A0A075B657_MOUSE Loading...

T cell receptor delta variable 1

AlphaFold DB , UniProt , Accession A0A075B657, Species MOUSE (Mus musculus, Mouse), Gene Trdv1, Length 112 aa.

						>A0A075B657_MOUSE|A0A075B657|Trdv1
MGMRLQVLAWLLTFQAAWVNTQMLHQSPQSLTIQEGDEVTMSCNLSTSLYALLWYRQGDDGSLVSLVTLQKGGDEKSKDKITANLDKKMQQSSLWIQASQPSHSGTYLCGGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.2	Very low	60.2	Low	243 Å²	243	133.4 Å²	133.4	100%	1.197	67%	0.669	S	S	*	*				0	31.3	0	-155.6	88.2	104.1	0	0	112.7
2	G	54	Low	60.3	Low	50 Å²	50	132.5 Å²	132.5	52%	0.515	67%	0.667	S	S	.	*			trans	-115.5	-20.9	-173	0	0	0	0	0	115.7
3	M	55.2	Low	60.4	Low	152 Å²	152	129 Å²	129	75%	0.749	66%	0.656	S	S	*	*	H	α-helix	trans	-82.8	-27.5	-172.5	-160.1	139.6	63.8	0	0	113.3	V7	M3-V7 WeakPolarHBondContact O-CG2 3.38Å; M3-V7 PolarHBondContact O-N 3.06Å
4	R	58.7	Low	60.4	Low	218 Å²	218	131.4 Å²	131.4	82%	0.823	66%	0.661	S	S	*	*	H	α-helix	trans	-72.1	-34.3	-179	-68	-172.9	175.5	-175.1	-1.7	113.2	L8	R4-L8 WeakPolarHBondContact O-CG 3.49Å; R4-L8 PolarHBondContact O-N 3.21Å
5	L	56.3	Low	60.3	Low	137 Å²	137	132.9 Å²	132.9	72%	0.717	67%	0.665	S	S	*	*	H	α-helix	trans	-73.7	-37.1	-178.7	-143.7	80.8	0	0	0	111.8	L8 A9	L5-L8 PolarHBondContact O-N 2.88Å; L5-A9 PolarHBondContact O-N 3.46Å
6	Q	61.1	Low	60	Low	131 Å²	131	129.3 Å²	129.3	61%	0.612	66%	0.662	S	S	*	*	H	α-helix	trans	-65	-45	176.2	-70.6	-173.7	-24.4	0	0	111.3	L8 A9 W10	Q6-L8 VanDerWaalsContact C-N 3.32Å; Q6-L8 PolarHBondContact O-N 3.23Å; Q6-A9 WeakPolarHBondContact O-CB 3.37Å; Q6-A9 PolarHBondContact O-N 3.15Å; Q6-A9 VanDerWaalsContact O-N 3.14Å; Q6-W10 PolarHBondContact O-N 3.26Å
7	V	67.1	Low	59.8	Low	81 Å²	81	126.9 Å²	126.9	49%	0.491	67%	0.666	S	S	.	*	H	α-helix	trans	-60.2	-41.3	177.4	175.1	0	0	0	0	111.6	M3 W10 L11	M3-V7 WeakPolarHBondContact O-CG2 3.38Å; M3-V7 PolarHBondContact O-N 3.06Å; V7-W10 PolarHBondContact O-N 2.94Å; V7-L11 HydrophobicContact CG1-CD1 4Å; V7-L11 HydrophobicContact CG1-CG 4.5Å; V7-L11 WeakPolarHBondContact O-CG 3.28Å; V7-L11 PolarHBondContact O-N 3.41Å
8	L	64.2	Low	59.6	Low	101 Å²	101	132.2 Å²	132.2	53%	0.529	68%	0.676	S	S	.	*	H	α-helix	trans	-63.8	-40.3	175.3	-70.8	169.6	0	0	0	112.1	R4 L5 Q6 L11 L12	R4-L8 WeakPolarHBondContact O-CG 3.49Å; R4-L8 PolarHBondContact O-N 3.21Å; L5-L8 PolarHBondContact O-N 2.88Å; Q6-L8 VanDerWaalsContact C-N 3.32Å; Q6-L8 PolarHBondContact O-N 3.23Å; L8-L11 PolarHBondContact O-N 2.78Å; L8-L12 WeakPolarHBondContact O-CB 3.21Å; L8-L12 WeakPolarHBondContact O-CD1 3.34Å; L8-L12 VanDerWaalsContact O-CG 3.31Å; L8-L12 WeakPolarHBondContact O-CG 3.35Å; L8-L12 PolarHBondContact O-N 3.16Å
