A0A075B5L3_MOUSE Loading...

Immunoglobulin kappa chain variable 4-90

AlphaFold DB , UniProt , Accession A0A075B5L3, Species MOUSE (Mus musculus, Mouse), Gene Igkv4-90, Length 117 aa.

						>A0A075B5L3_MOUSE|A0A075B5L3|Igkv4-90
MDFQVQIFSFLLISVTVILTNGEILLTQSPAIIAASPGEKVTITCSASSSVSYMNWYQQKPGSSPKIWIYGISNLASGVPARFSGSGSGTSFSFTINSMEAEDVATYYCQQRSSYPP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	36.7	Very low	45	Very low	227 Å²	227	155.6 Å²	155.6	100%	1.118	77%	0.772	S	S	*	*				0	110.4	0	-72.9	153.8	61	0	0	104.3
2	D	42.8	Very low	46.3	Very low	157 Å²	157	157.3 Å²	157.3	84%	0.84	78%	0.784	S	S	*	*				-136.9	129	50.8	-68.3	-52.2	0	0	0	113.7
3	F	41.7	Very low	47.3	Very low	169 Å²	169	154.9 Å²	154.9	74%	0.741	77%	0.774	S	S	*	*			trans	-109.3	97.8	169	-167.9	-91.3	0	0	0	105.2	V5	F3-V5 HydrophobicContact CD1-CG2 4.3Å; F3-V5 HydrophobicContact CE1-CB 4.31Å; F3-V5 HydrophobicContact CE1-CG2 3.83Å; F3-V5 HydrophobicContact CE2-CG2 4.29Å; F3-V5 HydrophobicContact CZ-CG2 3.83Å
4	Q	41.8	Very low	48.8	Very low	163 Å²	163	150.8 Å²	150.8	76%	0.762	77%	0.767	S	S	*	*			trans	-131.1	74.8	166.7	-75.5	-62.3	-61.4	0	0	108.4	Q6	Q4-Q6 VanDerWaalsContact C-N 3.3Å; Q4-Q6 PolarHBondContact O-N 3.42Å
5	V	45	Very low	49.9	Very low	80 Å²	80	148.2 Å²	148.2	49%	0.485	76%	0.761	S	S	.	*			trans	-61.5	95.2	155	175.6	0	0	0	0	106.7	F3 I7	F3-V5 HydrophobicContact CD1-CG2 4.3Å; F3-V5 HydrophobicContact CE1-CB 4.31Å; F3-V5 HydrophobicContact CE1-CG2 3.83Å; F3-V5 HydrophobicContact CE2-CG2 4.29Å; F3-V5 HydrophobicContact CZ-CG2 3.83Å; V5-I7 HydrophobicContact CG1-CB 3.74Å; V5-I7 HydrophobicContact CG1-CD1 3.4Å; V5-I7 VanDerWaalsContact CG1-CD1 3.4Å; V5-I7 HydrophobicContact CG1-CG1 3.42Å; V5-I7 VanDerWaalsContact CG1-CG1 3.42Å; V5-I7 PolarHBondContact O-N 3.1Å
6	Q	45	Very low	50.9	Low	175 Å²	175	145.5 Å²	145.5	82%	0.818	75%	0.754	S	S	*	*			trans	-90.4	60.5	163.6	-135.8	157.9	-18.1	0	0	108.1	Q4	Q4-Q6 VanDerWaalsContact C-N 3.3Å; Q4-Q6 PolarHBondContact O-N 3.42Å
7	I	40.9	Very low	51.6	Low	113 Å²	113	143.1 Å²	143.1	58%	0.579	75%	0.747	S	S	*	*			trans	-73.2	122.6	153.6	-71.5	172.2	0	0	0	104.8	V5	V5-I7 HydrophobicContact CG1-CB 3.74Å; V5-I7 HydrophobicContact CG1-CD1 3.4Å; V5-I7 VanDerWaalsContact CG1-CD1 3.4Å; V5-I7 HydrophobicContact CG1-CG1 3.42Å; V5-I7 VanDerWaalsContact CG1-CG1 3.42Å; V5-I7 PolarHBondContact O-N 3.1Å
8	F	42.2	Very low	52.3	Low	175 Å²	175	142.3 Å²	142.3	77%	0.768	74%	0.742	S	S	*	*	S	Bend	trans	145.1	113.8	143.2	-77.4	-63.4	0	0	0	109.9
9	S	56.3	Low	52.6	Low	107 Å²	107	142 Å²	142	75%	0.748	74%	0.741	S	S	*	*			trans	87.4	35.2	140.2	-45.9	0	0	0	0	119.4	L11	S9-L11 PolarHBondContact O-N 3.35Å
10	F	50.3	Low	53	Low	206 Å²	206	140.1 Å²	140.1	90%	0.904	74%	0.735	S	S	*	*			trans	-81.5	78.5	149.9	-71	-74.4	0	0	0	108.7	L12	F10-L12 PolarHBondContact O-N 3.27Å
11	L	52.1	Low	53.5	Low	140 Å²	140	139.6 Å²	139.6	73%	0.733	73%	0.734	S	S	*	*			trans	19.4	102.7	145	-158.8	75.7	0	0	0	113.2	S9 I13	S9-L11 PolarHBondContact O-N 3.35Å; L11-I13 HydrophobicContact CB-CG1 4.48Å; L11-I13 HydrophobicContact CD2-CG1 3.95Å; L11-I13 HydrophobicContact CG-CG1 4.25Å; L11-I13 PolarHBondContact O-N 3.14Å
12	L	60.7	Low	55	Low	175 Å²	175	132.1 Å²	132.1	92%	0.916	72%	0.715	S	S	*	*			trans	-58.7	89.6	163.9	-86.3	155.4	0	0	0	107.6	F10 S14	F10-L12 PolarHBondContact O-N 3.27Å; L12-S14 PolarHBondContact O-N 3.06Å
13	I	59.8	Low	56.8	Low	127 Å²	127	131.3 Å²	131.3	65%	0.651	71%	0.706	S	S	*	*			trans	-73.3	86.5	168.5	-55.9	173.2	0	0	0	104.8	L11 V15	L11-I13 HydrophobicContact CB-CG1 4.48Å; L11-I13 HydrophobicContact CD2-CG1 3.95Å; L11-I13 HydrophobicContact CG-CG1 4.25Å; L11-I13 PolarHBondContact O-N 3.14Å; I13-V15 HydrophobicContact CG2-CG2 3.59Å; I13-V15 PolarHBondContact O-N 2.91Å
14	S	68.2	Low	59	Low	97 Å²	97	124.9 Å²	124.9	68%	0.678	68%	0.679	S	S	*	*			trans	-67.2	90.3	161.8	55.2	0	0	0	0	106.8	L12 T16	L12-S14 PolarHBondContact O-N 3.06Å; S14-T16 PolarHBondContact O-N 2.83Å
15	V	65.6	Low	61.4	Low	112 Å²	112	122.6 Å²	122.6	68%	0.679	67%	0.671	S	S	*	*			trans	-67.5	91	167.9	-177.3	0	0	0	0	106.3	I13 V17	I13-V15 HydrophobicContact CG2-CG2 3.59Å; I13-V15 PolarHBondContact O-N 2.91Å; V15-V17 HydrophobicContact CG1-CG2 3.91Å; V15-V17 PolarHBondContact O-N 2.74Å
16	T	66	Low	63.8	Low	105 Å²	105	121 Å²	121	64%	0.644	66%	0.66	S	S	*	*			trans	-81.7	97.7	167.7	45.5	0	0	0	0	106.9	S14 I18	S14-T16 PolarHBondContact O-N 2.83Å; T16-I18 VanDerWaalsContact C-N 3.26Å; T16-I18 PolarHBondContact O-N 2.77Å
17	V	62.6	Low	66.3	Low	105 Å²	105	116.7 Å²	116.7	64%	0.636	65%	0.645	S	S	*	*			trans	-73.2	90.4	164.6	-172.3	0	0	0	0	106.1	V15 L19	V15-V17 HydrophobicContact CG1-CG2 3.91Å; V15-V17 PolarHBondContact O-N 2.74Å; V17-L19 VanDerWaalsContact C-N 3.31Å; V17-L19 HydrophobicContact CG1-CD2 3.73Å; V17-L19 HydrophobicContact CG1-CG 3.87Å; V17-L19 PolarHBondContact O-N 3.45Å
18	I	63	Low	69.1	Low	129 Å²	129	114.4 Å²	114.4	66%	0.662	63%	0.632	S	S	*	*			trans	-77.9	90.8	171.3	-46.4	-178.6	0	0	0	106.8	T16 T20	T16-I18 VanDerWaalsContact C-N 3.26Å; T16-I18 PolarHBondContact O-N 2.77Å; I18-T20 VanDerWaalsContact C-N 3.27Å; I18-T20 HydrophobicContact CG2-CG2 3.47Å; I18-T20 VanDerWaalsContact CG2-CG2 3.47Å; I18-T20 PolarHBondContact O-N 3.01Å
19	L	59	Low	71.7	Confident	136 Å²	136	109.1 Å²	109.1	71%	0.712	62%	0.617	S	S	*	*			trans	-71.2	87.1	167.3	-63.3	175.8	0	0	0	107.7	V17 N21	V17-L19 VanDerWaalsContact C-N 3.31Å; V17-L19 HydrophobicContact CG1-CD2 3.73Å; V17-L19 HydrophobicContact CG1-CG 3.87Å; V17-L19 PolarHBondContact O-N 3.45Å; L19-N21 PolarHBondContact O-N 3.1Å
20	T	61.1	Low	73.7	Confident	103 Å²	103	106.7 Å²	106.7	63%	0.632	60%	0.599	S	S	*	*			trans	-83.6	90.2	170.6	57	0	0	0	0	108.7	I18 G22	I18-T20 VanDerWaalsContact C-N 3.27Å; I18-T20 HydrophobicContact CG2-CG2 3.47Å; I18-T20 VanDerWaalsContact CG2-CG2 3.47Å; I18-T20 PolarHBondContact O-N 3.01Å; T20-G22 VanDerWaalsContact C-N 3.3Å; T20-G22 PolarHBondContact O-N 2.84Å
21	N	63.3	Low	75.9	Confident	131 Å²	131	101.8 Å²	101.8	70%	0.701	60%	0.596	S	S	*	*			trans	-78	82	175.7	-70.3	6.9	0	0	0	109.3	L19 E23	L19-N21 PolarHBondContact O-N 3.1Å; N21-E23 PolarHBondContact O-N 3.37Å
22	G	68.3	Low	78	Confident	70 Å²	70	102.6 Å²	102.6	72%	0.722	60%	0.6	S	S	*	*	S	Bend	trans	64	12.4	166.2	0	0	0	0	0	116.8	T20	T20-G22 VanDerWaalsContact C-N 3.3Å; T20-G22 PolarHBondContact O-N 2.84Å
23	E	79.1	Confident	79.6	Confident	139 Å²	139	98 Å²	98	65%	0.65	58%	0.575	S	S	*	*			trans	-75.9	138	176.9	-66.5	-172.7	168.1	0	0	111.6	N21	N21-E23 PolarHBondContact O-N 3.37Å
24	I	88.4	Confident	81.4	Confident	34 Å²	34	96.7 Å²	96.7	17%	0.174	58%	0.584	C	S	.	*			trans	-93.4	113.6	173.2	-55.6	-176.4	0	0	0	107.9	L26 A47 S49 V51 Q111	I24-L26 HydrophobicContact CG2-CD2 4.34Å; I24-A47 HydrophobicContact CG2-CB 4.08Å; I24-S49 WeakPolarHBondContact CG1-OG 3.46Å; I24-V51 HydrophobicContact CD1-CG1 3.62Å; I24-V51 HydrophobicContact CG2-CG1 3.9Å; I24-Q111 HydrophobicContact CB-CG 4.27Å; I24-Q111 HydrophobicContact CG2-CG 4.21Å
25	L	92.7	Very high	82.7	Confident	115 Å²	115	93.8 Å²	93.8	60%	0.602	57%	0.565	S	S	*	*			trans	-82.4	133.8	177.3	-179.5	65.2	0	0	0	109.8	A47 S48	L25-A47 CarbonylContact O-C 3.55Å; L25-A47 WeakPolarHBondContact O-CA 3.4Å; L25-S48 PolarHBondContact N-OG 3.49Å; L25-S48 PolarHBondContact O-N 3.32Å
26	L	95.6	Very high	84.2	Confident	48 Å²	48	91.4 Å²	91.4	25%	0.251	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.3	132.2	174.1	-58.5	-177.7	0	0	0	110.2	I24 S46 A47 M54 Q111	I24-L26 HydrophobicContact CG2-CD2 4.34Å; L26-S46 CarbonylContact C-O 3.57Å; L26-S46 WeakPolarHBondContact CA-O 3.45Å; L26-A47 HydrophobicContact CD2-CB 3.58Å; L26-M54 HydrophobicContact CD1-CE 4.45Å; L26-M54 HydrophobicContact CD2-CE 4Å; L26-Q111 HydrophobicContact CD1-CB 4.34Å; L26-Q111 HydrophobicContact CD1-CG 4.24Å; L26-Q111 HydrophobicContact CD2-CB 4.38Å; L26-Q111 HydrophobicContact CD2-CG 4.3Å
