.3	Very high	89.9	Confident	53 Å²	53	84.6 Å²	84.6	33%	0.325	48%	0.477	S	S	.	.			trans	-125.1	178.1	179.7	-168.7	0	0	0	0	110.8	H12 N19 L21	H12-T31 PolarHBondContact NE2-O 2.79Å; N19-T31 HydrophobicContact CB-CG2 4.4Å; N19-T31 WeakPolarHBondContact O-CG2 3.35Å; N19-T31 PolarHBondContact O-N 3.03Å; L21-T31 HydrophobicContact CD1-CG2 4.14Å; L21-T31 HydrophobicContact CD2-CG2 4.15Å; L21-T31 HydrophobicContact CG-CG2 3.85Å
32	D	91.2	Very high	88.9	Confident	82 Å²	82	89.1 Å²	89.1	44%	0.439	50%	0.496	S	S	.	.			trans	56.4	73.1	176.4	-164.9	5.1	0	0	0	114.4	H12 N19 G34	H12-D32 PolarHBondContact CE1-O 3.39Å; H12-D32 PolarHBondContact NE2-O 3.38Å; N19-D32 HydrophobicContact CB-CB 4.49Å; D32-G34 PolarHBondContact O-N 2.67Å; D32-G34 PolarHBondContact OD1-N 3.39Å
33	F	91.3	Very high	87.8	Confident	89 Å²	89	88.2 Å²	88.2	39%	0.39	49%	0.485	S	S	.	.			trans	-88.2	18.1	177.2	-68	-94.9	0	0	0	112.7	L5 L10 H12 I30 L35 A36	L5-F33 HydrophobicContact CD2-CE1 3.95Å; L5-F33 HydrophobicContact CD2-CZ 4.41Å; L10-F33 HydrophobicContact CD2-CD1 3.96Å; L10-F33 HydrophobicContact CD2-CE1 3.77Å; H12-F33 AromaticContact CD2-CD1 3.61Å; H12-F33 AromaticContact CD2-CE1 3.53Å; H12-F33 AromaticContact CD2-CZ 3.99Å; I30-F33 HydrophobicContact CB-CZ 4.3Å; I30-F33 HydrophobicContact CG2-CE2 4.43Å; I30-F33 HydrophobicContact CG2-CZ 3.99Å; I30-F33 WeakPolarHBondContact O-CE2 3.18Å; F33-L35 PolarHBondContact O-N 3.27Å; F33-L35 VanDerWaalsContact O-N 3.13Å; F33-A36 HydrophobicContact CB-CB 3.85Å; F33-A36 HydrophobicContact CD1-CB 3.84Å; F33-A36 HydrophobicContact CG-CB 4.35Å; F33-A36 VanDerWaalsContact O-CB 3.27Å; F33-A36 WeakPolarHBondContact O-CB 3.15Å; F33-A36 PolarHBondContact O-N 2.65Å
34	G	90.3	Very high	86.8	Confident	67 Å²	67	90 Å²	90	69%	0.691	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-24	-175.7	0	0	0	0	0	114.1	D32	D32-G34 PolarHBondContact O-N 2.67Å; D32-G34 PolarHBondContact OD1-N 3.39Å
35	L	88.9	Confident	85.8	Confident	90 Å²	90	93.6 Å²	93.6	47%	0.471	51%	0.505	S	S	.	.	T	Hydrogen-bonded Turn	trans	-105.8	4.3	175.6	-62.1	177.9	0	0	0	113.2	H12 R13 D14 F33	H12-L35 CarbonylContact O-C 3.53Å; R13-L35 HydrophobicContact CB-CB 4.32Å; R13-L35 WeakPolarHBondContact CB-O 3.27Å; R13-L35 WeakPolarHBondContact CD-O 3.45Å; R13-L35 PolarHBondContact NE-O 3.02Å; D14-L35 HydrophobicContact CB-CD1 4.01Å; F33-L35 PolarHBondContact O-N 3.27Å; F33-L35 VanDerWaalsContact O-N 3.13Å
