A0A075B5I0_MOUSE Loading...

Predicted gene, 54637

AlphaFold DB , UniProt , Accession A0A075B5I0, Species MOUSE (Mus musculus, Mouse), Gene Gm54637, Length 98 aa.

						>A0A075B5I0_MOUSE|A0A075B5I0|Gm54637
SLTIIVSSVLRCQASELHVGCVGGCVYSKCGLAFELLIVGNTTIFRMNSSNPFQSLLQTLLHPLNFIVIKIVARSLAGQLHLSPRYYQLWSRLLKLDL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	64.7	Low	67.9	Low	117 Å²	117	83.5 Å²	83.5	82%	0.818	48%	0.48	S	S	*	.				0	136.9	0	54.7	0	0	0	0	108	M47 N48	S1-M47 WeakPolarHBondContact CA-O 3.49Å; S1-N48 WeakPolarHBondContact CA-OD1 3.45Å; S1-N48 WeakPolarHBondContact CB-OD1 2.99Å
2	L	65.9	Low	68.1	Low	72 Å²	72	81.7 Å²	81.7	38%	0.377	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	130.5	174.7	-175.5	77.4	0	0	0	108.3	I4 M47 P52	L2-I4 HydrophobicContact CD2-CD1 3.84Å; L2-I4 HydrophobicContact CD2-CG1 3.6Å; L2-I4 HydrophobicContact CG-CG1 4.04Å; L2-M47 PolarHBondContact N-O 3.41Å; L2-M47 PolarHBondContact O-N 2.99Å; L2-P52 HydrophobicContact CD2-CB 3.54Å
3	T	65.5	Low	68.3	Low	71 Å²	71	81.4 Å²	81.4	44%	0.436	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	120.8	169.9	-53.1	0	0	0	0	108.2	I44 F45	T3-I44 HydrophobicContact CG2-CG2 3.78Å; T3-F45 CarbonylContact C-O 3.53Å; T3-F45 WeakPolarHBondContact CA-O 3.31Å
4	I	65.2	Low	68.4	Low	22 Å²	22	76.9 Å²	76.9	11%	0.113	44%	0.443	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.7	129.7	177.1	-57.2	161.3	0	0	0	107.4	L2 V6 F45 M47 L56	L2-I4 HydrophobicContact CD2-CD1 3.84Å; L2-I4 HydrophobicContact CD2-CG1 3.6Å; L2-I4 HydrophobicContact CG-CG1 4.04Å; I4-V6 HydrophobicContact CG2-CG2 3.93Å; I4-F45 HydrophobicContact CB-CD2 4.48Å; I4-F45 PolarHBondContact N-O 3.47Å; I4-F45 PolarHBondContact O-N 3.47Å; I4-M47 HydrophobicContact CD1-SD 3.84Å; I4-L56 HydrophobicContact CD1-CB 4.39Å; I4-L56 HydrophobicContact CD1-CD1 3.55Å; I4-L56 HydrophobicContact CD1-CG 3.92Å; I4-L56 HydrophobicContact CG1-CD1 4.04Å; I4-L56 HydrophobicContact CG2-CD1 4.15Å
5	I	73.3	Confident	68.3	Low	111 Å²	111	74.9 Å²	74.9	57%	0.569	44%	0.436	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.3	118.8	175.8	-55.3	176.1	0	0	0	106.5	T42 I44	I5-T42 HydrophobicContact CG2-CG2 3.71Å; I5-I44 HydrophobicContact CG1-CG1 4.38Å; I5-I44 HydrophobicContact CG1-CG2 4.42Å; I5-I44 HydrophobicContact CG2-CG1 4.41Å
6	V	71.2	Confident	68	Low	60 Å²	60	75.6 Å²	75.6	36%	0.364	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	120.8	175.5	-177	0	0	0	0	107.9	I4 T42 T43 F45	I4-V6 HydrophobicContact CG2-CG2 3.93Å; V6-T42 CarbonylContact O-C 3.54Å; V6-T42 WeakPolarHBondContact O-CA 3.49Å; V6-T43 PolarHBondContact N-O 3.39Å; V6-T43 PolarHBondContact O-N 3.47Å; V6-F45 HydrophobicContact CB-CE2 4.05Å; V6-F45 HydrophobicContact CG2-CD2 4.2Å; V6-F45 HydrophobicContact CG2-CE2 3.73Å
7	S	72.5	Confident	67.5	Low	86 Å²	86	75.9 Å²	75.9	60%	0.601	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.2	139.2	174.8	-58	0	0	0	0	109.3	N41	S7-N41 CarbonylContact C-O 3.59Å; S7-N41 VanDerWaalsContact CA-O 3.32Å; S7-N41 WeakPolarHBondContact CA-O 3.4Å
8	S	75.5	Confident	66.9	Low	57 Å²	57	79.9 Å²	79.9	40%	0.399	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	144.8	173.6	64	0	0	0	0	111	G40 N41	S8-G40 CarbonylContact O-C 3.59Å; S8-G40 WeakPolarHBondContact O-CA 3.49Å; S8-N41 PolarHBondContact N-O 3.01Å; S8-N41 PolarHBondContact O-N 3.25Å
9	V	65.4	Low	66.2	Low	98 Å²	98	81.2 Å²	81.2	59%	0.594	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.9	115.5	172.6	177.6	0	0	0	0	108.4	C12 I38	V9-C12 HydrophobicContact CG1-CB 4.38Å; V9-I38 HydrophobicContact CG1-CG2 3.87Å; V9-I38 HydrophobicContact CG2-CG2 4.13Å
10	L	66.6	Low	65.5	Low	109 Å²	109	80.3 Å²	80.3	57%	0.571	47%	0.466	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.5	-37.1	178.2	-62	-177.7	0	0	0	112.2	V39 N41	L10-V39 WeakPolarHBondContact CA-O 3.36Å; L10-V39 HydrophobicContact CB-CG1 4.43Å; L10-V39 WeakPolarHBondContact CB-O 3.23Å; L10-V39 HydrophobicContact CD1-CG1 4.5Å; L10-V39 PolarHBondContact N-O 3.36Å; L10-N41 HydrophobicContact CD1-CB 3.86Å; L10-N41 HydrophobicContact CD2-CB 4.11Å; L10-N41 HydrophobicContact CG-CB 3.9Å