27	T	98	Very high	85.7	Confident	83 Å²	83	91.6 Å²	91.6	51%	0.509	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120.2	122	177.3	-56.9	0	0	0	0	109.6	C45 S46	T27-C45 WeakPolarHBondContact O-CA 3.5Å; T27-S46 PolarHBondContact N-O 2.93Å; T27-S46 PolarHBondContact O-N 2.82Å
28	Q	98.2	Very high	87.4	Confident	66 Å²	66	88.9 Å²	88.9	31%	0.308	55%	0.55	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-101.6	145.1	178.6	-74.4	178.9	-143.6	0	0	112.5	T44 C45 Y107 C109	Q28-T44 VanDerWaalsContact CA-O 3.25Å; Q28-T44 WeakPolarHBondContact CA-O 3.34Å; Q28-C45 HydrophobicContact CG-CB 4.28Å; Q28-Y107 PolarHBondContact NE2-O 3.21Å; Q28-C109 WeakPolarHBondContact CG-SG 3.37Å; Q28-C109 PolarHBondContact OE1-SG 3.25Å
29	S	98.3	Very high	89.1	Confident	64 Å²	64	87 Å²	87	45%	0.448	54%	0.538	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.5	144.2	175.5	-172.5	0	0	0	0	112.5	I43 T44	S29-I43 WeakPolarHBondContact O-CA 3.29Å; S29-T44 PolarHBondContact N-O 3.01Å; S29-T44 PolarHBondContact O-N 2.89Å; S29-T44 PolarHBondContact O-OG1 2.85Å
30	P	97.8	Very high	91	Very high	55 Å²	55	87.1 Å²	87.1	36%	0.357	53%	0.533	S	S	.	.			cis	-71.6	161	-11.8	33.2	-36.5	0	0	0	111.4	I32 I33	P30-I32 VanDerWaalsContact C-N 3.34Å; P30-I33 HydrophobicContact CG-CB 4.04Å; P30-I33 HydrophobicContact CG-CD1 4.32Å; P30-I33 HydrophobicContact CG-CG1 4.45Å
31	A	95.1	Very high	92.7	Very high	104 Å²	104	82.3 Å²	82.3	86%	0.86	50%	0.504	S	S	*	.	S	Bend	trans	-68	-34.4	177.9	0	0	0	0	0	112.7
32	I	96.7	Very high	94.4	Very high	156 Å²	156	78.7 Å²	78.7	80%	0.8	49%	0.486	S	S	*	.	S	Bend	trans	-137.3	137.2	177.3	-58.7	174.6	0	0	0	107.1	P30	P30-I32 VanDerWaalsContact C-N 3.34Å
33	I	95.5	Very high	95.8	Very high	79 Å²	79	76 Å²	76	41%	0.405	46%	0.455	S	S	.	.			trans	-131.2	135.2	173.1	-164.9	166.9	0	0	0	109.5	P30 V41	P30-I33 HydrophobicContact CG-CB 4.04Å; P30-I33 HydrophobicContact CG-CD1 4.32Å; P30-I33 HydrophobicContact CG-CG1 4.45Å; I33-V41 HydrophobicContact CD1-CB 4.34Å; I33-V41 HydrophobicContact CD1-CG1 3.86Å; I33-V41 HydrophobicContact CD1-CG2 3.9Å; I33-V41 HydrophobicContact CG2-CG1 4.13Å
34	A	96.5	Very high	96.8	Very high	100 Å²	100	71.9 Å²	71.9	83%	0.826	44%	0.44	S	S	*	.			trans	-106.5	132.4	166.6	0	0	0	0	0	107.4
35	A	95.8	Very high	97.2	Very high	35 Å²	35	70.3 Å²	70.3	29%	0.289	43%	0.431	S	S	.	.			trans	-143.4	145.8	179.7	0	0	0	0	0	110	E39 V41 M99	A35-E39 VanDerWaalsContact CA-OE2 3.24Å; A35-E39 WeakPolarHBondContact CA-OE2 3.37Å; A35-E39 HydrophobicContact CB-CB 4.38Å; A35-V41 HydrophobicContact CB-CG2 3.39Å; A35-M99 HydrophobicContact CB-CE 4.04Å; A35-M99 HydrophobicContact CB-CG 4.24Å
36	S	97.3	Very high	97.5	Very high	62 Å²	62	67.3 Å²	67.3	43%	0.434	42%	0.42	S	S	.	.			trans	-84.3	155.3	174.7	-44.9	0	0	0	0	110.7	G38 E39	S36-G38 PolarHBondContact O-N 3.06Å; S36-E39 VanDerWaalsContact CB-OE1 3.25Å; S36-E39 WeakPolarHBondContact CB-OE1 3.34Å; S36-E39 VanDerWaalsContact N-CD 3.25Å; S36-E39 PolarHBondContact N-OE2 2.8Å; S36-E39 VanDerWaalsContact O-CB 3.29Å; S36-E39 WeakPolarHBondContact O-CB 3.33Å; S36-E39 PolarHBondContact O-N 3.47Å; S36-E39 PolarHBondContact OG-OE1 2.87Å
37	P	97.7	Very high	97.5	Very high	110 Å²	110	65.6 Å²	65.6	71%	0.714	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53	135.5	172.8	-27	35.5	0	0	0	112.4	E39 M99	P37-E39 VanDerWaalsContact C-N 3.29Å; P37-E39 PolarHBondContact O-N 3.38Å; P37-M99 CarbonylContact C-O 3.53Å; P37-M99 VanDerWaalsContact CA-O 3.28Å; P37-M99 WeakPolarHBondContact CA-O 3.45Å
38	G	98.2	Very high	97.3	Very high	48 Å²	48	65.3 Å²	65.3	50%	0.495	41%	0.414	S	S	.	.	T	Hydrogen-bonded Turn	trans	85.1	-12.6	-176.4	0	0	0	0	0	115.1	S36 M99	S36-G38 PolarHBondContact O-N 3.06Å; G38-M99 PolarHBondContact N-O 3.38Å
39	E	98.4	Very high	97.1	Very high	89 Å²	89	64.5 Å²	64.5	42%	0.416	42%	0.416	S	S	.	.			trans	-72.4	149.3	175.8	-69.2	177.7	-177.6	0	0	111.7	A35 S36 P37 M99	A35-E39 VanDerWaalsContact CA-OE2 3.24Å; A35-E39 WeakPolarHBondContact CA-OE2 3.37Å; A35-E39 HydrophobicContact CB-CB 4.38Å; S36-E39 VanDerWaalsContact CB-OE1 3.25Å; S36-E39 WeakPolarHBondContact CB-OE1 3.34Å; S36-E39 VanDerWaalsContact N-CD 3.25Å; S36-E39 PolarHBondContact N-OE2 2.8Å; S36-E39 VanDerWaalsContact O-CB 3.29Å; S36-E39 WeakPolarHBondContact O-CB 3.33Å; S36-E39 PolarHBondContact O-N 3.47Å; S36-E39 PolarHBondContact OG-OE1 2.87Å; P37-E39 VanDerWaalsContact C-N 3.29Å; P37-E39 PolarHBondContact O-N 3.38Å; E39-M99 WeakPolarHBondContact O-CB 3.48Å; E39-M99 PolarHBondContact O-N 3.21Å
40	K	98.5	Very high	96.8	Very high	138 Å²	138	65.6 Å²	65.6	60%	0.6	42%	0.424	S	S	*	.			trans	-84.8	124.6	173	179.2	176.6	-178.7	176.7	0	110	T95 I96	K40-T95 HydrophobicContact CD-CG2 4.37Å; K40-T95 HydrophobicContact CG-CG2 4.14Å; K40-I96 CarbonylContact C-O 3.56Å; K40-I96 VanDerWaalsContact CA-O 3.32Å; K40-I96 WeakPolarHBondContact CA-O 3.02Å
41	V	98.1	Very high	96.6	Very high	3 Å²	3	63.1 Å²	63.1	2%	0.018	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	138.9	173.5	162.3	0	0	0	0	110.4	I33 A35 I43 T95 I96 M99	I33-V41 HydrophobicContact CD1-CB 4.34Å; I33-V41 HydrophobicContact CD1-CG1 3.86Å; I33-V41 HydrophobicContact CD1-CG2 3.9Å; I33-V41 HydrophobicContact CG2-CG1 4.13Å; A35-V41 HydrophobicContact CB-CG2 3.39Å; V41-I43 HydrophobicContact CG1-CG1 4.3Å; V41-T95 CarbonylContact O-C 3.6Å; V41-T95 VanDerWaalsContact O-CA 3.28Å; V41-T95 WeakPolarHBondContact O-CA 3.32Å; V41-I96 HydrophobicContact CB-CB 4.34Å; V41-I96 HydrophobicContact CG1-CD1 4.47Å; V41-I96 PolarHBondContact N-O 3.05Å; V41-I96 PolarHBondContact O-N 3.28Å; V41-M99 HydrophobicContact CB-CE 3.8Å; V41-M99 HydrophobicContact CG1-CE 4.21Å; V41-M99 HydrophobicContact CG2-CE 3.35Å
42	T	98.5	Very high	96.4	Very high	54 Å²	54	61.9 Å²	61.9	33%	0.331	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	128.3	171.7	-60.8	0	0	0	0	109.8	F94 T95	T42-F94 CarbonylContact C-O 3.51Å; T42-F94 VanDerWaalsContact CA-O 3.29Å; T42-F94 WeakPolarHBondContact CA-O 3.19Å; T42-T95 PolarHBondContact OG1-OG1 3.02Å
43	I	98.4	Very high	96.1	Very high	14 Å²	14	60.8 Å²	60.8	7%	0.072	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	132.9	173.5	-54.6	173.1	0	0	0	106.7	S29 V41 W56 S93 F94 Y107	S29-I43 WeakPolarHBondContact O-CA 3.29Å; V41-I43 HydrophobicContact CG1-CG1 4.3Å; I43-W56 HydrophobicContact CB-CH2 4.38Å; I43-W56 HydrophobicContact CB-CZ3 4.33Å; I43-W56 HydrophobicContact CG2-CH2 4.08Å; I43-W56 HydrophobicContact CG2-CZ3 3.96Å; I43-S93 CarbonylContact O-C 3.53Å; I43-S93 VanDerWaalsContact O-CA 3.25Å; I43-S93 WeakPolarHBondContact O-CA 3.28Å; I43-F94 HydrophobicContact CB-CB 4.44Å; I43-F94 HydrophobicContact CD1-CD1 4.12Å; I43-F94 PolarHBondContact N-O 2.84Å; I43-F94 PolarHBondContact O-N 2.82Å; I43-Y107 HydrophobicContact CD1-CD2 4.17Å; I43-Y107 HydrophobicContact CD1-CG 4.26Å
44	T	98.5	Very high	96.1	Very high	53 Å²	53	57 Å²	57	33%	0.325	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	151	174.4	60.6	0	0	0	0	110.7	Q28 S29 F92	Q28-T44 VanDerWaalsContact CA-O 3.25Å; Q28-T44 WeakPolarHBondContact CA-O 3.34Å; S29-T44 PolarHBondContact N-O 3.01Å; S29-T44 PolarHBondContact O-N 2.89Å; S29-T44 PolarHBondContact O-OG1 2.85Å; T44-F92 CarbonylContact C-O 3.54Å; T44-F92 VanDerWaalsContact CA-O 3.31Å; T44-F92 WeakPolarHBondContact CA-O 3.28Å