36	A	90.5	Very high	85.3	Confident	31 Å²	31	91.7 Å²	91.7	26%	0.256	48%	0.484	S	S	.	.			trans	-70.8	145.3	-175.9	0	0	0	0	0	111.6	L10 V11 H12 F33	L10-A36 HydrophobicContact CD1-CB 4.18Å; V11-A36 CarbonylContact O-C 3.5Å; V11-A36 WeakPolarHBondContact O-CA 3.42Å; H12-A36 WeakPolarHBondContact O-CA 3.41Å; H12-A36 PolarHBondContact O-N 3.23Å; F33-A36 HydrophobicContact CB-CB 3.85Å; F33-A36 HydrophobicContact CD1-CB 3.84Å; F33-A36 HydrophobicContact CG-CB 4.35Å; F33-A36 VanDerWaalsContact O-CB 3.27Å; F33-A36 WeakPolarHBondContact O-CB 3.15Å; F33-A36 PolarHBondContact O-N 2.65Å
37	K	88.8	Confident	84.5	Confident	77 Å²	77	90.2 Å²	90.2	34%	0.335	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	128.3	176.2	-170.8	179.5	175.8	-166.8	0	109.9	V11 E43 Y46	V11-K37 PolarHBondContact N-O 3.43Å; V11-K37 PolarHBondContact O-N 3.12Å; K37-E43 IonicContact NZ-OE1 3.25Å; K37-E43 PolarHBondContact NZ-OE1 2.92Å; K37-Y46 HydrophobicContact CD-CD2 4.28Å; K37-Y46 HydrophobicContact CD-CE2 3.92Å
38	L	88.1	Confident	83.7	Confident	119 Å²	119	89.7 Å²	89.7	62%	0.623	49%	0.486	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.6	129.4	167.8	-169.7	72.7	0	0	0	108.5	R8 L10	R8-L38 WeakPolarHBondContact O-CD1 3.3Å; L10-L38 HydrophobicContact CD1-CB 4.48Å; L10-L38 HydrophobicContact CD1-CD1 4.31Å
39	L	85.9	Confident	82.7	Confident	23 Å²	23	95.6 Å²	95.6	12%	0.12	51%	0.51	C	S	.	.	P	Polyproline II helix	trans	-84.8	130.7	175	-54.6	175.4	0	0	0	109.7	R9 V11 E43 Y46	R9-L39 HydrophobicContact CB-CB 4.23Å; R9-L39 PolarHBondContact O-N 3.14Å; V11-L39 HydrophobicContact CG2-CD1 3.83Å; V11-L39 HydrophobicContact CG2-CD2 4.21Å; V11-L39 HydrophobicContact CG2-CG 4Å; L39-E43 WeakPolarHBondContact CA-OE2 3.42Å; L39-E43 HydrophobicContact CB-CB 4.15Å; L39-Y46 HydrophobicContact CD2-CD2 3.84Å; L39-Y46 HydrophobicContact CD2-CG 4.23Å
40	G	81.2	Confident	80.9	Confident	35 Å²	35	93.3 Å²	93.3	36%	0.361	52%	0.52	S	S	.	.	P	Polyproline II helix	trans	-64.1	164.9	175.3	0	0	0	0	0	112.5	E42 E43	G40-E42 PolarHBondContact O-N 3.21Å; G40-E42 VanDerWaalsContact O-N 3.14Å; G40-E43 PolarHBondContact N-OE2 3.39Å; G40-E43 PolarHBondContact O-N 3.06Å
41	A	74.1	Confident	79.4	Confident	88 Å²	88	94.9 Å²	94.9	73%	0.727	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.3	-30	179.8	0	0	0	0	0	113.1	R9	R9-A41 PolarHBondContact NH1-O 3.18Å
42	E	75.5	Confident	77	Confident	191 Å²	191	106 Å²	106	89%	0.893	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.6	-15.4	179.4	-54.7	-158.8	148.9	0	0	113.7	G40 K44	G40-E42 PolarHBondContact O-N 3.21Å; G40-E42 VanDerWaalsContact O-N 3.14Å; E42-K44 PolarHBondContact O-N 3.25Å
43	E	72.4	Confident	76.2	Confident	81 Å²	81	107.3 Å²	107.3	38%	0.379	60%	0.6	S	S	.	*			trans	-85.3	91.8	176.1	-69.4	179.1	138.5	0	0	108.9	K37 L39 G40	K37-E43 IonicContact NZ-OE1 3.25Å; K37-E43 PolarHBondContact NZ-OE1 2.92Å; L39-E43 WeakPolarHBondContact CA-OE2 3.42Å; L39-E43 HydrophobicContact CB-CB 4.15Å; G40-E43 PolarHBondContact N-OE2 3.39Å; G40-E43 PolarHBondContact O-N 3.06Å