11	R	61.6	Low	64.8	Low	115 Å²	115	81.7 Å²	81.7	43%	0.434	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.9	137.5	-179.8	-174.9	176.8	176.7	171.1	-0.4	109.7	I38 V39	R11-I38 CarbonylContact O-C 3.53Å; R11-I38 WeakPolarHBondContact O-CA 3.46Å; R11-V39 HydrophobicContact CB-CB 4.06Å; R11-V39 HydrophobicContact CB-CG2 4.26Å; R11-V39 PolarHBondContact N-O 2.73Å; R11-V39 VanDerWaalsContact N-O 3.09Å; R11-V39 PolarHBondContact O-N 2.94Å
12	C	69.3	Low	64	Low	62 Å²	62	83.6 Å²	83.6	42%	0.419	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	127	166.3	-173.7	0	0	0	0	107.2	V9 L37	V9-C12 HydrophobicContact CG1-CB 4.38Å; C12-L37 CarbonylContact C-O 3.45Å; C12-L37 WeakPolarHBondContact CA-O 3.11Å
13	Q	71.4	Confident	63.3	Low	78 Å²	78	84.3 Å²	84.3	36%	0.364	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	124.5	175.4	-179.5	171.1	-16.6	0	0	108.1	L36 L37	Q13-L36 CarbonylContact O-C 3.51Å; Q13-L36 WeakPolarHBondContact O-CA 3.28Å; Q13-L37 HydrophobicContact CB-CB 4.37Å; Q13-L37 PolarHBondContact N-O 2.75Å; Q13-L37 PolarHBondContact O-N 2.88Å
14	A	69.9	Low	62.2	Low	18 Å²	18	83 Å²	83	15%	0.149	51%	0.511	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	135	172.5	0	0	0	0	0	109.8	E35 L36 Y86	A14-E35 CarbonylContact C-O 3.59Å; A14-E35 VanDerWaalsContact CA-O 3.25Å; A14-E35 WeakPolarHBondContact CA-O 3.5Å; A14-L36 HydrophobicContact CB-CD1 3.62Å; A14-Y86 VanDerWaalsContact CB-OH 3.29Å; A14-Y86 WeakPolarHBondContact CB-OH 3.41Å; A14-Y86 PolarHBondContact N-OH 3.35Å; A14-Y86 PolarHBondContact O-OH 3.29Å
15	S	66.9	Low	61.2	Low	48 Å²	48	87.9 Å²	87.9	34%	0.336	55%	0.546	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	135.3	170.9	42.7	0	0	0	0	110.6	L17 E35	S15-L17 PolarHBondContact O-N 3.42Å; S15-E35 PolarHBondContact N-O 2.69Å; S15-E35 PolarHBondContact O-N 3.33Å
16	E	63.5	Low	59.9	Low	86 Å²	86	88.5 Å²	88.5	40%	0.402	56%	0.555	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-76.9	108.4	167.7	-74.6	-179.5	178.5	0	0	108	H18 F34	E16-H18 PolarHBondContact O-N 3.16Å; E16-F34 HydrophobicContact CG-CD1 3.87Å; E16-F34 HydrophobicContact CG-CE1 3.28Å; E16-F34 HydrophobicContact CG-CZ 3.74Å; E16-F34 WeakPolarHBondContact OE1-CE1 3.37Å; E16-F34 WeakPolarHBondContact OE1-CZ 3.25Å
17	L	58.5	Low	58.7	Low	80 Å²	80	96.8 Å²	96.8	42%	0.419	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-78.8	111	168.6	-76.3	167.9	0	0	0	108.2	S15 V19 A33 E35	S15-L17 PolarHBondContact O-N 3.42Å; L17-V19 PolarHBondContact O-N 2.83Å; L17-A33 WeakPolarHBondContact CA-O 3.33Å; L17-A33 HydrophobicContact CB-CB 3.98Å; L17-A33 WeakPolarHBondContact CB-O 3.49Å; L17-A33 HydrophobicContact CD1-CB 4.48Å; L17-A33 PolarHBondContact N-O 2.83Å; L17-A33 PolarHBondContact O-N 3.39Å; L17-A33 VanDerWaalsContact O-N 3.16Å; L17-E35 HydrophobicContact CD1-CB 3.81Å; L17-E35 HydrophobicContact CD1-CG 4.43Å; L17-E35 HydrophobicContact CG-CB 4.23Å
18	H	57.6	Low	57.5	Low	148 Å²	148	96 Å²	96	69%	0.685	58%	0.575	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-75.5	101.7	166.6	-77.4	-90.2	0	0	0	108.7	E16 G20	E16-H18 PolarHBondContact O-N 3.16Å; H18-G20 PolarHBondContact O-N 2.82Å
19	V	53.1	Low	56.4	Low	105 Å²	105	103.2 Å²	103.2	64%	0.636	60%	0.599	S	S	*	*			trans	-76.4	92.8	175.2	-167.6	0	0	0	0	108.3	L17 G31 A33	L17-V19 PolarHBondContact O-N 2.83Å; V19-G31 PolarHBondContact N-O 2.81Å; V19-A33 HydrophobicContact CG2-CB 3.99Å
20	G	52.5	Low	55.5	Low	62 Å²	62	104.3 Å²	104.3	64%	0.639	61%	0.61	S	S	*	*			trans	-97.3	139.5	171.4	0	0	0	0	0	111.2	H18	H18-G20 PolarHBondContact O-N 2.82Å
21	C	51.1	Low	54.7	Low	111 Å²	111	100 Å²	100	75%	0.75	59%	0.593	S	S	*	*			trans	-82.3	145.4	174.2	-149.3	0	0	0	0	110.4	G23	C21-G23 PolarHBondContact O-N 2.98Å
22	V	47.4	Very low	54.1	Low	157 Å²	157	98.5 Å²	98.5	95%	0.952	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.3	106	175.9	-178.6	0	0	0	0	108.4
23	G	51.9	Low	53.6	Low	86 Å²	86	97.3 Å²	97.3	89%	0.887	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	139.3	-7	177.7	0	0	0	0	0	116.6	C21	C21-G23 PolarHBondContact O-N 2.98Å
24	G	42.4	Very low	53.1	Low	43 Å²	43	99.2 Å²	99.2	44%	0.443	60%	0.595	S	S	.	*			trans	157.7	144.4	172.5	0	0	0	0	0	113.2	V26	G24-V26 VanDerWaalsContact C-N 3.29Å; G24-V26 PolarHBondContact O-N 3.38Å
25	C	44.6	Very low	52.5	Low	125 Å²	125	103.6 Å²	103.6	85%	0.845	61%	0.612	S	S	*	*			trans	-67.2	85	174.2	-66.3	0	0	0	0	110.3	Y27	C25-Y27 PolarHBondContact O-N 3.05Å