45	C	98.3	Very high	96.2	Very high	0 Å²	0	52.8 Å²	52.8	0%	0	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	115.7	172.3	177.3	0	0	0	0	108.7	T27 Q28 W56 F92 C109	T27-C45 WeakPolarHBondContact O-CA 3.5Å; Q28-C45 HydrophobicContact CG-CB 4.28Å; C45-W56 HydrophobicContact CB-CH2 3.58Å; C45-W56 HydrophobicContact CB-CZ2 3.74Å; C45-F92 HydrophobicContact CB-CB 4.45Å; C45-F92 PolarHBondContact N-O 3.37Å; C45-F92 PolarHBondContact O-N 3.07Å; C45-C109 HydrophobicContact CB-CB 3.48Å; C45-C109 VanDerWaalsContact CB-CB 3.48Å; C45-C109 WeakPolarHBondContact CB-SG 3.26Å; C45-C109 WeakPolarHBondContact SG-CB 3.45Å; C45-C109 CovalentContact SG-SG 2.03Å; C45-C109 PolarHBondContact SG-SG 2.89Å
46	S	98.1	Very high	96.3	Very high	53 Å²	53	51.1 Å²	51.1	37%	0.371	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	129.4	178.3	-61.5	0	0	0	0	110	L26 T27 T90	L26-S46 CarbonylContact C-O 3.57Å; L26-S46 WeakPolarHBondContact CA-O 3.45Å; T27-S46 PolarHBondContact N-O 2.93Å; T27-S46 PolarHBondContact O-N 2.82Å; S46-T90 CarbonylContact C-O 3.5Å; S46-T90 VanDerWaalsContact CA-O 3.26Å; S46-T90 WeakPolarHBondContact CA-O 3.42Å
47	A	95.7	Very high	96.3	Very high	11 Å²	11	51.1 Å²	51.1	9%	0.091	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	142.9	174.8	0	0	0	0	0	111	I24 L25 L26 S49 V51 T90	I24-A47 HydrophobicContact CG2-CB 4.08Å; L25-A47 CarbonylContact O-C 3.55Å; L25-A47 WeakPolarHBondContact O-CA 3.4Å; L26-A47 HydrophobicContact CD2-CB 3.58Å; A47-S49 VanDerWaalsContact CB-O 3.26Å; A47-S49 WeakPolarHBondContact CB-O 3.37Å; A47-S49 PolarHBondContact O-N 2.83Å; A47-V51 HydrophobicContact CB-CG1 4.28Å; A47-V51 HydrophobicContact CB-CG2 4.33Å; A47-T90 PolarHBondContact N-O 2.89Å; A47-T90 WeakPolarHBondContact O-CB 3.25Å
48	S	94.4	Very high	96.4	Very high	77 Å²	77	46.6 Å²	46.6	54%	0.538	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67	-16.9	177	62	0	0	0	0	113.8	L25	L25-S48 PolarHBondContact N-OG 3.49Å; L25-S48 PolarHBondContact O-N 3.32Å
49	S	93	Very high	96.4	Very high	49 Å²	49	46.9 Å²	46.9	34%	0.343	26%	0.258	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147	166.5	174.7	66.1	0	0	0	0	110.4	I24 A47 V51	I24-S49 WeakPolarHBondContact CG1-OG 3.46Å; A47-S49 VanDerWaalsContact CB-O 3.26Å; A47-S49 WeakPolarHBondContact CB-O 3.37Å; A47-S49 PolarHBondContact O-N 2.83Å; S49-V51 PolarHBondContact O-N 2.88Å
50	S	93.4	Very high	96.3	Very high	88 Å²	88	46.5 Å²	46.5	62%	0.615	26%	0.255	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.2	128.2	-177.6	-173.1	0	0	0	0	111.3	G89	S50-G89 WeakPolarHBondContact CA-O 3.29Å; S50-G89 WeakPolarHBondContact OG-CA 3.27Å
51	V	92.5	Very high	96.2	Very high	3 Å²	3	45.5 Å²	45.5	2%	0.018	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	145.5	174.2	-58.5	0	0	0	0	111.1	I24 A47 S49 M54 G89 F92 Q111 S113	I24-V51 HydrophobicContact CD1-CG1 3.62Å; I24-V51 HydrophobicContact CG2-CG1 3.9Å; A47-V51 HydrophobicContact CB-CG1 4.28Å; A47-V51 HydrophobicContact CB-CG2 4.33Å; S49-V51 PolarHBondContact O-N 2.88Å; V51-M54 HydrophobicContact CG2-CE 4.08Å; V51-G89 PolarHBondContact N-O 2.87Å; V51-F92 HydrophobicContact CG2-CD2 4.45Å; V51-F92 HydrophobicContact CG2-CE2 3.36Å; V51-F92 HydrophobicContact CG2-CZ 3.46Å; V51-F92 VanDerWaalsContact CG2-CZ 3.46Å; V51-Q111 HydrophobicContact CB-CB 4.03Å; V51-Q111 HydrophobicContact CG1-CB 3.74Å; V51-Q111 HydrophobicContact CG1-CG 4.08Å; V51-Q111 HydrophobicContact CG2-CB 4.09Å; V51-S113 WeakPolarHBondContact CA-OG 3.42Å
52	S	90.7	Very high	96.1	Very high	77 Å²	77	49.9 Å²	49.9	54%	0.538	31%	0.308	S	S	.	.	S	Bend	trans	-86.8	-25.6	-177.5	-47.9	0	0	0	0	112.7	S113	S52-S113 PolarHBondContact N-OG 3.06Å
53	Y	91.5	Very high	96.1	Very high	133 Å²	133	50 Å²	50	52%	0.522	31%	0.312	S	S	.	.			trans	-138.5	128.7	-176.7	-60.4	-73	0	0	0	110.2	Q111 R112	Y53-Q111 VanDerWaalsContact O-CA 3.32Å; Y53-Q111 WeakPolarHBondContact O-CA 3.38Å; Y53-R112 PolarHBondContact O-N 2.73Å; Y53-R112 VanDerWaalsContact O-N 3.14Å
54	M	95.7	Very high	96	Very high	0 Å²	0	53.2 Å²	53.2	0%	0	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	128.9	170.5	-173.2	59.2	72.8	0	0	109.3	L26 V51 I72 F92 C109 Q110 Q111	L26-M54 HydrophobicContact CD1-CE 4.45Å; L26-M54 HydrophobicContact CD2-CE 4Å; V51-M54 HydrophobicContact CG2-CE 4.08Å; M54-I72 HydrophobicContact CB-CG1 4.36Å; M54-I72 WeakPolarHBondContact O-CA 3.24Å; M54-I72 PolarHBondContact O-N 2.84Å; M54-F92 HydrophobicContact CB-CB 4.4Å; M54-F92 HydrophobicContact CB-CD1 3.48Å; M54-F92 VanDerWaalsContact CB-CD1 3.48Å; M54-F92 HydrophobicContact CB-CD2 4.27Å; M54-F92 HydrophobicContact CB-CE1 3.73Å; M54-F92 HydrophobicContact CB-CE2 4.5Å; M54-F92 HydrophobicContact CB-CG 3.77Å; M54-F92 HydrophobicContact CB-CZ 4.25Å; M54-F92 HydrophobicContact CE-CB 4.42Å; M54-F92 HydrophobicContact CE-CD2 3.38Å; M54-F92 HydrophobicContact CE-CE2 3.75Å; M54-F92 HydrophobicContact CE-CG 3.9Å; M54-F92 HydrophobicContact CG-CB 3.96Å; M54-F92 HydrophobicContact CG-CD1 4Å; M54-F92 HydrophobicContact CG-CD2 4.27Å; M54-F92 HydrophobicContact CG-CG 3.79Å; M54-C109 HydrophobicContact CG-CB 4.46Å; M54-C109 HydrophobicContact SD-CB 3.65Å; M54-Q110 VanDerWaalsContact SD-C 3.6Å; M54-Q111 HydrophobicContact CE-CB 4.45Å
55	N	97.1	Very high	96	Very high	11 Å²	11	53.8 Å²	53.8	6%	0.059	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	151.7	173.2	-57	-38.6	0	0	0	109.1	Y57 I69 Y70 G71 C109 Q110	N55-Y57 HydrophobicContact CB-CE2 3.81Å; N55-I69 CarbonylContact C-O 3.57Å; N55-I69 VanDerWaalsContact CA-O 3.3Å; N55-I69 WeakPolarHBondContact CA-O 3.47Å; N55-Y70 VanDerWaalsContact OD1-CA 3.28Å; N55-Y70 WeakPolarHBondContact OD1-CA 3.43Å; N55-G71 PolarHBondContact OD1-N 2.8Å; N55-C109 CarbonylContact O-C 3.51Å; N55-C109 VanDerWaalsContact O-CA 3.29Å; N55-C109 WeakPolarHBondContact O-CA 3.4Å; N55-Q110 PolarHBondContact N-O 2.94Å; N55-Q110 PolarHBondContact ND2-OE1 2.89Å; N55-Q110 PolarHBondContact O-N 2.9Å
56	W	98.2	Very high	95.9	Very high	1 Å²	1	60.1 Å²	60.1	0%	0.004	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	136.2	173.4	-65.7	89.6	0	0	0	109.9	I43 C45 W68 I69 F94 Y108 C109	I43-W56 HydrophobicContact CB-CH2 4.38Å; I43-W56 HydrophobicContact CB-CZ3 4.33Å; I43-W56 HydrophobicContact CG2-CH2 4.08Å; I43-W56 HydrophobicContact CG2-CZ3 3.96Å; C45-W56 HydrophobicContact CB-CH2 3.58Å; C45-W56 HydrophobicContact CB-CZ2 3.74Å; W56-W68 WeakPolarHBondContact O-CA 3.29Å; W56-W68 WeakPolarHBondContact O-CB 3.3Å; W56-W68 PolarHBondContact O-N 3.2Å; W56-I69 HydrophobicContact CB-CB 4.11Å; W56-I69 PolarHBondContact N-O 3.06Å; W56-I69 PolarHBondContact O-N 3.18Å; W56-I69 VanDerWaalsContact O-N 3.12Å; W56-F94 HydrophobicContact CB-CD2 3.99Å; W56-F94 HydrophobicContact CB-CE2 4.35Å; W56-F94 HydrophobicContact CD2-CB 3.53Å; W56-F94 HydrophobicContact CD2-CD2 4.03Å; W56-F94 HydrophobicContact CD2-CG 4.03Å; W56-F94 HydrophobicContact CE3-CB 3.63Å; W56-F94 HydrophobicContact CE3-CD2 4.38Å; W56-F94 HydrophobicContact CE3-CG 4.05Å; W56-F94 HydrophobicContact CG-CB 4.17Å; W56-F94 AromaticContact CG-CD2 3.83Å; W56-F94 HydrophobicContact CG-CD2 3.83Å; W56-F94 HydrophobicContact CG-CG 4.33Å; W56-F94 HydrophobicContact CH2-CB 3.66Å; W56-F94 HydrophobicContact CZ2-CB 3.59Å; W56-F94 HydrophobicContact CZ3-CB 3.69Å; W56-F94 HydrophobicContact CZ3-CG 4.44Å; W56-Y108 CarbonylContact C-O 3.54Å; W56-Y108 VanDerWaalsContact CA-O 3.27Å; W56-Y108 WeakPolarHBondContact CA-O 3.36Å; W56-C109 HydrophobicContact CD2-CB 4.1Å; W56-C109 HydrophobicContact CE3-CB 3.9Å; W56-C109 HydrophobicContact CH2-CB 3.91Å; W56-C109 HydrophobicContact CZ2-CB 4.07Å; W56-C109 HydrophobicContact CZ3-CB 3.81Å