9	A	66.6	Low	59.4	Low	51 Å²	51	130.8 Å²	130.8	42%	0.421	67%	0.674	S	S	.	*	H	α-helix	trans	-64.1	-41.1	176.1	0	0	0	0	0	112.3	L5 Q6 L12 T13	L5-A9 PolarHBondContact O-N 3.46Å; Q6-A9 WeakPolarHBondContact O-CB 3.37Å; Q6-A9 PolarHBondContact O-N 3.15Å; Q6-A9 VanDerWaalsContact O-N 3.14Å; A9-L12 PolarHBondContact O-N 3.18Å; A9-T13 WeakPolarHBondContact O-CG2 3.23Å; A9-T13 PolarHBondContact O-N 3.21Å; A9-T13 VanDerWaalsContact O-N 3.07Å; A9-T13 PolarHBondContact O-OG1 3.06Å
10	W	64.6	Low	59.2	Low	197 Å²	197	131.8 Å²	131.8	75%	0.746	68%	0.681	S	S	*	*	H	α-helix	trans	-67.5	-36.6	175.4	-80.9	98.9	0	0	0	113.1	Q6 V7 T13 F14	Q6-W10 PolarHBondContact O-N 3.26Å; V7-W10 PolarHBondContact O-N 2.94Å; W10-T13 PolarHBondContact O-OG1 2.85Å; W10-F14 PolarHBondContact O-N 3.36Å
11	L	65.3	Low	59.2	Low	106 Å²	106	130.9 Å²	130.9	56%	0.555	68%	0.681	S	S	*	*	H	α-helix	trans	-67	-40.8	174.2	-72.4	167.7	0	0	0	111.5	V7 L8 F14 Q15	V7-L11 HydrophobicContact CG1-CD1 4Å; V7-L11 HydrophobicContact CG1-CG 4.5Å; V7-L11 WeakPolarHBondContact O-CG 3.28Å; V7-L11 PolarHBondContact O-N 3.41Å; L8-L11 PolarHBondContact O-N 2.78Å; L11-F14 PolarHBondContact O-N 3.02Å; L11-Q15 WeakPolarHBondContact O-CG 3.42Å; L11-Q15 PolarHBondContact O-N 3Å
12	L	60.8	Low	60	Low	123 Å²	123	124.6 Å²	124.6	64%	0.644	65%	0.649	S	S	*	*	H	α-helix	trans	-66	-38.4	178.4	-77.7	162.2	0	0	0	112.6	L8 A9 A16	L8-L12 WeakPolarHBondContact O-CB 3.21Å; L8-L12 WeakPolarHBondContact O-CD1 3.34Å; L8-L12 VanDerWaalsContact O-CG 3.31Å; L8-L12 WeakPolarHBondContact O-CG 3.35Å; L8-L12 PolarHBondContact O-N 3.16Å; A9-L12 PolarHBondContact O-N 3.18Å; L12-A16 PolarHBondContact O-N 2.99Å
13	T	62.1	Low	61	Low	87 Å²	87	129 Å²	129	53%	0.534	66%	0.657	S	S	.	*	H	α-helix	trans	-70.9	-33.4	176.8	54.5	0	0	0	0	112.5	A9 W10 Q15 A16 A17	A9-T13 WeakPolarHBondContact O-CG2 3.23Å; A9-T13 PolarHBondContact O-N 3.21Å; A9-T13 VanDerWaalsContact O-N 3.07Å; A9-T13 PolarHBondContact O-OG1 3.06Å; W10-T13 PolarHBondContact O-OG1 2.85Å; T13-Q15 VanDerWaalsContact C-N 3.34Å; T13-Q15 PolarHBondContact O-N 2.85Å; T13-A16 PolarHBondContact O-N 2.95Å; T13-A17 PolarHBondContact O-N 2.75Å
14	F	60	Low	62.4	Low	163 Å²	163	124.7 Å²	124.7	72%	0.715	64%	0.637	S	S	*	*	H	α-helix	trans	-68.5	-32.5	177.9	-151.7	-96.7	0	0	0	112.6	W10 L11	W10-F14 PolarHBondContact O-N 3.36Å; L11-F14 PolarHBondContact O-N 3.02Å
15	Q	59.5	Low	64	Low	154 Å²	154	119.4 Å²	119.4	72%	0.72	62%	0.622	S	S	*	*	H	α-helix	trans	-72.4	-34.7	175.5	-59.1	-138.9	-29.4	0	0	112.7	L11 T13 A17 W18	L11-Q15 WeakPolarHBondContact O-CG 3.42Å; L11-Q15 PolarHBondContact O-N 3Å; T13-Q15 VanDerWaalsContact C-N 3.34Å; T13-Q15 PolarHBondContact O-N 2.85Å; Q15-A17 VanDerWaalsContact C-N 3.28Å; Q15-A17 PolarHBondContact O-N 2.72Å; Q15-W18 PolarHBondContact O-N 2.86Å