26	V	44.4	Very low	52.7	Low	125 Å²	125	105.3 Å²	105.3	76%	0.758	62%	0.617	S	S	*	*			trans	-75.1	110.5	162.6	-174.4	0	0	0	0	106.6	G24 S28	G24-V26 VanDerWaalsContact C-N 3.29Å; G24-V26 PolarHBondContact O-N 3.38Å; V26-S28 PolarHBondContact O-N 3.32Å
27	Y	45.9	Very low	53	Low	233 Å²	233	105.9 Å²	105.9	91%	0.914	62%	0.622	S	S	*	*			trans	-62.8	80.1	168.4	-93.7	-88.9	0	0	0	109.2	C25	C25-Y27 PolarHBondContact O-N 3.05Å
28	S	47.7	Very low	53.9	Low	70 Å²	70	106.5 Å²	106.5	49%	0.49	63%	0.625	S	S	.	*			trans	-91.8	117.8	174	165.7	0	0	0	0	108.4	V26 C30	V26-S28 PolarHBondContact O-N 3.32Å; S28-C30 PolarHBondContact O-N 2.87Å; S28-C30 WeakPolarHBondContact OG-CB 3.43Å; S28-C30 PolarHBondContact OG-N 3.4Å; S28-C30 VanDerWaalsContact OG-N 3.15Å
29	K	51.9	Low	54.6	Low	208 Å²	208	102.4 Å²	102.4	90%	0.904	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.1	-6.3	169.1	-78.1	-177.8	177.2	176	0	112.9
30	C	47.2	Very low	55.8	Low	122 Å²	122	99.9 Å²	99.9	82%	0.824	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.6	5.3	-168.8	-63.3	0	0	0	0	114.8	S28	S28-C30 PolarHBondContact O-N 2.87Å; S28-C30 WeakPolarHBondContact OG-CB 3.43Å; S28-C30 PolarHBondContact OG-N 3.4Å; S28-C30 VanDerWaalsContact OG-N 3.15Å
31	G	49.4	Very low	57	Low	19 Å²	19	100.3 Å²	100.3	20%	0.196	59%	0.593	C	S	.	*			trans	-121.4	30.4	-168.5	0	0	0	0	0	116.6	V19 A33	V19-G31 PolarHBondContact N-O 2.81Å; G31-A33 PolarHBondContact O-N 2.8Å
32	L	50.6	Low	58.2	Low	82 Å²	82	99 Å²	99	43%	0.429	58%	0.582	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-86.6	104.2	172.2	-67.6	172.8	0	0	0	109
33	A	57.8	Low	59.3	Low	38 Å²	38	94 Å²	94	31%	0.314	55%	0.551	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.3	134.1	166.1	0	0	0	0	0	108.3	L17 V19 G31	L17-A33 WeakPolarHBondContact CA-O 3.33Å; L17-A33 HydrophobicContact CB-CB 3.98Å; L17-A33 WeakPolarHBondContact CB-O 3.49Å; L17-A33 HydrophobicContact CD1-CB 4.48Å; L17-A33 PolarHBondContact N-O 2.83Å; L17-A33 PolarHBondContact O-N 3.39Å; L17-A33 VanDerWaalsContact O-N 3.16Å; V19-A33 HydrophobicContact CG2-CB 3.99Å; G31-A33 PolarHBondContact O-N 2.8Å
34	F	59.9	Low	60.5	Low	118 Å²	118	95.3 Å²	95.3	52%	0.518	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	119.5	173.4	-76.6	-88.4	0	0	0	108.3	E16	E16-F34 HydrophobicContact CG-CD1 3.87Å; E16-F34 HydrophobicContact CG-CE1 3.28Å; E16-F34 HydrophobicContact CG-CZ 3.74Å; E16-F34 WeakPolarHBondContact OE1-CE1 3.37Å; E16-F34 WeakPolarHBondContact OE1-CZ 3.25Å
35	E	58	Low	61.8	Low	109 Å²	109	96.1 Å²	96.1	51%	0.509	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.5	126.8	168.5	-161.4	173.5	-173.5	0	0	108.3	A14 S15 L17	A14-E35 CarbonylContact C-O 3.59Å; A14-E35 VanDerWaalsContact CA-O 3.25Å; A14-E35 WeakPolarHBondContact CA-O 3.5Å; S15-E35 PolarHBondContact N-O 2.69Å; S15-E35 PolarHBondContact O-N 3.33Å; L17-E35 HydrophobicContact CD1-CB 3.81Å; L17-E35 HydrophobicContact CD1-CG 4.43Å; L17-E35 HydrophobicContact CG-CB 4.23Å
36	L	70.8	Confident	62.7	Low	84 Å²	84	99.9 Å²	99.9	44%	0.44	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	107.6	-178.8	-155	98	0	0	0	108.7	Q13 A14 I38	Q13-L36 CarbonylContact O-C 3.51Å; Q13-L36 WeakPolarHBondContact O-CA 3.28Å; A14-L36 HydrophobicContact CB-CD1 3.62Å; L36-I38 HydrophobicContact CD2-CD1 3.6Å; L36-I38 HydrophobicContact CD2-CG1 3.66Å; L36-I38 HydrophobicContact CG-CG1 4.36Å
37	L	69.6	Low	63.6	Low	98 Å²	98	95.9 Å²	95.9	51%	0.513	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	109.2	172.8	-178.6	70.6	0	0	0	109	C12 Q13 V39	C12-L37 CarbonylContact C-O 3.45Å; C12-L37 WeakPolarHBondContact CA-O 3.11Å; Q13-L37 HydrophobicContact CB-CB 4.37Å; Q13-L37 PolarHBondContact N-O 2.75Å; Q13-L37 PolarHBondContact O-N 2.88Å; L37-V39 HydrophobicContact CG-CG2 4.44Å
38	I	77.4	Confident	64.5	Low	94 Å²	94	92 Å²	92	48%	0.482	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	118.6	171.9	-55.9	178.8	0	0	0	108.4	V9 R11 L36	V9-I38 HydrophobicContact CG1-CG2 3.87Å; V9-I38 HydrophobicContact CG2-CG2 4.13Å; R11-I38 CarbonylContact O-C 3.53Å; R11-I38 WeakPolarHBondContact O-CA 3.46Å; L36-I38 HydrophobicContact CD2-CD1 3.6Å; L36-I38 HydrophobicContact CD2-CG1 3.66Å; L36-I38 HydrophobicContact CG-CG1 4.36Å