57	Y	98.3	Very high	95.9	Very high	62 Å²	62	61 Å²	61	24%	0.243	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	142.5	178.5	-65.6	-101.9	0	0	0	109.7	N55 P65 K66 I67 Y107 Y108 Q110	N55-Y57 HydrophobicContact CB-CE2 3.81Å; Y57-P65 HydrophobicContact CD1-CB 4.4Å; Y57-K66 CarbonylContact C-O 3.57Å; Y57-K66 WeakPolarHBondContact CA-O 3.25Å; Y57-I67 HydrophobicContact CD1-CB 4.16Å; Y57-I67 HydrophobicContact CE1-CB 3.87Å; Y57-I67 HydrophobicContact CE1-CG1 4.24Å; Y57-Y107 CarbonylContact O-C 3.51Å; Y57-Y107 VanDerWaalsContact O-CA 3.24Å; Y57-Y107 WeakPolarHBondContact O-CA 3.33Å; Y57-Y108 PolarHBondContact N-O 2.99Å; Y57-Y108 PolarHBondContact O-N 3.31Å; Y57-Q110 HydrophobicContact CD2-CB 4.29Å; Y57-Q110 HydrophobicContact CE2-CB 3.83Å; Y57-Q110 HydrophobicContact CE2-CG 4.4Å; Y57-Q110 PolarHBondContact OH-OE1 2.92Å
58	Q	98.2	Very high	96	Very high	14 Å²	14	62.3 Å²	62.3	7%	0.065	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	134.9	169.5	-174.2	-169.8	71	0	0	109	P65 K66 W68 A105 Y107	Q58-P65 WeakPolarHBondContact O-CA 3.24Å; Q58-K66 PolarHBondContact N-O 2.96Å; Q58-K66 PolarHBondContact O-N 3.12Å; Q58-W68 HydrophobicContact CB-CB 4.35Å; Q58-W68 HydrophobicContact CB-CD2 3.94Å; Q58-W68 HydrophobicContact CB-CE3 3.83Å; Q58-W68 HydrophobicContact CB-CG 4.2Å; Q58-W68 HydrophobicContact CB-CZ3 4.47Å; Q58-W68 VanDerWaalsContact OE1-CZ3 3.31Å; Q58-A105 HydrophobicContact CG-CB 3.47Å; Q58-A105 VanDerWaalsContact CG-CB 3.47Å; Q58-Y107 HydrophobicContact CB-CD1 4.09Å; Q58-Y107 HydrophobicContact CB-CE1 3.83Å; Q58-Y107 HydrophobicContact CG-CD1 4.24Å; Q58-Y107 HydrophobicContact CG-CE1 3.67Å; Q58-Y107 PolarHBondContact NE2-OH 3.04Å
59	Q	98.3	Very high	96.2	Very high	54 Å²	54	58.7 Å²	58.7	25%	0.252	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	112.6	171.7	-170.8	176	17.5	0	0	110.2	S63 P65 A105 T106 Y108	Q59-S63 VanDerWaalsContact CG-O 3.27Å; Q59-S63 WeakPolarHBondContact CG-O 3.32Å; Q59-S63 PolarHBondContact NE2-O 2.88Å; Q59-P65 HydrophobicContact CB-CB 4.42Å; Q59-P65 HydrophobicContact CB-CG 4.29Å; Q59-P65 HydrophobicContact CG-CG 4.19Å; Q59-A105 WeakPolarHBondContact O-CB 3.33Å; Q59-T106 PolarHBondContact N-O 3.5Å; Q59-T106 PolarHBondContact O-N 2.88Å; Q59-Y108 HydrophobicContact CB-CD2 4.46Å; Q59-Y108 HydrophobicContact CB-CE2 3.81Å; Q59-Y108 VanDerWaalsContact OE1-CE2 3.3Å; Q59-Y108 PolarHBondContact OE1-OH 3.01Å
60	K	97	Very high	96.4	Very high	81 Å²	81	61.6 Å²	61.6	35%	0.352	35%	0.348	S	S	.	.			trans	-79.5	152.6	169.3	-65.5	-168.1	175.3	-164.2	0	110.2	G62 S63 E102 A105	K60-G62 PolarHBondContact O-N 2.89Å; K60-S63 WeakPolarHBondContact O-CB 3.42Å; K60-S63 PolarHBondContact O-N 3.4Å; K60-E102 VanDerWaalsContact CE-O 3.28Å; K60-E102 WeakPolarHBondContact CE-O 3.33Å; K60-E102 PolarHBondContact NZ-O 2.79Å; K60-A105 HydrophobicContact CG-CB 4.19Å
61	P	96.3	Very high	96.5	Very high	118 Å²	118	58.3 Å²	58.3	77%	0.766	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.7	131.2	175.9	-27.8	35.4	0	0	0	112.1	S63	P61-S63 PolarHBondContact O-N 2.78Å
62	G	96.8	Very high	96.6	Very high	94 Å²	94	59.9 Å²	59.9	97%	0.969	34%	0.337	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.1	2.1	-179.9	0	0	0	0	0	115.9	K60	K60-G62 PolarHBondContact O-N 2.89Å
63	S	96.9	Very high	96.9	Very high	57 Å²	57	59.6 Å²	59.6	40%	0.399	34%	0.335	S	S	.	.	S	Bend	trans	-106.1	158.8	177.1	-61.4	0	0	0	0	111.8	Q59 K60 P61	Q59-S63 VanDerWaalsContact CG-O 3.27Å; Q59-S63 WeakPolarHBondContact CG-O 3.32Å; Q59-S63 PolarHBondContact NE2-O 2.88Å; K60-S63 WeakPolarHBondContact O-CB 3.42Å; K60-S63 PolarHBondContact O-N 3.4Å; P61-S63 PolarHBondContact O-N 2.78Å
64	S	97	Very high	97.3	Very high	81 Å²	81	56.9 Å²	56.9	57%	0.566	33%	0.329	S	S	*	.			trans	-72.5	150.6	168.5	61.7	0	0	0	0	111	K66	S64-K66 PolarHBondContact O-N 2.93Å
65	P	97.7	Very high	97.4	Very high	65 Å²	65	59.8 Å²	59.8	42%	0.422	34%	0.344	S	S	.	.			trans	-56.8	138.9	170.3	-23	33.4	0	0	0	111.5	Y57 Q58 Q59	Y57-P65 HydrophobicContact CD1-CB 4.4Å; Q58-P65 WeakPolarHBondContact O-CA 3.24Å; Q59-P65 HydrophobicContact CB-CB 4.42Å; Q59-P65 HydrophobicContact CB-CG 4.29Å; Q59-P65 HydrophobicContact CG-CG 4.19Å
66	K	97.9	Very high	97.5	Very high	133 Å²	133	59.9 Å²	59.9	58%	0.578	35%	0.347	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.6	140.2	174.8	-65.8	-178	-178.2	179.6	0	109.5	Y57 Q58 S64 W68	Y57-K66 CarbonylContact C-O 3.57Å; Y57-K66 WeakPolarHBondContact CA-O 3.25Å; Q58-K66 PolarHBondContact N-O 2.96Å; Q58-K66 PolarHBondContact O-N 3.12Å; S64-K66 PolarHBondContact O-N 2.93Å; K66-W68 PolarHBondContact O-N 3.35Å
67	I	97.5	Very high	97.5	Very high	72 Å²	72	66.1 Å²	66.1	37%	0.369	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.6	132.3	175.7	-163.2	163.3	0	0	0	109.6	Y57 A76	Y57-I67 HydrophobicContact CD1-CB 4.16Å; Y57-I67 HydrophobicContact CE1-CB 3.87Å; Y57-I67 HydrophobicContact CE1-CG1 4.24Å; I67-A76 HydrophobicContact CG2-CB 4.12Å; I67-A76 WeakPolarHBondContact O-CB 3.28Å
68	W	98	Very high	97.4	Very high	39 Å²	39	66.8 Å²	66.8	15%	0.148	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	-45.3	-175.4	-151.9	-106.5	0	0	0	110.8	W56 Q58 K66 A76 V79 F83 F94	W56-W68 WeakPolarHBondContact O-CA 3.29Å; W56-W68 WeakPolarHBondContact O-CB 3.3Å; W56-W68 PolarHBondContact O-N 3.2Å; Q58-W68 HydrophobicContact CB-CB 4.35Å; Q58-W68 HydrophobicContact CB-CD2 3.94Å; Q58-W68 HydrophobicContact CB-CE3 3.83Å; Q58-W68 HydrophobicContact CB-CG 4.2Å; Q58-W68 HydrophobicContact CB-CZ3 4.47Å; Q58-W68 VanDerWaalsContact OE1-CZ3 3.31Å; K66-W68 PolarHBondContact O-N 3.35Å; W68-A76 WeakPolarHBondContact O-CB 3.3Å; W68-A76 PolarHBondContact O-N 3.19Å; W68-V79 HydrophobicContact CD2-CB 4.48Å; W68-V79 HydrophobicContact CD2-CG1 4.11Å; W68-V79 HydrophobicContact CD2-CG2 3.55Å; W68-V79 HydrophobicContact CE3-CG2 3.68Å; W68-V79 HydrophobicContact CG-CG1 4.2Å; W68-V79 HydrophobicContact CG-CG2 4Å; W68-V79 HydrophobicContact CH2-CG2 4.2Å; W68-V79 HydrophobicContact CZ2-CB 4.49Å; W68-V79 HydrophobicContact CZ2-CG1 4.07Å; W68-V79 HydrophobicContact CZ2-CG2 4.1Å; W68-V79 HydrophobicContact CZ3-CG2 4.01Å; W68-F83 AromaticContact CD1-CD1 3.89Å; W68-F83 HydrophobicContact CZ2-CD2 4.36Å; W68-F83 AromaticContact CZ2-CE2 3.84Å; W68-F83 HydrophobicContact CZ2-CE2 3.84Å; W68-F83 AromaticContact CZ2-CZ 3.93Å; W68-F83 HydrophobicContact CZ2-CZ 3.93Å; W68-F83 AromaticContact NE1-CD1 3.29Å; W68-F83 VanDerWaalsContact NE1-CD1 3.29Å; W68-F83 AromaticContact NE1-CD2 3.55Å; W68-F83 AromaticContact NE1-CE1 3.35Å; W68-F83 VanDerWaalsContact NE1-CE1 3.35Å; W68-F83 AromaticContact NE1-CE2 3.65Å; W68-F83 AromaticContact NE1-CG 3.37Å; W68-F83 AromaticContact NE1-CZ 3.52Å; W68-F94 AromaticContact CD1-CE2 3.75Å; W68-F94 AromaticContact CD1-CZ 3.76Å
69	I	98.4	Very high	97.4	Very high	0 Å²	0	66.9 Å²	66.9	0%	0	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131	138.5	171	-57.7	-171.6	0	0	0	108.5	N55 W56 I72 N74 L75 S84 G85 F94	N55-I69 CarbonylContact C-O 3.57Å; N55-I69 VanDerWaalsContact CA-O 3.3Å; N55-I69 WeakPolarHBondContact CA-O 3.47Å; W56-I69 HydrophobicContact CB-CB 4.11Å; W56-I69 PolarHBondContact N-O 3.06Å; W56-I69 PolarHBondContact O-N 3.18Å; W56-I69 VanDerWaalsContact O-N 3.12Å; I69-I72 WeakPolarHBondContact CG2-O 3.45Å; I69-N74 CarbonylContact C-O 3.49Å; I69-N74 VanDerWaalsContact CA-O 3.24Å; I69-N74 WeakPolarHBondContact CA-O 3.19Å; I69-N74 WeakPolarHBondContact CG2-O 3.48Å; I69-L75 HydrophobicContact CD1-CD2 3.95Å; I69-L75 HydrophobicContact CG1-CD2 3.87Å; I69-S84 WeakPolarHBondContact CD1-O 3.27Å; I69-G85 VanDerWaalsContact CD1-N 3.3Å; I69-F94 HydrophobicContact CD1-CD2 3.68Å; I69-F94 HydrophobicContact CD1-CE2 3.66Å; I69-F94 HydrophobicContact CG1-CD2 4.34Å; I69-F94 HydrophobicContact CG1-CE2 4.06Å