44	K	69.2	Low	75.5	Confident	195 Å²	195	108.2 Å²	108.2	85%	0.848	61%	0.611	S	S	*	*			trans	-73	-29.8	179.2	-69.3	-173.6	179.6	179.3	0	113.4	E42	E42-K44 PolarHBondContact O-N 3.25Å
45	E	73.6	Confident	74.6	Confident	141 Å²	141	110.5 Å²	110.5	66%	0.659	61%	0.606	S	S	*	*	S	Bend	trans	-137.2	143	-178.3	-71	-177.2	-174.5	0	0	110	H47	E45-H47 IonicContact OE2-CE1 3.68Å; E45-H47 IonicContact OE2-NE2 3.85Å
46	Y	77.8	Confident	73.8	Confident	73 Å²	73	111.7 Å²	111.7	29%	0.286	61%	0.614	S	S	.	*			trans	-94.8	116.9	171.1	177.1	-103.8	0	0	0	109.6	V11 R13 K37 L39 A48	V11-Y46 HydrophobicContact CG1-CD1 4.03Å; V11-Y46 HydrophobicContact CG1-CE1 4.27Å; V11-Y46 HydrophobicContact CG1-CG 4.46Å; V11-Y46 HydrophobicContact CG2-CD1 4.47Å; V11-Y46 HydrophobicContact CG2-CG 4.14Å; R13-Y46 WeakPolarHBondContact CD-OH 3.43Å; K37-Y46 HydrophobicContact CD-CD2 4.28Å; K37-Y46 HydrophobicContact CD-CE2 3.92Å; L39-Y46 HydrophobicContact CD2-CD2 3.84Å; L39-Y46 HydrophobicContact CD2-CG 4.23Å; Y46-A48 HydrophobicContact CE1-CB 3.8Å
47	H	74.6	Confident	72.8	Confident	145 Å²	145	116.8 Å²	116.8	67%	0.671	64%	0.636	S	S	*	*			trans	-97.7	113.7	168.3	-60.8	-75.4	0	0	0	109	E45 E49	E45-H47 IonicContact OE2-CE1 3.68Å; E45-H47 IonicContact OE2-NE2 3.85Å; H47-E49 PolarHBondContact O-N 3.08Å
48	A	74.4	Confident	71.7	Confident	70 Å²	70	119.4 Å²	119.4	58%	0.579	66%	0.656	S	S	*	*			trans	-69.5	124.3	168.6	0	0	0	0	0	108.4	Y46 G50	Y46-A48 HydrophobicContact CE1-CB 3.8Å; A48-G50 PolarHBondContact O-N 3.41Å; A48-G50 VanDerWaalsContact O-N 3.08Å
49	E	71.3	Confident	70.5	Confident	192 Å²	192	119.4 Å²	119.4	90%	0.897	66%	0.659	S	S	*	*			trans	-64.2	112.5	165	-66.7	-169.6	174.5	0	0	107.3	H47 G51	H47-E49 PolarHBondContact O-N 3.08Å; E49-G51 PolarHBondContact O-N 3.45Å
50	G	55.1	Low	69.3	Low	73 Å²	73	126.8 Å²	126.8	75%	0.753	70%	0.7	S	S	*	*			trans	-55.3	123.5	179.7	0	0	0	0	0	110	A48 K52	A48-G50 PolarHBondContact O-N 3.41Å; A48-G50 VanDerWaalsContact O-N 3.08Å; G50-K52 PolarHBondContact O-N 3.2Å
51	G	60.9	Low	68.3	Low	78 Å²	78	134.5 Å²	134.5	80%	0.804	73%	0.729	S	S	*	*			trans	-59.1	134.1	171.2	0	0	0	0	0	109.6	E49	E49-G51 PolarHBondContact O-N 3.45Å
52	K	41.2	Very low	67.8	Low	287 Å²	287	138.7 Å²	138.7	100%	1.248	73%	0.729	S	S	*	*			trans	-56	0	171.8	-69.1	-174.8	178.2	-179.5	0	111.9	G50	G50-K52 PolarHBondContact O-N 3.2Å

Retrieved 52 of 52 residues in 119.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).