39	V	72.1	Confident	65	Low	62 Å²	62	91.2 Å²	91.2	38%	0.376	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	113.6	167.8	-175.2	0	0	0	0	107.3	L10 R11 L37	L10-V39 WeakPolarHBondContact CA-O 3.36Å; L10-V39 HydrophobicContact CB-CG1 4.43Å; L10-V39 WeakPolarHBondContact CB-O 3.23Å; L10-V39 HydrophobicContact CD1-CG1 4.5Å; L10-V39 PolarHBondContact N-O 3.36Å; R11-V39 HydrophobicContact CB-CB 4.06Å; R11-V39 HydrophobicContact CB-CG2 4.26Å; R11-V39 PolarHBondContact N-O 2.73Å; R11-V39 VanDerWaalsContact N-O 3.09Å; R11-V39 PolarHBondContact O-N 2.94Å; L37-V39 HydrophobicContact CG-CG2 4.44Å
40	G	79	Confident	65.6	Low	51 Å²	51	87.1 Å²	87.1	53%	0.526	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	160.4	175.9	0	0	0	0	0	112.6	S8	S8-G40 CarbonylContact O-C 3.59Å; S8-G40 WeakPolarHBondContact O-CA 3.49Å
41	N	77.2	Confident	66	Low	72 Å²	72	86 Å²	86	39%	0.385	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	133.1	167	-179.1	37.6	0	0	0	109	S7 S8 L10 T43	S7-N41 CarbonylContact C-O 3.59Å; S7-N41 VanDerWaalsContact CA-O 3.32Å; S7-N41 WeakPolarHBondContact CA-O 3.4Å; S8-N41 PolarHBondContact N-O 3.01Å; S8-N41 PolarHBondContact O-N 3.25Å; L10-N41 HydrophobicContact CD1-CB 3.86Å; L10-N41 HydrophobicContact CD2-CB 4.11Å; L10-N41 HydrophobicContact CG-CB 3.9Å; N41-T43 PolarHBondContact ND2-OG1 3.05Å
42	T	76.8	Confident	66.2	Low	83 Å²	83	87.3 Å²	87.3	51%	0.509	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	122.7	175.8	-56.2	0	0	0	0	108.5	I5 V6 I44	I5-T42 HydrophobicContact CG2-CG2 3.71Å; V6-T42 CarbonylContact O-C 3.54Å; V6-T42 WeakPolarHBondContact O-CA 3.49Å; T42-I44 HydrophobicContact CG2-CG1 4.39Å
43	T	69.8	Low	66.5	Low	52 Å²	52	91.4 Å²	91.4	32%	0.319	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	123.6	179.8	-30.1	0	0	0	0	108.8	V6 N41 F45	V6-T43 PolarHBondContact N-O 3.39Å; V6-T43 PolarHBondContact O-N 3.47Å; N41-T43 PolarHBondContact ND2-OG1 3.05Å; T43-F45 HydrophobicContact CG2-CD1 4.47Å; T43-F45 HydrophobicContact CG2-CE1 3.58Å; T43-F45 HydrophobicContact CG2-CE2 3.96Å; T43-F45 HydrophobicContact CG2-CZ 3.28Å
44	I	77.7	Confident	66.3	Low	113 Å²	113	96.3 Å²	96.3	58%	0.579	51%	0.508	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109	121.9	-178.3	-55.4	175.2	0	0	0	108.1	T3 I5 T42	T3-I44 HydrophobicContact CG2-CG2 3.78Å; I5-I44 HydrophobicContact CG1-CG1 4.38Å; I5-I44 HydrophobicContact CG1-CG2 4.42Å; I5-I44 HydrophobicContact CG2-CG1 4.41Å; T42-I44 HydrophobicContact CG2-CG1 4.39Å
45	F	69.8	Low	65.8	Low	60 Å²	60	91.5 Å²	91.5	26%	0.263	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	134.9	178.5	-47.6	-82.5	0	0	0	109.5	T3 I4 V6 T43 T59	T3-F45 CarbonylContact C-O 3.53Å; T3-F45 WeakPolarHBondContact CA-O 3.31Å; I4-F45 HydrophobicContact CB-CD2 4.48Å; I4-F45 PolarHBondContact N-O 3.47Å; I4-F45 PolarHBondContact O-N 3.47Å; V6-F45 HydrophobicContact CB-CE2 4.05Å; V6-F45 HydrophobicContact CG2-CD2 4.2Å; V6-F45 HydrophobicContact CG2-CE2 3.73Å; T43-F45 HydrophobicContact CG2-CD1 4.47Å; T43-F45 HydrophobicContact CG2-CE1 3.58Å; T43-F45 HydrophobicContact CG2-CE2 3.96Å; T43-F45 HydrophobicContact CG2-CZ 3.28Å; F45-T59 HydrophobicContact CE1-CG2 4.38Å; F45-T59 HydrophobicContact CZ-CG2 4.25Å
46	R	63.1	Low	65.5	Low	205 Å²	205	89 Å²	89	77%	0.774	48%	0.478	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.1	113	166.4	-113.6	179	177.7	170.6	-0.9	108.2
47	M	63.8	Low	64.8	Low	41 Å²	41	89.8 Å²	89.8	20%	0.202	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	126.1	177.8	-77.2	-175	160.4	0	0	110.8	S1 L2 I4 S55 T59	S1-M47 WeakPolarHBondContact CA-O 3.49Å; L2-M47 PolarHBondContact N-O 3.41Å; L2-M47 PolarHBondContact O-N 2.99Å; I4-M47 HydrophobicContact CD1-SD 3.84Å; M47-S55 WeakPolarHBondContact SD-CB 3.47Å; M47-S55 PolarHBondContact SD-OG 3.3Å; M47-S55 VanDerWaalsContact SD-OG 3.33Å; M47-T59 VanDerWaalsContact CE-OG1 3.28Å; M47-T59 WeakPolarHBondContact CE-OG1 3.33Å
48	N	64.1	Low	64	Low	150 Å²	150	91.1 Å²	91.1	80%	0.802	49%	0.486	S	S	*	.			trans	-99.1	81.8	164.7	-79.1	-16.6	0	0	0	107.8	S1	S1-N48 WeakPolarHBondContact CA-OD1 3.45Å; S1-N48 WeakPolarHBondContact CB-OD1 2.99Å