70	Y	96.7	Very high	97.4	Very high	110 Å²	110	66.4 Å²	66.4	43%	0.431	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	150.4	178	70.1	-88.3	0	0	0	111.9	N55 I72 N74	N55-Y70 VanDerWaalsContact OD1-CA 3.28Å; N55-Y70 WeakPolarHBondContact OD1-CA 3.43Å; Y70-I72 VanDerWaalsContact C-N 3.3Å; Y70-I72 PolarHBondContact O-N 2.78Å; Y70-N74 HydrophobicContact CD1-CB 3.95Å; Y70-N74 WeakPolarHBondContact CD1-O 3.24Å; Y70-N74 HydrophobicContact CD2-CB 3.96Å; Y70-N74 HydrophobicContact CE1-CB 3.59Å; Y70-N74 HydrophobicContact CE2-CB 3.59Å; Y70-N74 HydrophobicContact CG-CB 4.13Å; Y70-N74 PolarHBondContact N-O 2.82Å; Y70-N74 VanDerWaalsContact O-CB 3.3Å; Y70-N74 WeakPolarHBondContact O-CB 3.47Å; Y70-N74 PolarHBondContact O-N 3.11Å; Y70-N74 PolarHBondContact O-ND2 2.83Å
71	G	94.9	Very high	97.5	Very high	20 Å²	20	66.9 Å²	66.9	21%	0.206	44%	0.438	C	S	.	.	T	Hydrogen-bonded Turn	trans	56.9	44.5	178	0	0	0	0	0	112.8	N55 S73	N55-G71 PolarHBondContact OD1-N 2.8Å; G71-S73 VanDerWaalsContact C-N 3.3Å; G71-S73 PolarHBondContact O-N 2.93Å; G71-S73 VanDerWaalsContact O-N 3.11Å
72	I	96	Very high	97.6	Very high	36 Å²	36	63.2 Å²	63.2	19%	0.185	41%	0.409	C	S	.	.	T	Hydrogen-bonded Turn	trans	79.1	-52.4	179.3	-54.7	170.9	0	0	0	114.3	M54 I69 Y70 G85 G87 F92	M54-I72 HydrophobicContact CB-CG1 4.36Å; M54-I72 WeakPolarHBondContact O-CA 3.24Å; M54-I72 PolarHBondContact O-N 2.84Å; I69-I72 WeakPolarHBondContact CG2-O 3.45Å; Y70-I72 VanDerWaalsContact C-N 3.3Å; Y70-I72 PolarHBondContact O-N 2.78Å; I72-G85 CarbonylContact O-C 3.51Å; I72-G85 VanDerWaalsContact O-CA 3.23Å; I72-G85 WeakPolarHBondContact O-CA 3.48Å; I72-G87 WeakPolarHBondContact CG2-O 3.36Å; I72-F92 HydrophobicContact CD1-CE1 4.05Å; I72-F92 HydrophobicContact CG1-CD1 4.43Å; I72-F92 HydrophobicContact CG1-CE1 3.99Å; I72-F92 HydrophobicContact CG2-CD1 4.4Å
73	S	97.5	Very high	97.7	Very high	71 Å²	71	58.9 Å²	58.9	50%	0.497	36%	0.364	S	S	.	.	T	Hydrogen-bonded Turn	trans	-134.3	-5.4	-167.4	59.2	0	0	0	0	115.8	G71 G85	G71-S73 VanDerWaalsContact C-N 3.3Å; G71-S73 PolarHBondContact O-N 2.93Å; G71-S73 VanDerWaalsContact O-N 3.11Å; S73-G85 VanDerWaalsContact CB-O 3.31Å; S73-G85 WeakPolarHBondContact CB-O 3.49Å
74	N	98.1	Very high	97.7	Very high	76 Å²	76	58.3 Å²	58.3	41%	0.406	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.1	126.2	-177.8	-54.1	-69.1	0	0	0	111	I69 Y70	I69-N74 CarbonylContact C-O 3.49Å; I69-N74 VanDerWaalsContact CA-O 3.24Å; I69-N74 WeakPolarHBondContact CA-O 3.19Å; I69-N74 WeakPolarHBondContact CG2-O 3.48Å; Y70-N74 HydrophobicContact CD1-CB 3.95Å; Y70-N74 WeakPolarHBondContact CD1-O 3.24Å; Y70-N74 HydrophobicContact CD2-CB 3.96Å; Y70-N74 HydrophobicContact CE1-CB 3.59Å; Y70-N74 HydrophobicContact CE2-CB 3.59Å; Y70-N74 HydrophobicContact CG-CB 4.13Å; Y70-N74 PolarHBondContact N-O 2.82Å; Y70-N74 VanDerWaalsContact O-CB 3.3Å; Y70-N74 WeakPolarHBondContact O-CB 3.47Å; Y70-N74 PolarHBondContact O-N 3.11Å; Y70-N74 PolarHBondContact O-ND2 2.83Å
75	L	98.6	Very high	97.8	Very high	60 Å²	60	54.8 Å²	54.8	31%	0.314	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	135.2	175.5	-64.3	169.7	0	0	0	110.4	I69 V79 F83	I69-L75 HydrophobicContact CD1-CD2 3.95Å; I69-L75 HydrophobicContact CG1-CD2 3.87Å; L75-V79 HydrophobicContact CB-CB 4.24Å; L75-V79 HydrophobicContact CB-CG1 4.39Å; L75-V79 HydrophobicContact CD2-CB 4.39Å; L75-V79 HydrophobicContact CD2-CG1 3.62Å; L75-V79 HydrophobicContact CG-CG1 4.47Å; L75-F83 HydrophobicContact CD2-CB 3.83Å; L75-F83 WeakPolarHBondContact CD2-O 3.3Å
76	A	98.3	Very high	97.8	Very high	14 Å²	14	54.2 Å²	54.2	12%	0.116	33%	0.334	C	S	.	.	P	Polyproline II helix	trans	-66.3	160.9	170.2	0	0	0	0	0	111	I67 W68 G78 V79	I67-A76 HydrophobicContact CG2-CB 4.12Å; I67-A76 WeakPolarHBondContact O-CB 3.28Å; W68-A76 WeakPolarHBondContact O-CB 3.3Å; W68-A76 PolarHBondContact O-N 3.19Å; A76-G78 PolarHBondContact O-N 2.71Å; A76-V79 HydrophobicContact CB-CG2 3.93Å; A76-V79 WeakPolarHBondContact O-CB 3.31Å; A76-V79 WeakPolarHBondContact O-CG2 3.23Å; A76-V79 PolarHBondContact O-N 3.3Å; A76-V79 VanDerWaalsContact O-N 3.1Å
77	S	98	Very high	97.8	Very high	132 Å²	132	49.6 Å²	49.6	92%	0.923	32%	0.324	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.5	132.8	179.8	-170.5	0	0	0	0	111.6	V79	S77-V79 VanDerWaalsContact C-N 3.27Å; S77-V79 PolarHBondContact O-N 3.13Å
78	G	97.6	Very high	97.8	Very high	75 Å²	75	50.3 Å²	50.3	77%	0.773	34%	0.335	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.3	-2.4	-178.6	0	0	0	0	0	115.1	A76 P80	A76-G78 PolarHBondContact O-N 2.71Å; G78-P80 WeakPolarHBondContact O-CD 3.32Å
79	V	98.2	Very high	97.7	Very high	17 Å²	17	49.5 Å²	49.5	10%	0.103	34%	0.339	C	S	.	.			trans	-77.3	126.2	175.8	176.5	0	0	0	0	110.2	W68 L75 A76 S77 F83	W68-V79 HydrophobicContact CD2-CB 4.48Å; W68-V79 HydrophobicContact CD2-CG1 4.11Å; W68-V79 HydrophobicContact CD2-CG2 3.55Å; W68-V79 HydrophobicContact CE3-CG2 3.68Å; W68-V79 HydrophobicContact CG-CG1 4.2Å; W68-V79 HydrophobicContact CG-CG2 4Å; W68-V79 HydrophobicContact CH2-CG2 4.2Å; W68-V79 HydrophobicContact CZ2-CB 4.49Å; W68-V79 HydrophobicContact CZ2-CG1 4.07Å; W68-V79 HydrophobicContact CZ2-CG2 4.1Å; W68-V79 HydrophobicContact CZ3-CG2 4.01Å; L75-V79 HydrophobicContact CB-CB 4.24Å; L75-V79 HydrophobicContact CB-CG1 4.39Å; L75-V79 HydrophobicContact CD2-CB 4.39Å; L75-V79 HydrophobicContact CD2-CG1 3.62Å; L75-V79 HydrophobicContact CG-CG1 4.47Å; A76-V79 HydrophobicContact CB-CG2 3.93Å; A76-V79 WeakPolarHBondContact O-CB 3.31Å; A76-V79 WeakPolarHBondContact O-CG2 3.23Å; A76-V79 PolarHBondContact O-N 3.3Å; A76-V79 VanDerWaalsContact O-N 3.1Å; S77-V79 VanDerWaalsContact C-N 3.27Å; S77-V79 PolarHBondContact O-N 3.13Å; V79-F83 HydrophobicContact CG1-CB 3.96Å; V79-F83 HydrophobicContact CG1-CD2 3.81Å; V79-F83 HydrophobicContact CG1-CG 4.07Å
80	P	98.3	Very high	97.6	Very high	43 Å²	43	52.9 Å²	52.9	28%	0.279	36%	0.36	S	S	.	.			trans	-62.5	149.8	-179.6	-25.7	35.5	0	0	0	114.1	G78 R82 F83	G78-P80 WeakPolarHBondContact O-CD 3.32Å; P80-R82 HydrophobicContact CB-CG 4.1Å; P80-R82 PolarHBondContact O-N 3.22Å; P80-F83 HydrophobicContact CB-CD2 4.09Å; P80-F83 HydrophobicContact CB-CE2 4.21Å; P80-F83 HydrophobicContact CG-CD2 4.32Å; P80-F83 HydrophobicContact CG-CE2 4.07Å; P80-F83 WeakPolarHBondContact O-CD2 3.44Å; P80-F83 PolarHBondContact O-N 2.93Å; P80-F83 VanDerWaalsContact O-N 3.14Å
81	A	98.3	Very high	97.7	Very high	91 Å²	91	50.8 Å²	50.8	75%	0.752	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.4	-9.6	-179.7	0	0	0	0	0	114.6	F83	A81-F83 PolarHBondContact O-N 2.81Å
82	R	98.2	Very high	97.8	Very high	41 Å²	41	50 Å²	50	16%	0.155	35%	0.352	C	S	.	.	T	Hydrogen-bonded Turn	trans	-68.2	-18.5	173	72.3	-175	175.6	-107.6	3.1	112.7	P80 I96 N97 S98 E100 E102 D103	P80-R82 HydrophobicContact CB-CG 4.1Å; P80-R82 PolarHBondContact O-N 3.22Å; R82-I96 HydrophobicContact CG-CG2 4.45Å; R82-N97 WeakPolarHBondContact O-CB 3.48Å; R82-N97 PolarHBondContact O-N 2.87Å; R82-N97 PolarHBondContact O-ND2 2.79Å; R82-S98 VanDerWaalsContact CD-O 3.29Å; R82-S98 WeakPolarHBondContact CD-O 3.28Å; R82-E100 IonicContact CZ-OE1 2.77Å; R82-E100 VanDerWaalsContact CZ-OE1 3.29Å; R82-E100 IonicContact CZ-OE2 3.6Å; R82-E100 IonicContact NE-OE1 3.69Å; R82-E100 IonicContact NE-OE2 3.45Å; R82-E100 IonicContact NH1-OE1 3.1Å; R82-E100 PolarHBondContact NH1-OE1 3.27Å; R82-E100 IonicContact NH1-OE2 3.64Å; R82-E100 PolarHBondContact NH1-OE2 2.88Å; R82-E100 IonicContact NH2-OE2 3.67Å; R82-E100 PolarHBondContact NH2-OE2 2.82Å; R82-E102 IonicContact NH2-OE1 2.83Å; R82-D103 IonicContact CZ-OD1 2.94Å; R82-D103 IonicContact CZ-OD2 3.72Å; R82-D103 IonicContact NE-OD1 3.29Å; R82-D103 IonicContact NE-OD2 3.8Å; R82-D103 PolarHBondContact NE-OD2 2.85Å; R82-D103 VanDerWaalsContact NE-OD2 3.1Å; R82-D103 IonicContact NH2-OD1 2.74Å; R82-D103 PolarHBondContact NH2-OD1 2.82Å; R82-D103 IonicContact NH2-OD2 2.91Å; R82-D103 PolarHBondContact NH2-OD2 2.83Å