16	A	55.5	Low	65.8	Low	75 Å²	75	114.7 Å²	114.7	62%	0.62	60%	0.596	S	S	*	*	H	α-helix	trans	-66.6	-27.9	178.7	0	0	0	0	0	113.1	L12 T13 W18	L12-A16 PolarHBondContact O-N 2.99Å; T13-A16 PolarHBondContact O-N 2.95Å; A16-W18 VanDerWaalsContact C-N 3.28Å; A16-W18 PolarHBondContact O-N 2.87Å
17	A	57.1	Low	67.4	Low	89 Å²	89	110.4 Å²	110.4	74%	0.736	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	-10.8	178.7	0	0	0	0	0	114.2	T13 Q15	T13-A17 PolarHBondContact O-N 2.75Å; Q15-A17 VanDerWaalsContact C-N 3.28Å; Q15-A17 PolarHBondContact O-N 2.72Å
18	W	55.3	Low	68.8	Low	221 Å²	221	109.2 Å²	109.2	84%	0.837	57%	0.574	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.4	-3.5	-175.5	-163.8	-88	0	0	0	114.1	Q15 A16 N20	Q15-W18 PolarHBondContact O-N 2.86Å; A16-W18 VanDerWaalsContact C-N 3.28Å; A16-W18 PolarHBondContact O-N 2.87Å; W18-N20 VanDerWaalsContact C-N 3.34Å; W18-N20 PolarHBondContact O-N 3.32Å
19	V	55.9	Low	70.2	Confident	107 Å²	107	113.2 Å²	113.2	65%	0.648	59%	0.59	S	S	*	*			trans	-74.7	91	177	179.9	0	0	0	0	109.3	T21	V19-T21 VanDerWaalsContact C-N 3.32Å; V19-T21 PolarHBondContact O-N 2.95Å
20	N	56.3	Low	71.5	Confident	150 Å²	150	115.7 Å²	115.7	80%	0.802	61%	0.605	S	S	*	*			trans	-77.6	85.7	171.1	-156	2.5	0	0	0	108.2	W18 Q22	W18-N20 VanDerWaalsContact C-N 3.34Å; W18-N20 PolarHBondContact O-N 3.32Å; N20-Q22 PolarHBondContact O-N 2.82Å; N20-Q22 VanDerWaalsContact O-N 3.1Å
21	T	59.3	Low	73	Confident	112 Å²	112	109.7 Å²	109.7	69%	0.687	59%	0.587	S	S	*	*			trans	-67.2	108.9	179.7	-15.8	0	0	0	0	108.8	V19 M23	V19-T21 VanDerWaalsContact C-N 3.32Å; V19-T21 PolarHBondContact O-N 2.95Å; T21-M23 PolarHBondContact O-N 2.91Å; T21-M23 VanDerWaalsContact O-N 3.12Å
22	Q	64.6	Low	74.4	Confident	112 Å²	112	111.5 Å²	111.5	52%	0.523	60%	0.603	S	S	.	*			trans	-60.6	117.2	168.2	-68.8	179.2	3.2	0	0	107.7	N20	N20-Q22 PolarHBondContact O-N 2.82Å; N20-Q22 VanDerWaalsContact O-N 3.1Å
23	M	75	Confident	76	Confident	141 Å²	141	108.6 Å²	108.6	70%	0.695	59%	0.587	S	S	*	*			trans	-93.4	112.1	-177.1	-163.8	174.3	-173.8	0	0	108.2	T21 S46	T21-M23 PolarHBondContact O-N 2.91Å; T21-M23 VanDerWaalsContact O-N 3.12Å; M23-S46 PolarHBondContact N-OG 2.75Å; M23-S46 VanDerWaalsContact O-CB 3.26Å; M23-S46 WeakPolarHBondContact O-CB 3.31Å; M23-S46 PolarHBondContact O-N 2.75Å; M23-S46 PolarHBondContact O-OG 2.88Å; M23-S46 VanDerWaalsContact O-OG 3.11Å
24	L	85.4	Confident	77.6	Confident	62 Å²	62	111.1 Å²	111.1	33%	0.325	59%	0.593	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.8	128.7	177	176.5	145.5	0	0	0	108.4	Q26 C43 N44 C109	L24-Q26 HydrophobicContact CD2-CB 4.4Å; L24-C43 WeakPolarHBondContact CD1-SG 3.27Å; L24-C43 VanDerWaalsContact CG-SG 3.51Å; L24-N44 WeakPolarHBondContact CA-O 3.37Å; L24-C109 WeakPolarHBondContact CD2-SG 3.32Å