49	S	58.1	Low	62.7	Low	55 Å²	55	88.6 Å²	88.6	39%	0.385	48%	0.475	S	S	.	.			trans	-133.8	135.1	174.8	168.3	0	0	0	0	109.3	N51	S49-N51 PolarHBondContact O-N 2.77Å; S49-N51 PolarHBondContact OG-N 2.88Å; S49-N51 PolarHBondContact OG-O 3.43Å
50	S	64.6	Low	61.7	Low	121 Å²	121	91.6 Å²	91.6	85%	0.846	49%	0.488	S	S	*	.	S	Bend	trans	-65.5	-14.4	171.1	43.6	0	0	0	0	112.9
51	N	55.9	Low	60.2	Low	99 Å²	99	95.3 Å²	95.3	53%	0.529	50%	0.495	S	S	.	.			trans	-128.7	93.3	175.5	-91.1	-34.2	0	0	0	110.9	S49 F53 S55	S49-N51 PolarHBondContact O-N 2.77Å; S49-N51 PolarHBondContact OG-N 2.88Å; S49-N51 PolarHBondContact OG-O 3.43Å; N51-F53 VanDerWaalsContact C-N 3.34Å; N51-F53 PolarHBondContact O-N 3.26Å; N51-S55 PolarHBondContact O-OG 3.23Å
52	P	54.2	Low	58.5	Low	47 Å²	47	97.7 Å²	97.7	31%	0.305	50%	0.504	S	S	.	.	H	α-helix	trans	-68.2	-29	-172	24.3	-32.8	0	0	0	114.1	L2 S55 L56	L2-P52 HydrophobicContact CD2-CB 3.54Å; P52-S55 PolarHBondContact O-OG 2.77Å; P52-L56 WeakPolarHBondContact O-CB 3.2Å; P52-L56 PolarHBondContact O-N 2.82Å
53	F	55.7	Low	56.8	Low	168 Å²	168	98.9 Å²	98.9	74%	0.737	51%	0.513	S	S	*	.	H	α-helix	trans	-72.4	-36.6	-176.6	-80.8	-81.1	0	0	0	113.6	N51 L56 L57	N51-F53 VanDerWaalsContact C-N 3.34Å; N51-F53 PolarHBondContact O-N 3.26Å; F53-L56 PolarHBondContact O-N 3.13Å; F53-L57 WeakPolarHBondContact O-CB 3.47Å; F53-L57 PolarHBondContact O-N 3.12Å
54	Q	54.7	Low	55.3	Low	141 Å²	141	102.2 Å²	102.2	66%	0.659	53%	0.528	S	S	*	.	H	α-helix	trans	-70.7	-37.8	-175.2	-158.1	172.4	5.4	0	0	111.5	Q58	Q54-Q58 PolarHBondContact O-N 3.09Å
55	S	50.1	Low	53.4	Low	17 Å²	17	101.3 Å²	101.3	12%	0.119	53%	0.525	C	S	.	.	H	α-helix	trans	-73.9	-31.7	176.5	47.3	0	0	0	0	113	M47 N51 P52 Q58 T59	M47-S55 WeakPolarHBondContact SD-CB 3.47Å; M47-S55 PolarHBondContact SD-OG 3.3Å; M47-S55 VanDerWaalsContact SD-OG 3.33Å; N51-S55 PolarHBondContact O-OG 3.23Å; P52-S55 PolarHBondContact O-OG 2.77Å; S55-Q58 PolarHBondContact O-N 2.78Å; S55-T59 PolarHBondContact O-N 2.76Å; S55-T59 PolarHBondContact O-OG1 3.39Å
56	L	51.8	Low	51.8	Low	57 Å²	57	106.4 Å²	106.4	30%	0.298	55%	0.547	S	S	.	.	H	α-helix	trans	-69.7	-42	174.4	-149.8	153.9	0	0	0	111	I4 P52 F53 Q58 T59 L60	I4-L56 HydrophobicContact CD1-CB 4.39Å; I4-L56 HydrophobicContact CD1-CD1 3.55Å; I4-L56 HydrophobicContact CD1-CG 3.92Å; I4-L56 HydrophobicContact CG1-CD1 4.04Å; I4-L56 HydrophobicContact CG2-CD1 4.15Å; P52-L56 WeakPolarHBondContact O-CB 3.2Å; P52-L56 PolarHBondContact O-N 2.82Å; F53-L56 PolarHBondContact O-N 3.13Å; L56-Q58 VanDerWaalsContact C-N 3.33Å; L56-Q58 PolarHBondContact O-N 2.85Å; L56-T59 PolarHBondContact O-N 3.14Å; L56-L60 HydrophobicContact CD2-CD1 3.5Å; L56-L60 VanDerWaalsContact CD2-CD1 3.5Å; L56-L60 HydrophobicContact CD2-CG 4.23Å; L56-L60 WeakPolarHBondContact O-CB 3.5Å; L56-L60 WeakPolarHBondContact O-CG 3.32Å; L56-L60 PolarHBondContact O-N 2.99Å
57	L	54.5	Low	50.3	Low	99 Å²	99	102.6 Å²	102.6	52%	0.518	54%	0.541	S	S	.	.	H	α-helix	trans	-59	-42.4	170	-107.7	146.1	0	0	0	111.9	F53 T59 L60 L61	F53-L57 WeakPolarHBondContact O-CB 3.47Å; F53-L57 PolarHBondContact O-N 3.12Å; L57-T59 VanDerWaalsContact C-N 3.32Å; L57-T59 PolarHBondContact O-N 2.78Å; L57-L60 PolarHBondContact O-N 2.82Å; L57-L61 HydrophobicContact CB-CD1 4.44Å; L57-L61 HydrophobicContact CD2-CD1 3.37Å; L57-L61 HydrophobicContact CD2-CG 4.12Å; L57-L61 WeakPolarHBondContact O-CA 3.29Å; L57-L61 WeakPolarHBondContact O-CB 3.25Å; L57-L61 VanDerWaalsContact O-CG 3.31Å; L57-L61 WeakPolarHBondContact O-CG 3.44Å; L57-L61 PolarHBondContact O-N 3.41Å
58	Q	53.2	Low	48.9	Very low	126 Å²	126	105.4 Å²	105.4	59%	0.589	56%	0.56	S	S	*	*	H	α-helix	trans	-67.6	-33.4	178.2	-134.3	170.7	8.4	0	0	112.6	Q54 S55 L56 H62	Q54-Q58 PolarHBondContact O-N 3.09Å; S55-Q58 PolarHBondContact O-N 2.78Å; L56-Q58 VanDerWaalsContact C-N 3.33Å; L56-Q58 PolarHBondContact O-N 2.85Å; Q58-H62 VanDerWaalsContact O-CB 3.25Å; Q58-H62 WeakPolarHBondContact O-CB 3.5Å; Q58-H62 PolarHBondContact O-N 2.74Å
59	T	50.8	Low	47.3	Very low	42 Å²	42	103.6 Å²	103.6	26%	0.258	55%	0.549	S	S	.	.	H	α-helix	trans	-74.6	-33.4	176.8	-45.7	0	0	0	0	111.6	F45 M47 S55 L56 L57	F45-T59 HydrophobicContact CE1-CG2 4.38Å; F45-T59 HydrophobicContact CZ-CG2 4.25Å; M47-T59 VanDerWaalsContact CE-OG1 3.28Å; M47-T59 WeakPolarHBondContact CE-OG1 3.33Å; S55-T59 PolarHBondContact O-N 2.76Å; S55-T59 PolarHBondContact O-OG1 3.39Å; L56-T59 PolarHBondContact O-N 3.14Å; L57-T59 VanDerWaalsContact C-N 3.32Å; L57-T59 PolarHBondContact O-N 2.78Å