83	F	98.7	Very high	98	Very high	3 Å²	3	49.4 Å²	49.4	1%	0.013	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	144.6	176.7	-65.2	-86	0	0	0	111.1	W68 L75 V79 P80 A81 F94 T95 I96 D103 Y107	W68-F83 AromaticContact CD1-CD1 3.89Å; W68-F83 HydrophobicContact CZ2-CD2 4.36Å; W68-F83 AromaticContact CZ2-CE2 3.84Å; W68-F83 HydrophobicContact CZ2-CE2 3.84Å; W68-F83 AromaticContact CZ2-CZ 3.93Å; W68-F83 HydrophobicContact CZ2-CZ 3.93Å; W68-F83 AromaticContact NE1-CD1 3.29Å; W68-F83 VanDerWaalsContact NE1-CD1 3.29Å; W68-F83 AromaticContact NE1-CD2 3.55Å; W68-F83 AromaticContact NE1-CE1 3.35Å; W68-F83 VanDerWaalsContact NE1-CE1 3.35Å; W68-F83 AromaticContact NE1-CE2 3.65Å; W68-F83 AromaticContact NE1-CG 3.37Å; W68-F83 AromaticContact NE1-CZ 3.52Å; L75-F83 HydrophobicContact CD2-CB 3.83Å; L75-F83 WeakPolarHBondContact CD2-O 3.3Å; V79-F83 HydrophobicContact CG1-CB 3.96Å; V79-F83 HydrophobicContact CG1-CD2 3.81Å; V79-F83 HydrophobicContact CG1-CG 4.07Å; P80-F83 HydrophobicContact CB-CD2 4.09Å; P80-F83 HydrophobicContact CB-CE2 4.21Å; P80-F83 HydrophobicContact CG-CD2 4.32Å; P80-F83 HydrophobicContact CG-CE2 4.07Å; P80-F83 WeakPolarHBondContact O-CD2 3.44Å; P80-F83 PolarHBondContact O-N 2.93Å; P80-F83 VanDerWaalsContact O-N 3.14Å; A81-F83 PolarHBondContact O-N 2.81Å; F83-F94 HydrophobicContact CD1-CE1 4.12Å; F83-F94 HydrophobicContact CD1-CE2 4.05Å; F83-F94 AromaticContact CD1-CZ 3.38Å; F83-F94 HydrophobicContact CD1-CZ 3.38Å; F83-F94 HydrophobicContact CE1-CE1 4.36Å; F83-F94 AromaticContact CE1-CZ 3.83Å; F83-F94 HydrophobicContact CE1-CZ 3.83Å; F83-F94 HydrophobicContact CG-CZ 4.45Å; F83-T95 CarbonylContact C-O 3.54Å; F83-T95 WeakPolarHBondContact CA-O 3.46Å; F83-I96 HydrophobicContact CD1-CB 4.38Å; F83-I96 HydrophobicContact CD1-CD1 4.38Å; F83-I96 HydrophobicContact CD1-CG1 3.76Å; F83-I96 HydrophobicContact CD1-CG2 4.26Å; F83-I96 HydrophobicContact CE1-CB 4.32Å; F83-I96 HydrophobicContact CE1-CD1 3.73Å; F83-I96 HydrophobicContact CE1-CG1 3.61Å; F83-I96 HydrophobicContact CE1-CG2 3.95Å; F83-I96 HydrophobicContact CZ-CG2 4.33Å; F83-D103 HydrophobicContact CZ-CB 4.42Å; F83-D103 VanDerWaalsContact CZ-OD1 3.3Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.25Å; F83-Y107 HydrophobicContact CE1-CE1 4.44Å
84	S	98.6	Very high	98	Very high	45 Å²	45	46 Å²	46	32%	0.315	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.5	154.7	172.5	62.1	0	0	0	0	112.1	I69 F94 T95	I69-S84 WeakPolarHBondContact CD1-O 3.27Å; S84-F94 WeakPolarHBondContact O-CA 3.3Å; S84-T95 PolarHBondContact N-O 2.82Å; S84-T95 PolarHBondContact O-N 2.93Å
85	G	98.4	Very high	98	Very high	7 Å²	7	42.9 Å²	42.9	7%	0.072	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	144.2	173.1	0	0	0	0	0	109.7	I69 I72 S73 S93	I69-G85 VanDerWaalsContact CD1-N 3.3Å; I72-G85 CarbonylContact O-C 3.51Å; I72-G85 VanDerWaalsContact O-CA 3.23Å; I72-G85 WeakPolarHBondContact O-CA 3.48Å; S73-G85 VanDerWaalsContact CB-O 3.31Å; S73-G85 WeakPolarHBondContact CB-O 3.49Å; G85-S93 CarbonylContact C-O 3.52Å; G85-S93 WeakPolarHBondContact CA-O 3.29Å
86	S	98.1	Very high	98	Very high	54 Å²	54	40 Å²	40	38%	0.378	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.8	166.9	179	53.5	0	0	0	0	111.4	F92 S93	S86-F92 CarbonylContact O-C 3.19Å; S86-F92 VanDerWaalsContact O-CA 3.3Å; S86-F92 WeakPolarHBondContact O-CA 3.31Å; S86-S93 PolarHBondContact N-O 2.03Å; S86-S93 PolarHBondContact O-N 3.3Å; S86-S93 PolarHBondContact OG-OG 2.99Å
87	G	97.5	Very high	98	Very high	35 Å²	35	43 Å²	43	36%	0.361	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	121.1	178.8	176.4	0	0	0	0	0	113.2	I72 S91	I72-G87 WeakPolarHBondContact CG2-O 3.36Å; G87-S91 CarbonylContact C-O 3.54Å; G87-S91 WeakPolarHBondContact CA-O 3.25Å
88	S	96.8	Very high	98	Very high	88 Å²	88	39 Å²	39	62%	0.615	28%	0.282	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-168.4	157.8	-175.7	57.8	0	0	0	0	110.2	T90 S91	S88-T90 PolarHBondContact O-N 3.14Å; S88-S91 PolarHBondContact N-O 2.83Å; S88-S91 PolarHBondContact O-N 3.3Å
89	G	95.8	Very high	98.1	Very high	22 Å²	22	36.6 Å²	36.6	23%	0.227	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	66.2	-107.7	176.2	0	0	0	0	0	110.9	S50 V51 F92	S50-G89 WeakPolarHBondContact CA-O 3.29Å; S50-G89 WeakPolarHBondContact OG-CA 3.27Å; V51-G89 PolarHBondContact N-O 2.87Å; G89-F92 VanDerWaalsContact O-CE2 3.27Å; G89-F92 WeakPolarHBondContact O-CE2 3.5Å; G89-F92 WeakPolarHBondContact O-CZ 3.43Å
90	T	97	Very high	98.1	Very high	70 Å²	70	38.8 Å²	38.8	43%	0.429	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	-3.8	-176.3	54.2	0	0	0	0	114	S46 A47 S88	S46-T90 CarbonylContact C-O 3.5Å; S46-T90 VanDerWaalsContact CA-O 3.26Å; S46-T90 WeakPolarHBondContact CA-O 3.42Å; A47-T90 PolarHBondContact N-O 2.89Å; A47-T90 WeakPolarHBondContact O-CB 3.25Å; S88-T90 PolarHBondContact O-N 3.14Å
91	S	98.2	Very high	98	Very high	67 Å²	67	40.7 Å²	40.7	47%	0.469	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.9	123.1	-172	-174	0	0	0	0	111.6	G87 S88	G87-S91 CarbonylContact C-O 3.54Å; G87-S91 WeakPolarHBondContact CA-O 3.25Å; S88-S91 PolarHBondContact N-O 2.83Å; S88-S91 PolarHBondContact O-N 3.3Å
92	F	98.3	Very high	97.9	Very high	3 Å²	3	41 Å²	41	1%	0.013	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	154.4	-178.1	-57.3	-90.2	0	0	0	110.9	T44 C45 V51 M54 I72 S86 G89	T44-F92 CarbonylContact C-O 3.54Å; T44-F92 VanDerWaalsContact CA-O 3.31Å; T44-F92 WeakPolarHBondContact CA-O 3.28Å; C45-F92 HydrophobicContact CB-CB 4.45Å; C45-F92 PolarHBondContact N-O 3.37Å; C45-F92 PolarHBondContact O-N 3.07Å; V51-F92 HydrophobicContact CG2-CD2 4.45Å; V51-F92 HydrophobicContact CG2-CE2 3.36Å; V51-F92 HydrophobicContact CG2-CZ 3.46Å; V51-F92 VanDerWaalsContact CG2-CZ 3.46Å; M54-F92 HydrophobicContact CB-CB 4.4Å; M54-F92 HydrophobicContact CB-CD1 3.48Å; M54-F92 VanDerWaalsContact CB-CD1 3.48Å; M54-F92 HydrophobicContact CB-CD2 4.27Å; M54-F92 HydrophobicContact CB-CE1 3.73Å; M54-F92 HydrophobicContact CB-CE2 4.5Å; M54-F92 HydrophobicContact CB-CG 3.77Å; M54-F92 HydrophobicContact CB-CZ 4.25Å; M54-F92 HydrophobicContact CE-CB 4.42Å; M54-F92 HydrophobicContact CE-CD2 3.38Å; M54-F92 HydrophobicContact CE-CE2 3.75Å; M54-F92 HydrophobicContact CE-CG 3.9Å; M54-F92 HydrophobicContact CG-CB 3.96Å; M54-F92 HydrophobicContact CG-CD1 4Å; M54-F92 HydrophobicContact CG-CD2 4.27Å; M54-F92 HydrophobicContact CG-CG 3.79Å; I72-F92 HydrophobicContact CD1-CE1 4.05Å; I72-F92 HydrophobicContact CG1-CD1 4.43Å; I72-F92 HydrophobicContact CG1-CE1 3.99Å; I72-F92 HydrophobicContact CG2-CD1 4.4Å; S86-F92 CarbonylContact O-C 3.19Å; S86-F92 VanDerWaalsContact O-CA 3.3Å; S86-F92 WeakPolarHBondContact O-CA 3.31Å; G89-F92 VanDerWaalsContact O-CE2 3.27Å; G89-F92 WeakPolarHBondContact O-CE2 3.5Å; G89-F92 WeakPolarHBondContact O-CZ 3.43Å
93	S	98.5	Very high	97.8	Very high	23 Å²	23	39.2 Å²	39.2	16%	0.161	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	145.1	175.3	59	0	0	0	0	111.5	I43 G85 S86	I43-S93 CarbonylContact O-C 3.53Å; I43-S93 VanDerWaalsContact O-CA 3.25Å; I43-S93 WeakPolarHBondContact O-CA 3.28Å; G85-S93 CarbonylContact C-O 3.52Å; G85-S93 WeakPolarHBondContact CA-O 3.29Å; S86-S93 PolarHBondContact N-O 2.03Å; S86-S93 PolarHBondContact O-N 3.3Å; S86-S93 PolarHBondContact OG-OG 2.99Å