25	H	91.7	Very high	79.3	Confident	108 Å²	108	110 Å²	110	50%	0.5	59%	0.59	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.1	109.3	-177.5	-170.9	76.6	0	0	0	110	C43 N44	H25-C43 WeakPolarHBondContact O-CA 3.43Å; H25-N44 HydrophobicContact CB-CB 4.36Å; H25-N44 PolarHBondContact N-O 2.93Å; H25-N44 PolarHBondContact O-N 2.87Å
26	Q	94.4	Very high	81	Confident	37 Å²	37	104.9 Å²	104.9	17%	0.173	58%	0.578	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.9	136.8	178.8	-168.7	178.9	-39.2	0	0	110.9	L24 S42 W54 Y107 C109	L24-Q26 HydrophobicContact CD2-CB 4.4Å; Q26-S42 CarbonylContact C-O 3.56Å; Q26-S42 VanDerWaalsContact CA-O 3.27Å; Q26-S42 WeakPolarHBondContact CA-O 3.31Å; Q26-S42 WeakPolarHBondContact CG-O 3.49Å; Q26-W54 HydrophobicContact CG-CH2 4.31Å; Q26-W54 HydrophobicContact CG-CZ3 4.46Å; Q26-Y107 PolarHBondContact NE2-O 3.29Å; Q26-C109 PolarHBondContact OE1-SG 3.37Å; Q26-C109 VanDerWaalsContact OE1-SG 3.37Å
27	S	95.1	Very high	82.9	Confident	42 Å²	42	104.9 Å²	104.9	29%	0.294	57%	0.568	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-143.5	150.3	176.9	70.9	0	0	0	0	112.4	M41 S42	S27-M41 CarbonylContact O-C 3.55Å; S27-M41 WeakPolarHBondContact O-CA 3.36Å; S27-S42 PolarHBondContact N-O 2.96Å; S27-S42 PolarHBondContact O-N 2.83Å; S27-S42 PolarHBondContact OG-OG 2.81Å
28	P	95.9	Very high	84.7	Confident	55 Å²	55	106.1 Å²	106.1	36%	0.357	56%	0.559	S	S	.	*			cis	-67.4	161.5	-15.3	33	-36.7	0	0	0	111.2	L31 T40	P28-L31 HydrophobicContact CG-CB 4.3Å; P28-L31 HydrophobicContact CG-CD2 3.55Å; P28-T40 WeakPolarHBondContact CD-O 3.47Å
29	Q	93.7	Very high	86.6	Confident	185 Å²	185	96.2 Å²	96.2	86%	0.864	52%	0.523	S	S	*	.	S	Bend	trans	-75.2	-31.1	177.7	-69.6	-176.3	-16.4	0	0	112.6
30	S	94.6	Very high	88.5	Confident	104 Å²	104	94.1 Å²	94.1	73%	0.727	51%	0.51	S	S	*	.			trans	-153.4	153.1	174.3	61.2	0	0	0	0	108.7
31	L	94.8	Very high	90.4	Very high	71 Å²	71	87.4 Å²	87.4	37%	0.372	47%	0.474	S	S	.	.			trans	-149.2	149.9	176.9	56.9	129.1	0	0	0	109.5	P28 I33 V39 M41	P28-L31 HydrophobicContact CG-CB 4.3Å; P28-L31 HydrophobicContact CG-CD2 3.55Å; L31-I33 HydrophobicContact CD1-CG1 4.13Å; L31-I33 HydrophobicContact CD1-CG2 3.68Å; L31-V39 HydrophobicContact CD1-CB 4.27Å; L31-V39 HydrophobicContact CD1-CG1 3.56Å; L31-V39 HydrophobicContact CD1-CG2 3.77Å; L31-V39 HydrophobicContact CD2-CG1 4.12Å; L31-M41 HydrophobicContact CD2-CG 4.4Å
32	T	95.4	Very high	92.1	Very high	144 Å²	144	83 Å²	83	88%	0.883	45%	0.447	S	S	*	.			trans	-124.8	124.4	168.4	-58.7	0	0	0	0	106.6