60	L	50.6	Low	46	Very low	125 Å²	125	109.9 Å²	109.9	65%	0.654	57%	0.569	S	S	*	*	H	α-helix	trans	-78.6	-33	174.1	-77.5	168.6	0	0	0	113.5	L56 L57	L56-L60 HydrophobicContact CD2-CD1 3.5Å; L56-L60 VanDerWaalsContact CD2-CD1 3.5Å; L56-L60 HydrophobicContact CD2-CG 4.23Å; L56-L60 WeakPolarHBondContact O-CB 3.5Å; L56-L60 WeakPolarHBondContact O-CG 3.32Å; L56-L60 PolarHBondContact O-N 2.99Å; L57-L60 PolarHBondContact O-N 2.82Å
61	L	48.2	Very low	44.5	Very low	128 Å²	128	110.8 Å²	110.8	67%	0.67	56%	0.564	S	S	*	*	H	α-helix	trans	-88.5	-21.8	180	-77.9	165.3	0	0	0	113.1	L57 P63	L57-L61 HydrophobicContact CB-CD1 4.44Å; L57-L61 HydrophobicContact CD2-CD1 3.37Å; L57-L61 HydrophobicContact CD2-CG 4.12Å; L57-L61 WeakPolarHBondContact O-CA 3.29Å; L57-L61 WeakPolarHBondContact O-CB 3.25Å; L57-L61 VanDerWaalsContact O-CG 3.31Å; L57-L61 WeakPolarHBondContact O-CG 3.44Å; L57-L61 PolarHBondContact O-N 3.41Å; L61-P63 WeakPolarHBondContact O-CD 3.36Å
62	H	40.2	Very low	43.4	Very low	122 Å²	122	109.4 Å²	109.4	57%	0.565	56%	0.558	S	S	*	*	S	Bend	trans	-63.7	126.3	172.1	-106.6	-35.7	0	0	0	107.9	Q58 L64	Q58-H62 VanDerWaalsContact O-CB 3.25Å; Q58-H62 WeakPolarHBondContact O-CB 3.5Å; Q58-H62 PolarHBondContact O-N 2.74Å; H62-L64 PolarHBondContact O-N 3.35Å
63	P	41.4	Very low	42.3	Very low	108 Å²	108	110.8 Å²	110.8	70%	0.701	57%	0.574	S	S	*	*			trans	-72.4	67.8	172.7	32.1	-32.2	0	0	0	107.3	L61 N65	L61-P63 WeakPolarHBondContact O-CD 3.36Å; P63-N65 PolarHBondContact O-N 3.42Å
64	L	38	Very low	41.2	Very low	122 Å²	122	114.2 Å²	114.2	64%	0.639	58%	0.582	S	S	*	*			trans	-65.2	88.4	164	-91.1	163.1	0	0	0	105.9	H62 F66	H62-L64 PolarHBondContact O-N 3.35Å; L64-F66 PolarHBondContact O-N 2.88Å
65	N	38.5	Very low	40.1	Very low	95 Å²	95	112 Å²	112	51%	0.508	58%	0.582	S	S	.	*			trans	52	66.8	149.1	-68	-27.8	0	0	0	114.7	P63 I67 V68	P63-N65 PolarHBondContact O-N 3.42Å; N65-I67 HydrophobicContact CB-CB 4.13Å; N65-I67 HydrophobicContact CB-CG1 4.31Å; N65-I67 PolarHBondContact O-N 3.46Å; N65-I67 VanDerWaalsContact OD1-CD1 3.23Å; N65-I67 WeakPolarHBondContact OD1-CD1 3.4Å; N65-V68 PolarHBondContact O-N 3.09Å
66	F	35.8	Very low	39.5	Very low	167 Å²	167	115.5 Å²	115.5	73%	0.732	60%	0.599	S	S	*	*	G	3₁₀ helix	trans	-52	-0.2	144.3	-94.7	-89.3	0	0	0	113.4	L64 V68 I69	L64-F66 PolarHBondContact O-N 2.88Å; F66-V68 PolarHBondContact O-N 2.89Å; F66-I69 HydrophobicContact CD1-CD1 3.59Å; F66-I69 HydrophobicContact CE1-CD1 3.64Å; F66-I69 HydrophobicContact CG-CD1 4.48Å; F66-I69 PolarHBondContact O-N 3.21Å
67	I	31.9	Very low	38.7	Very low	124 Å²	124	117.6 Å²	117.6	64%	0.636	62%	0.624	S	S	*	*	G	3₁₀ helix	trans	-58.3	-22.3	171.8	-60.2	-175.5	0	0	0	112.4	N65	N65-I67 HydrophobicContact CB-CB 4.13Å; N65-I67 HydrophobicContact CB-CG1 4.31Å; N65-I67 PolarHBondContact O-N 3.46Å; N65-I67 VanDerWaalsContact OD1-CD1 3.23Å; N65-I67 WeakPolarHBondContact OD1-CD1 3.4Å
68	V	33.8	Very low	37.7	Very low	100 Å²	100	116.2 Å²	116.2	61%	0.606	63%	0.634	S	S	*	*	G	3₁₀ helix	trans	-85.8	-17.6	178.9	179.8	0	0	0	0	113.8	N65 F66	N65-V68 PolarHBondContact O-N 3.09Å; F66-V68 PolarHBondContact O-N 2.89Å
69	I	31.5	Very low	36.9	Very low	112 Å²	112	119 Å²	119	57%	0.574	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.5	-18	-174.4	-67.3	163.4	0	0	0	112.8	F66 I71	F66-I69 HydrophobicContact CD1-CD1 3.59Å; F66-I69 HydrophobicContact CE1-CD1 3.64Å; F66-I69 HydrophobicContact CG-CD1 4.48Å; F66-I69 PolarHBondContact O-N 3.21Å; I69-I71 PolarHBondContact O-N 3.11Å
70	K	30.2	Very low	36.2	Very low	187 Å²	187	121.1 Å²	121.1	81%	0.813	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.2	-15.8	-177.4	-134.2	175.3	-175	177	0	114.6
71	I	32.7	Very low	35.6	Very low	141 Å²	141	124 Å²	124	72%	0.723	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.9	-27.7	-178.4	-63.1	175.6	0	0	0	111.7	I69	I69-I71 PolarHBondContact O-N 3.11Å
72	V	33.2	Very low	35.1	Very low	69 Å²	69	124.7 Å²	124.7	42%	0.418	67%	0.67	S	S	.	*	G	3₁₀ helix	trans	-88.2	-21.6	-174	-176.9	0	0	0	0	113.3	R74 S75 L76	V72-R74 PolarHBondContact O-N 3.01Å; V72-R74 VanDerWaalsContact O-N 3.12Å; V72-S75 PolarHBondContact O-N 3.47Å; V72-S75 VanDerWaalsContact O-N 3.13Å; V72-L76 HydrophobicContact CG1-CD1 4.04Å