94	F	98.6	Very high	97.7	Very high	0 Å²	0	44.3 Å²	44.3	0%	0	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.9	129.1	169.2	175.6	-100.5	0	0	0	108.4	T42 I43 W56 W68 I69 F83 S84 I96 Y107	T42-F94 CarbonylContact C-O 3.51Å; T42-F94 VanDerWaalsContact CA-O 3.29Å; T42-F94 WeakPolarHBondContact CA-O 3.19Å; I43-F94 HydrophobicContact CB-CB 4.44Å; I43-F94 HydrophobicContact CD1-CD1 4.12Å; I43-F94 PolarHBondContact N-O 2.84Å; I43-F94 PolarHBondContact O-N 2.82Å; W56-F94 HydrophobicContact CB-CD2 3.99Å; W56-F94 HydrophobicContact CB-CE2 4.35Å; W56-F94 HydrophobicContact CD2-CB 3.53Å; W56-F94 HydrophobicContact CD2-CD2 4.03Å; W56-F94 HydrophobicContact CD2-CG 4.03Å; W56-F94 HydrophobicContact CE3-CB 3.63Å; W56-F94 HydrophobicContact CE3-CD2 4.38Å; W56-F94 HydrophobicContact CE3-CG 4.05Å; W56-F94 HydrophobicContact CG-CB 4.17Å; W56-F94 AromaticContact CG-CD2 3.83Å; W56-F94 HydrophobicContact CG-CD2 3.83Å; W56-F94 HydrophobicContact CG-CG 4.33Å; W56-F94 HydrophobicContact CH2-CB 3.66Å; W56-F94 HydrophobicContact CZ2-CB 3.59Å; W56-F94 HydrophobicContact CZ3-CB 3.69Å; W56-F94 HydrophobicContact CZ3-CG 4.44Å; W68-F94 AromaticContact CD1-CE2 3.75Å; W68-F94 AromaticContact CD1-CZ 3.76Å; I69-F94 HydrophobicContact CD1-CD2 3.68Å; I69-F94 HydrophobicContact CD1-CE2 3.66Å; I69-F94 HydrophobicContact CG1-CD2 4.34Å; I69-F94 HydrophobicContact CG1-CE2 4.06Å; F83-F94 HydrophobicContact CD1-CE1 4.12Å; F83-F94 HydrophobicContact CD1-CE2 4.05Å; F83-F94 AromaticContact CD1-CZ 3.38Å; F83-F94 HydrophobicContact CD1-CZ 3.38Å; F83-F94 HydrophobicContact CE1-CE1 4.36Å; F83-F94 AromaticContact CE1-CZ 3.83Å; F83-F94 HydrophobicContact CE1-CZ 3.83Å; F83-F94 HydrophobicContact CG-CZ 4.45Å; S84-F94 WeakPolarHBondContact O-CA 3.3Å; F94-I96 HydrophobicContact CD1-CG1 4.36Å; F94-I96 HydrophobicContact CE1-CD1 4Å; F94-I96 HydrophobicContact CE1-CG1 3.65Å; F94-I96 HydrophobicContact CZ-CG1 4.28Å; F94-Y107 HydrophobicContact CD1-CD1 4.39Å; F94-Y107 AromaticContact CE1-CD1 3.57Å; F94-Y107 HydrophobicContact CE1-CD1 3.57Å; F94-Y107 AromaticContact CE1-CE1 3.64Å; F94-Y107 HydrophobicContact CE1-CE1 3.64Å; F94-Y107 HydrophobicContact CE1-CG 4.06Å; F94-Y107 HydrophobicContact CE2-CD1 4.49Å; F94-Y107 AromaticContact CZ-CD1 3.62Å; F94-Y107 HydrophobicContact CZ-CD1 3.62Å; F94-Y107 AromaticContact CZ-CE1 3.52Å; F94-Y107 HydrophobicContact CZ-CE1 3.52Å
95	T	98.6	Very high	97.7	Very high	10 Å²	10	43.4 Å²	43.4	6%	0.061	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	135.7	-176.1	-66.7	0	0	0	0	110.3	K40 V41 T42 F83 S84 N97	K40-T95 HydrophobicContact CD-CG2 4.37Å; K40-T95 HydrophobicContact CG-CG2 4.14Å; V41-T95 CarbonylContact O-C 3.6Å; V41-T95 VanDerWaalsContact O-CA 3.28Å; V41-T95 WeakPolarHBondContact O-CA 3.32Å; T42-T95 PolarHBondContact OG1-OG1 3.02Å; F83-T95 CarbonylContact C-O 3.54Å; F83-T95 WeakPolarHBondContact CA-O 3.46Å; S84-T95 PolarHBondContact N-O 2.82Å; S84-T95 PolarHBondContact O-N 2.93Å; T95-N97 WeakPolarHBondContact CG2-OD1 3.02Å
96	I	98.6	Very high	97.7	Very high	1 Å²	1	46.5 Å²	46.5	1%	0.005	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	110.6	165.2	-44.9	-179.9	0	0	0	105.5	K40 V41 R82 F83 F94 S98 M99 D103 Y107	K40-I96 CarbonylContact C-O 3.56Å; K40-I96 VanDerWaalsContact CA-O 3.32Å; K40-I96 WeakPolarHBondContact CA-O 3.02Å; V41-I96 HydrophobicContact CB-CB 4.34Å; V41-I96 HydrophobicContact CG1-CD1 4.47Å; V41-I96 PolarHBondContact N-O 3.05Å; V41-I96 PolarHBondContact O-N 3.28Å; R82-I96 HydrophobicContact CG-CG2 4.45Å; F83-I96 HydrophobicContact CD1-CB 4.38Å; F83-I96 HydrophobicContact CD1-CD1 4.38Å; F83-I96 HydrophobicContact CD1-CG1 3.76Å; F83-I96 HydrophobicContact CD1-CG2 4.26Å; F83-I96 HydrophobicContact CE1-CB 4.32Å; F83-I96 HydrophobicContact CE1-CD1 3.73Å; F83-I96 HydrophobicContact CE1-CG1 3.61Å; F83-I96 HydrophobicContact CE1-CG2 3.95Å; F83-I96 HydrophobicContact CZ-CG2 4.33Å; F94-I96 HydrophobicContact CD1-CG1 4.36Å; F94-I96 HydrophobicContact CE1-CD1 4Å; F94-I96 HydrophobicContact CE1-CG1 3.65Å; F94-I96 HydrophobicContact CZ-CG1 4.28Å; I96-S98 VanDerWaalsContact C-N 3.32Å; I96-S98 PolarHBondContact O-N 2.89Å; I96-M99 HydrophobicContact CD1-CE 3.82Å; I96-M99 HydrophobicContact CD1-SD 4.27Å; I96-D103 HydrophobicContact CD1-CB 4.42Å; I96-Y107 HydrophobicContact CD1-CE2 4.38Å
97	N	98.5	Very high	97.7	Very high	77 Å²	77	44.8 Å²	44.8	41%	0.412	29%	0.288	S	S	.	.	S	Bend	trans	-71	-28.9	-174.8	-75.4	-45	0	0	0	113.3	R82 T95	R82-N97 WeakPolarHBondContact O-CB 3.48Å; R82-N97 PolarHBondContact O-N 2.87Å; R82-N97 PolarHBondContact O-ND2 2.79Å; T95-N97 WeakPolarHBondContact CG2-OD1 3.02Å
98	S	98.3	Very high	97.7	Very high	48 Å²	48	47.5 Å²	47.5	34%	0.336	29%	0.288	S	S	.	.	S	Bend	trans	-144.1	100.6	178.9	176.8	0	0	0	0	108.3	R82 I96	R82-S98 VanDerWaalsContact CD-O 3.29Å; R82-S98 WeakPolarHBondContact CD-O 3.28Å; I96-S98 VanDerWaalsContact C-N 3.32Å; I96-S98 PolarHBondContact O-N 2.89Å
99	M	97.9	Very high	97.7	Very high	24 Å²	24	43.9 Å²	43.9	12%	0.118	26%	0.263	C	S	.	.			trans	-60.5	136	-179.4	-179.2	64.2	75.8	0	0	111.4	A35 P37 G38 E39 V41 I96 D103	A35-M99 HydrophobicContact CB-CE 4.04Å; A35-M99 HydrophobicContact CB-CG 4.24Å; P37-M99 CarbonylContact C-O 3.53Å; P37-M99 VanDerWaalsContact CA-O 3.28Å; P37-M99 WeakPolarHBondContact CA-O 3.45Å; G38-M99 PolarHBondContact N-O 3.38Å; E39-M99 WeakPolarHBondContact O-CB 3.48Å; E39-M99 PolarHBondContact O-N 3.21Å; V41-M99 HydrophobicContact CB-CE 3.8Å; V41-M99 HydrophobicContact CG1-CE 4.21Å; V41-M99 HydrophobicContact CG2-CE 3.35Å; I96-M99 HydrophobicContact CD1-CE 3.82Å; I96-M99 HydrophobicContact CD1-SD 4.27Å; M99-D103 HydrophobicContact SD-CB 3.57Å; M99-D103 VanDerWaalsContact SD-CB 3.57Å
100	E	98.1	Very high	97.7	Very high	63 Å²	63	45.7 Å²	45.7	29%	0.294	27%	0.265	S	S	.	.			trans	-122.6	162.6	172.3	-65.5	171.4	-158.7	0	0	111	R82 E102 D103	R82-E100 IonicContact CZ-OE1 2.77Å; R82-E100 VanDerWaalsContact CZ-OE1 3.29Å; R82-E100 IonicContact CZ-OE2 3.6Å; R82-E100 IonicContact NE-OE1 3.69Å; R82-E100 IonicContact NE-OE2 3.45Å; R82-E100 IonicContact NH1-OE1 3.1Å; R82-E100 PolarHBondContact NH1-OE1 3.27Å; R82-E100 IonicContact NH1-OE2 3.64Å; R82-E100 PolarHBondContact NH1-OE2 2.88Å; R82-E100 IonicContact NH2-OE2 3.67Å; R82-E100 PolarHBondContact NH2-OE2 2.82Å; E100-E102 VanDerWaalsContact C-N 3.25Å; E100-E102 HydrophobicContact CB-CG 4.33Å; E100-E102 WeakPolarHBondContact CB-OE2 3.27Å; E100-E102 PolarHBondContact O-N 2.84Å; E100-D103 PolarHBondContact N-OD2 2.89Å; E100-D103 WeakPolarHBondContact O-CB 3.26Å; E100-D103 PolarHBondContact O-N 2.98Å; E100-D103 VanDerWaalsContact O-N 3.07Å
101	A	96.2	Very high	97.5	Very high	82 Å²	82	43.2 Å²	43.2	68%	0.678	25%	0.249	S	C	*	.	G	3₁₀ helix	trans	-63.8	-31.4	-174.2	0	0	0	0	0	112.7	D103 V104	A101-D103 PolarHBondContact O-N 2.98Å; A101-V104 WeakPolarHBondContact O-CG2 3.47Å
102	E	96.3	Very high	96.8	Very high	97 Å²	97	47 Å²	47	45%	0.453	25%	0.253	S	S	.	.	G	3₁₀ helix	trans	-72.9	-11	176.5	63	-100.4	-126.8	0	0	114.8	K60 R82 E100 V104	K60-E102 VanDerWaalsContact CE-O 3.28Å; K60-E102 WeakPolarHBondContact CE-O 3.33Å; K60-E102 PolarHBondContact NZ-O 2.79Å; R82-E102 IonicContact NH2-OE1 2.83Å; E100-E102 VanDerWaalsContact C-N 3.25Å; E100-E102 HydrophobicContact CB-CG 4.33Å; E100-E102 WeakPolarHBondContact CB-OE2 3.27Å; E100-E102 PolarHBondContact O-N 2.84Å; E102-V104 VanDerWaalsContact C-N 3.26Å