73	A	31.8	Very low	34.9	Very low	77 Å²	77	121.6 Å²	121.6	64%	0.636	66%	0.662	S	S	*	*	G	3₁₀ helix	trans	-63.2	-20.2	179.4	0	0	0	0	0	114.1
74	R	32.2	Very low	34.9	Very low	239 Å²	239	121.8 Å²	121.8	90%	0.902	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-81.8	-16.6	176.7	-93.3	-177.9	172.7	172.5	-2.3	114.5	V72	V72-R74 PolarHBondContact O-N 3.01Å; V72-R74 VanDerWaalsContact O-N 3.12Å
75	S	32.1	Very low	35	Very low	94 Å²	94	123.6 Å²	123.6	66%	0.657	66%	0.662	S	S	*	*	S	Bend	trans	-95.8	-6.3	-174.9	-157.7	0	0	0	0	114.4	V72	V72-S75 PolarHBondContact O-N 3.47Å; V72-S75 VanDerWaalsContact O-N 3.13Å
76	L	37.2	Very low	34.9	Very low	91 Å²	91	123.3 Å²	123.3	48%	0.476	65%	0.654	S	S	.	*	S	Bend	trans	-100.5	-15.7	-175.8	-98.6	103	0	0	0	115.2	V72 G78 L80	V72-L76 HydrophobicContact CG1-CD1 4.04Å; L76-G78 PolarHBondContact O-N 3.18Å; L76-G78 VanDerWaalsContact O-N 3.14Å; L76-L80 HydrophobicContact CD2-CD1 3.44Å; L76-L80 VanDerWaalsContact CD2-CD1 3.44Å; L76-L80 HydrophobicContact CG-CD1 4.27Å
77	A	35.5	Very low	35	Very low	101 Å²	101	124.3 Å²	124.3	84%	0.835	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69	-9	179.8	0	0	0	0	0	113.7
78	G	32.4	Very low	35.3	Very low	70 Å²	70	125.2 Å²	125.2	72%	0.722	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.1	-17.6	-173.4	0	0	0	0	0	117.1	L76	L76-G78 PolarHBondContact O-N 3.18Å; L76-G78 VanDerWaalsContact O-N 3.14Å
79	Q	36.5	Very low	35.4	Very low	185 Å²	185	124.3 Å²	124.3	86%	0.864	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-144.7	-0.3	-165.4	-82.9	-171.9	-25.2	0	0	118.1	H81	Q79-H81 PolarHBondContact O-N 3.42Å
80	L	36.6	Very low	35.6	Very low	86 Å²	86	127.8 Å²	127.8	45%	0.45	65%	0.653	S	S	.	*			trans	-98.8	86.4	175.4	-83	153.6	0	0	0	110.7	L76 L82 Y86	L76-L80 HydrophobicContact CD2-CD1 3.44Å; L76-L80 VanDerWaalsContact CD2-CD1 3.44Å; L76-L80 HydrophobicContact CG-CD1 4.27Å; L80-L82 VanDerWaalsContact C-N 3.32Å; L80-L82 PolarHBondContact O-N 3.44Å; L80-Y86 HydrophobicContact CD2-CE2 4.41Å
81	H	37.2	Very low	35.7	Very low	186 Å²	186	121.9 Å²	121.9	86%	0.861	64%	0.635	S	S	*	*			trans	-58.5	104.3	150	-115.6	-80.1	0	0	0	106.5	Q79 S83	Q79-H81 PolarHBondContact O-N 3.42Å; H81-S83 VanDerWaalsContact C-N 3.29Å; H81-S83 PolarHBondContact O-N 3.29Å
82	L	37.6	Very low	35.8	Very low	143 Å²	143	124.3 Å²	124.3	75%	0.749	64%	0.636	S	S	*	*			trans	-59	90.1	177.2	-79.7	153.4	0	0	0	109.4	L80	L80-L82 VanDerWaalsContact C-N 3.32Å; L80-L82 PolarHBondContact O-N 3.44Å
83	S	37.4	Very low	35.8	Very low	56 Å²	56	125 Å²	125	39%	0.392	64%	0.636	S	S	.	*			trans	-72.7	132.2	167.5	179.4	0	0	0	0	108.6	H81 R85 Y86	H81-S83 VanDerWaalsContact C-N 3.29Å; H81-S83 PolarHBondContact O-N 3.29Å; S83-R85 PolarHBondContact O-N 3.44Å; S83-Y86 PolarHBondContact O-N 2.79Å; S83-Y86 VanDerWaalsContact O-N 3.1Å
84	P	40.4	Very low	35.9	Very low	113 Å²	113	125.6 Å²	125.6	73%	0.734	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.6	-18.9	-177.4	-26.6	33	0	0	0	115.2	Y86	P84-Y86 VanDerWaalsContact C-N 3.33Å; P84-Y86 PolarHBondContact O-N 3.1Å
85	R	41.2	Very low	36	Very low	160 Å²	160	122.3 Å²	122.3	60%	0.604	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73	-19.3	-179.8	-69.9	-176.3	176.2	179	-1.7	114.3	S83 Y87 Q88	S83-R85 PolarHBondContact O-N 3.44Å; R85-Y87 VanDerWaalsContact C-N 3.31Å; R85-Y87 PolarHBondContact O-N 2.96Å; R85-Q88 PolarHBondContact O-N 3.28Å
86	Y	36.2	Very low	36.1	Very low	88 Å²	88	124.6 Å²	124.6	35%	0.345	63%	0.625	S	S	.	*	H	α-helix	trans	-67.7	-28.7	179.1	-103.7	-90.2	0	0	0	113.2	A14 L80 S83 P84 Q88 L89 W90	A14-Y86 VanDerWaalsContact CB-OH 3.29Å; A14-Y86 WeakPolarHBondContact CB-OH 3.41Å; A14-Y86 PolarHBondContact N-OH 3.35Å; A14-Y86 PolarHBondContact O-OH 3.29Å; L80-Y86 HydrophobicContact CD2-CE2 4.41Å; S83-Y86 PolarHBondContact O-N 2.79Å; S83-Y86 VanDerWaalsContact O-N 3.1Å; P84-Y86 VanDerWaalsContact C-N 3.33Å; P84-Y86 PolarHBondContact O-N 3.1Å; Y86-Q88 VanDerWaalsContact C-N 3.28Å; Y86-Q88 PolarHBondContact O-N 3.16Å; Y86-L89 PolarHBondContact O-N 3.46Å; Y86-W90 PolarHBondContact O-N 2.89Å; Y86-W90 VanDerWaalsContact O-N 3.16Å
87	Y	36.7	Very low	36	Very low	189 Å²	189	127.4 Å²	127.4	74%	0.741	64%	0.64	S	S	*	*	H	α-helix	trans	-63	-31.8	175.5	-97.5	-85.2	0	0	0	113.1	R85 S91	R85-Y87 VanDerWaalsContact C-N 3.31Å; R85-Y87 PolarHBondContact O-N 2.96Å; Y87-S91 PolarHBondContact O-N 3.26Å; Y87-S91 PolarHBondContact O-OG 3.4Å
88	Q	39.1	Very low	35.8	Very low	143 Å²	143	132.2 Å²	132.2	67%	0.668	65%	0.651	S	S	*	*	H	α-helix	trans	-75.3	-30.5	177.9	-89.8	-177.9	-23.1	0	0	113.2	R85 Y86 S91 R92	R85-Q88 PolarHBondContact O-N 3.28Å; Y86-Q88 VanDerWaalsContact C-N 3.28Å; Y86-Q88 PolarHBondContact O-N 3.16Å; Q88-S91 WeakPolarHBondContact CA-OG 3.45Å; Q88-S91 PolarHBondContact O-OG 3.38Å; Q88-S91 VanDerWaalsContact O-OG 3.06Å; Q88-R92 WeakPolarHBondContact O-CG 3.5Å; Q88-R92 PolarHBondContact O-N 3.06Å
89	L	36.8	Very low	36	Very low	80 Å²	80	135.3 Å²	135.3	42%	0.419	65%	0.647	S	S	.	*	H	α-helix	trans	-75.3	-39.5	176.3	-107.7	139.6	0	0	0	111.5	Y86 S91 R92 L93	Y86-L89 PolarHBondContact O-N 3.46Å; L89-S91 VanDerWaalsContact C-N 3.35Å; L89-S91 PolarHBondContact O-N 3.02Å; L89-R92 PolarHBondContact O-N 3Å; L89-L93 PolarHBondContact O-N 3.28Å; L89-L93 VanDerWaalsContact O-N 3.09Å
90	W	34.3	Very low	35.9	Very low	185 Å²	185	132.7 Å²	132.7	70%	0.701	64%	0.636	S	S	*	*	H	α-helix	trans	-62.4	-41.2	176.6	-136.7	83.8	0	0	0	112.2	Y86 R92 L93 L94	Y86-W90 PolarHBondContact O-N 2.89Å; Y86-W90 VanDerWaalsContact O-N 3.16Å; W90-R92 VanDerWaalsContact C-N 3.33Å; W90-R92 PolarHBondContact O-N 3.21Å; W90-L93 PolarHBondContact O-N 3.16Å; W90-L94 HydrophobicContact CE3-CD1 3.55Å; W90-L94 HydrophobicContact CH2-CD1 3.93Å; W90-L94 HydrophobicContact CZ3-CD1 3.14Å; W90-L94 PolarHBondContact O-N 3.06Å; W90-L94 VanDerWaalsContact O-N 3.11Å
91	S	33	Very low	35.9	Very low	64 Å²	64	135.3 Å²	135.3	45%	0.448	65%	0.646	S	S	.	*	H	α-helix	trans	-70.6	-21.9	176.6	51.4	0	0	0	0	114.5	Y87 Q88 L89	Y87-S91 PolarHBondContact O-N 3.26Å; Y87-S91 PolarHBondContact O-OG 3.4Å; Q88-S91 WeakPolarHBondContact CA-OG 3.45Å; Q88-S91 PolarHBondContact O-OG 3.38Å; Q88-S91 VanDerWaalsContact O-OG 3.06Å; L89-S91 VanDerWaalsContact C-N 3.35Å; L89-S91 PolarHBondContact O-N 3.02Å
92	R	33.8	Very low	35.8	Very low	192 Å²	192	132.3 Å²	132.3	73%	0.725	63%	0.633	S	S	*	*	H	α-helix	trans	-83.2	-33.6	173.7	-70.8	-174	101.6	-178	6.6	112.8	Q88 L89 W90 K95 L96	Q88-R92 WeakPolarHBondContact O-CG 3.5Å; Q88-R92 PolarHBondContact O-N 3.06Å; L89-R92 PolarHBondContact O-N 3Å; W90-R92 VanDerWaalsContact C-N 3.33Å; W90-R92 PolarHBondContact O-N 3.21Å; R92-K95 PolarHBondContact O-N 3.15Å; R92-L96 PolarHBondContact O-N 3.45Å
93	L	33.9	Very low	35.7	Very low	83 Å²	83	131.6 Å²	131.6	44%	0.435	63%	0.626	S	S	.	*	H	α-helix	trans	-66.7	-40.5	172.2	-77.8	162.4	0	0	0	111.1	L89 W90 K95 L96 D97	L89-L93 PolarHBondContact O-N 3.28Å; L89-L93 VanDerWaalsContact O-N 3.09Å; W90-L93 PolarHBondContact O-N 3.16Å; L93-K95 PolarHBondContact O-N 2.85Å; L93-L96 PolarHBondContact O-N 2.74Å; L93-D97 PolarHBondContact O-N 3.28Å
94	L	34	Very low	35.6	Very low	90 Å²	90	136.7 Å²	136.7	47%	0.471	64%	0.642	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64.5	-20.3	174.7	-129.4	123.8	0	0	0	114.1	W90	W90-L94 HydrophobicContact CE3-CD1 3.55Å; W90-L94 HydrophobicContact CH2-CD1 3.93Å; W90-L94 HydrophobicContact CZ3-CD1 3.14Å; W90-L94 PolarHBondContact O-N 3.06Å; W90-L94 VanDerWaalsContact O-N 3.11Å
95	K	33.9	Very low	35.3	Very low	170 Å²	170	138.4 Å²	138.4	74%	0.739	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.5	-13.4	173.8	-87.1	-176.3	174.8	-176.8	0	113.9	R92 L93	R92-K95 PolarHBondContact O-N 3.15Å; L93-K95 PolarHBondContact O-N 2.85Å
96	L	34.1	Very low	34.8	Very low	141 Å²	141	136.7 Å²	136.7	74%	0.738	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.8	-15.7	175.1	-78.2	158.8	0	0	0	112.1	R92 L93	R92-L96 PolarHBondContact O-N 3.45Å; L93-L96 PolarHBondContact O-N 2.74Å
97	D	35.4	Very low	34.7	Very low	150 Å²	150	140.8 Å²	140.8	80%	0.802	66%	0.662	S	S	*	*			trans	-99.3	13.7	178.6	-83.7	-29.6	0	0	0	114	L93	L93-D97 PolarHBondContact O-N 3.28Å
98	L	31.3	Very low	34.5	Very low	202 Å²	202	136.4 Å²	136.4	100%	1.058	66%	0.655	S	S	*	*			trans	-125.6	0	171.8	-80.4	166.3	0	0	0	110.2

Retrieved 98 of 98 residues in 48.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).