103	D	97.4	Very high	95.4	Very high	5 Å²	5	49.2 Å²	49.2	3%	0.027	27%	0.269	C	S	.	.	G	3₁₀ helix	trans	-83.6	-6.4	-176.7	-62.6	-22.2	0	0	0	112	R82 F83 I96 M99 E100 A101 A105 Y107	R82-D103 IonicContact CZ-OD1 2.94Å; R82-D103 IonicContact CZ-OD2 3.72Å; R82-D103 IonicContact NE-OD1 3.29Å; R82-D103 IonicContact NE-OD2 3.8Å; R82-D103 PolarHBondContact NE-OD2 2.85Å; R82-D103 VanDerWaalsContact NE-OD2 3.1Å; R82-D103 IonicContact NH2-OD1 2.74Å; R82-D103 PolarHBondContact NH2-OD1 2.82Å; R82-D103 IonicContact NH2-OD2 2.91Å; R82-D103 PolarHBondContact NH2-OD2 2.83Å; F83-D103 HydrophobicContact CZ-CB 4.42Å; F83-D103 VanDerWaalsContact CZ-OD1 3.3Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.25Å; I96-D103 HydrophobicContact CD1-CB 4.42Å; M99-D103 HydrophobicContact SD-CB 3.57Å; M99-D103 VanDerWaalsContact SD-CB 3.57Å; E100-D103 PolarHBondContact N-OD2 2.89Å; E100-D103 WeakPolarHBondContact O-CB 3.26Å; E100-D103 PolarHBondContact O-N 2.98Å; E100-D103 VanDerWaalsContact O-N 3.07Å; A101-D103 PolarHBondContact O-N 2.98Å; D103-A105 PolarHBondContact O-N 2.98Å; D103-Y107 WeakPolarHBondContact O-CE2 3.4Å; D103-Y107 PolarHBondContact O-OH 2.97Å
104	V	96.8	Very high	93.7	Very high	110 Å²	110	50 Å²	50	67%	0.667	27%	0.274	S	S	*	.			trans	-62.4	103.7	173.3	180	0	0	0	0	109.7	A101 E102	A101-V104 WeakPolarHBondContact O-CG2 3.47Å; E102-V104 VanDerWaalsContact C-N 3.26Å
105	A	97.6	Very high	91.8	Very high	26 Å²	26	57.8 Å²	57.8	22%	0.215	31%	0.305	C	S	.	.	S	Bend	trans	-161.9	169	-176.4	0	0	0	0	0	109.8	Q58 Q59 K60 D103 Y107	Q58-A105 HydrophobicContact CG-CB 3.47Å; Q58-A105 VanDerWaalsContact CG-CB 3.47Å; Q59-A105 WeakPolarHBondContact O-CB 3.33Å; K60-A105 HydrophobicContact CG-CB 4.19Å; D103-A105 PolarHBondContact O-N 2.98Å; A105-Y107 HydrophobicContact CB-CE2 3.99Å
106	T	98	Very high	89.7	Confident	72 Å²	72	61.4 Å²	61.4	44%	0.442	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	135.7	164.8	-47.6	0	0	0	0	109.4	Q59 Y108	Q59-T106 PolarHBondContact N-O 3.5Å; Q59-T106 PolarHBondContact O-N 2.88Å; T106-Y108 HydrophobicContact CG2-CE1 3.74Å; T106-Y108 HydrophobicContact CG2-CE2 3.76Å; T106-Y108 VanDerWaalsContact CG2-OH 3.25Å; T106-Y108 WeakPolarHBondContact CG2-OH 3.44Å
107	Y	98.2	Very high	87.5	Confident	17 Å²	17	70.5 Å²	70.5	7%	0.067	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	135.5	178.6	-65.2	-92.9	0	0	0	110.6	Q28 I43 Y57 Q58 F83 F94 I96 D103 A105	Q28-Y107 PolarHBondContact NE2-O 3.21Å; I43-Y107 HydrophobicContact CD1-CD2 4.17Å; I43-Y107 HydrophobicContact CD1-CG 4.26Å; Y57-Y107 CarbonylContact O-C 3.51Å; Y57-Y107 VanDerWaalsContact O-CA 3.24Å; Y57-Y107 WeakPolarHBondContact O-CA 3.33Å; Q58-Y107 HydrophobicContact CB-CD1 4.09Å; Q58-Y107 HydrophobicContact CB-CE1 3.83Å; Q58-Y107 HydrophobicContact CG-CD1 4.24Å; Q58-Y107 HydrophobicContact CG-CE1 3.67Å; Q58-Y107 PolarHBondContact NE2-OH 3.04Å; F83-Y107 HydrophobicContact CE1-CE1 4.44Å; F94-Y107 HydrophobicContact CD1-CD1 4.39Å; F94-Y107 AromaticContact CE1-CD1 3.57Å; F94-Y107 HydrophobicContact CE1-CD1 3.57Å; F94-Y107 AromaticContact CE1-CE1 3.64Å; F94-Y107 HydrophobicContact CE1-CE1 3.64Å; F94-Y107 HydrophobicContact CE1-CG 4.06Å; F94-Y107 HydrophobicContact CE2-CD1 4.49Å; F94-Y107 AromaticContact CZ-CD1 3.62Å; F94-Y107 HydrophobicContact CZ-CD1 3.62Å; F94-Y107 AromaticContact CZ-CE1 3.52Å; F94-Y107 HydrophobicContact CZ-CE1 3.52Å; I96-Y107 HydrophobicContact CD1-CE2 4.38Å; D103-Y107 WeakPolarHBondContact O-CE2 3.4Å; D103-Y107 PolarHBondContact O-OH 2.97Å; A105-Y107 HydrophobicContact CB-CE2 3.99Å
108	Y	97.7	Very high	86.9	Confident	93 Å²	93	70.2 Å²	70.2	37%	0.365	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	135.9	-177.8	-55.5	-79.5	0	0	0	111.1	W56 Y57 Q59 T106	W56-Y108 CarbonylContact C-O 3.54Å; W56-Y108 VanDerWaalsContact CA-O 3.27Å; W56-Y108 WeakPolarHBondContact CA-O 3.36Å; Y57-Y108 PolarHBondContact N-O 2.99Å; Y57-Y108 PolarHBondContact O-N 3.31Å; Q59-Y108 HydrophobicContact CB-CD2 4.46Å; Q59-Y108 HydrophobicContact CB-CE2 3.81Å; Q59-Y108 VanDerWaalsContact OE1-CE2 3.3Å; Q59-Y108 PolarHBondContact OE1-OH 3.01Å; T106-Y108 HydrophobicContact CG2-CE1 3.74Å; T106-Y108 HydrophobicContact CG2-CE2 3.76Å; T106-Y108 VanDerWaalsContact CG2-OH 3.25Å; T106-Y108 WeakPolarHBondContact CG2-OH 3.44Å
109	C	97.4	Very high	86.3	Confident	12 Å²	12	71.4 Å²	71.4	8%	0.081	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.7	146.2	168.6	68.2	0	0	0	0	110.9	Q28 C45 M54 N55 W56	Q28-C109 WeakPolarHBondContact CG-SG 3.37Å; Q28-C109 PolarHBondContact OE1-SG 3.25Å; C45-C109 HydrophobicContact CB-CB 3.48Å; C45-C109 VanDerWaalsContact CB-CB 3.48Å; C45-C109 WeakPolarHBondContact CB-SG 3.26Å; C45-C109 WeakPolarHBondContact SG-CB 3.45Å; C45-C109 CovalentContact SG-SG 2.03Å; C45-C109 PolarHBondContact SG-SG 2.89Å; M54-C109 HydrophobicContact CG-CB 4.46Å; M54-C109 HydrophobicContact SD-CB 3.65Å; N55-C109 CarbonylContact O-C 3.51Å; N55-C109 VanDerWaalsContact O-CA 3.29Å; N55-C109 WeakPolarHBondContact O-CA 3.4Å; W56-C109 HydrophobicContact CD2-CB 4.1Å; W56-C109 HydrophobicContact CE3-CB 3.9Å; W56-C109 HydrophobicContact CH2-CB 3.91Å; W56-C109 HydrophobicContact CZ2-CB 4.07Å; W56-C109 HydrophobicContact CZ3-CB 3.81Å
110	Q	95.7	Very high	85.7	Confident	60 Å²	60	74 Å²	74	28%	0.28	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.7	127.4	179.1	177.4	-98.5	-39.7	0	0	110.5	M54 N55 Y57	M54-Q110 VanDerWaalsContact SD-C 3.6Å; N55-Q110 PolarHBondContact N-O 2.94Å; N55-Q110 PolarHBondContact ND2-OE1 2.89Å; N55-Q110 PolarHBondContact O-N 2.9Å; Y57-Q110 HydrophobicContact CD2-CB 4.29Å; Y57-Q110 HydrophobicContact CE2-CB 3.83Å; Y57-Q110 HydrophobicContact CE2-CG 4.4Å; Y57-Q110 PolarHBondContact OH-OE1 2.92Å
111	Q	93	Very high	84.9	Confident	18 Å²	18	74.6 Å²	74.6	8%	0.084	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.5	143.2	176.1	66.9	77	21.3	0	0	111.5	I24 L26 V51 Y53 M54 S114	I24-Q111 HydrophobicContact CB-CG 4.27Å; I24-Q111 HydrophobicContact CG2-CG 4.21Å; L26-Q111 HydrophobicContact CD1-CB 4.34Å; L26-Q111 HydrophobicContact CD1-CG 4.24Å; L26-Q111 HydrophobicContact CD2-CB 4.38Å; L26-Q111 HydrophobicContact CD2-CG 4.3Å; V51-Q111 HydrophobicContact CB-CB 4.03Å; V51-Q111 HydrophobicContact CG1-CB 3.74Å; V51-Q111 HydrophobicContact CG1-CG 4.08Å; V51-Q111 HydrophobicContact CG2-CB 4.09Å; Y53-Q111 VanDerWaalsContact O-CA 3.32Å; Y53-Q111 WeakPolarHBondContact O-CA 3.38Å; M54-Q111 HydrophobicContact CE-CB 4.45Å; Q111-S114 PolarHBondContact NE2-O 3.24Å; Q111-S114 PolarHBondContact NE2-OG 3.07Å
112	R	82.6	Confident	84.2	Confident	145 Å²	145	74.2 Å²	74.2	55%	0.547	39%	0.394	S	S	.	.			trans	-112.2	14.9	178.4	-153.3	-169.9	179.8	171.6	-1.5	114.2	Y53 Y115	Y53-R112 PolarHBondContact O-N 2.73Å; Y53-R112 VanDerWaalsContact O-N 3.14Å; R112-Y115 PolarHBondContact NE-OH 3.4Å; R112-Y115 VanDerWaalsContact NE-OH 3.13Å
113	S	69.3	Low	83.4	Confident	51 Å²	51	72.7 Å²	72.7	36%	0.357	39%	0.39	S	S	.	.	S	Bend	trans	-78.6	-31.6	179.6	-75.9	0	0	0	0	113.7	V51 S52	V51-S113 WeakPolarHBondContact CA-OG 3.42Å; S52-S113 PolarHBondContact N-OG 3.06Å
114	S	63.3	Low	82.4	Confident	38 Å²	38	77.5 Å²	77.5	27%	0.266	42%	0.416	S	S	.	.			trans	-134.5	133.6	172	59.5	0	0	0	0	109.9	Q111	Q111-S114 PolarHBondContact NE2-O 3.24Å; Q111-S114 PolarHBondContact NE2-OG 3.07Å
115	Y	58.8	Low	81.3	Confident	164 Å²	164	75 Å²	75	64%	0.643	40%	0.397	S	S	*	.			trans	-84.8	130.1	159.5	-64.1	-82.6	0	0	0	106.3	R112	R112-Y115 PolarHBondContact NE-OH 3.4Å; R112-Y115 VanDerWaalsContact NE-OH 3.13Å
116	P	55.1	Low	80	Confident	87 Å²	87	79.1 Å²	79.1	57%	0.565	41%	0.412	S	S	*	.			trans	-55.5	143.7	163.2	-7.4	18.4	0	0	0	108.6
117	P	50.5	Low	78.3	Confident	192 Å²	192	79.7 Å²	79.7	100%	1.247	41%	0.409	S	S	*	.			trans	-56.8	0	178.6	23.5	-32.6	0	0	0	113.4

Retrieved 117 of 117 residues in 63.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).