33	I	93.8	Very high	93.5	Very high	61 Å²	61	77.6 Å²	77.6	31%	0.313	42%	0.422	S	S	.	.			trans	-134.2	162.4	-173.5	54.5	138.2	0	0	0	109.8	L31 D37 V39 S99	L31-I33 HydrophobicContact CD1-CG1 4.13Å; L31-I33 HydrophobicContact CD1-CG2 3.68Å; I33-D37 HydrophobicContact CB-CB 4.28Å; I33-D37 HydrophobicContact CD1-CB 4.19Å; I33-V39 HydrophobicContact CD1-CG2 3.2Å; I33-V39 HydrophobicContact CG1-CG2 3.97Å; I33-S99 WeakPolarHBondContact CD1-OG 3.47Å
34	Q	96.1	Very high	94.2	Very high	141 Å²	141	73.4 Å²	73.4	66%	0.659	40%	0.403	S	S	*	.			trans	-84.5	155.4	174.6	-62.2	-61.9	-42.9	0	0	110.8	G36 D37 S99	Q34-G36 PolarHBondContact O-N 2.88Å; Q34-D37 WeakPolarHBondContact CB-OD2 3.32Å; Q34-D37 PolarHBondContact N-OD2 3.39Å; Q34-D37 VanDerWaalsContact O-CB 3.31Å; Q34-D37 WeakPolarHBondContact O-CB 3.29Å; Q34-D37 PolarHBondContact O-N 3.5Å; Q34-D37 VanDerWaalsContact O-N 3.16Å; Q34-S99 PolarHBondContact O-OG 2.98Å
35	E	96.1	Very high	94.1	Very high	138 Å²	138	71.3 Å²	71.3	65%	0.645	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	135.9	170.8	-171	177.5	165.2	0	0	110.1	D37 S99	E35-D37 VanDerWaalsContact C-N 3.32Å; E35-S99 WeakPolarHBondContact CA-OG 3.41Å; E35-S99 VanDerWaalsContact CG-O 3.28Å; E35-S99 WeakPolarHBondContact CG-O 3.41Å
36	G	95.1	Very high	93.5	Very high	47 Å²	47	69.8 Å²	69.8	49%	0.485	39%	0.393	S	S	.	.	T	Hydrogen-bonded Turn	trans	90	-17.7	-175.8	0	0	0	0	0	114.7	Q34 A98 S99	Q34-G36 PolarHBondContact O-N 2.88Å; G36-A98 WeakPolarHBondContact O-CA 3.08Å; G36-S99 PolarHBondContact N-O 3.3Å; G36-S99 PolarHBondContact N-OG 3.18Å
37	D	95.5	Very high	92.6	Very high	76 Å²	76	70.7 Å²	70.7	41%	0.406	40%	0.401	S	S	.	.			trans	-68.4	158.1	175.8	-69	-18.1	0	0	0	111.9	I33 Q34 E35 S99	I33-D37 HydrophobicContact CB-CB 4.28Å; I33-D37 HydrophobicContact CD1-CB 4.19Å; Q34-D37 WeakPolarHBondContact CB-OD2 3.32Å; Q34-D37 PolarHBondContact N-OD2 3.39Å; Q34-D37 VanDerWaalsContact O-CB 3.31Å; Q34-D37 WeakPolarHBondContact O-CB 3.29Å; Q34-D37 PolarHBondContact O-N 3.5Å; Q34-D37 VanDerWaalsContact O-N 3.16Å; E35-D37 VanDerWaalsContact C-N 3.32Å; D37-S99 PolarHBondContact N-OG 3.42Å; D37-S99 VanDerWaalsContact O-CB 3.23Å; D37-S99 WeakPolarHBondContact O-CB 3.4Å; D37-S99 PolarHBondContact O-N 3.39Å; D37-S99 PolarHBondContact O-OG 3.39Å
38	E	94.4	Very high	91.5	Very high	115 Å²	115	71.8 Å²	71.8	54%	0.537	41%	0.409	S	S	.	.			trans	-87.1	135.8	171.8	-171.4	176	115.1	0	0	111	I96	E38-I96 WeakPolarHBondContact CA-O 3.44Å
39	V	94.8	Very high	90.4	Very high	13 Å²	13	69.9 Å²	69.9	8%	0.079	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	132.2	170.1	-179.5	0	0	0	0	109.2	L31 I33 M41 W95 I96	L31-V39 HydrophobicContact CD1-CB 4.27Å; L31-V39 HydrophobicContact CD1-CG1 3.56Å; L31-V39 HydrophobicContact CD1-CG2 3.77Å; L31-V39 HydrophobicContact CD2-CG1 4.12Å; I33-V39 HydrophobicContact CD1-CG2 3.2Å; I33-V39 HydrophobicContact CG1-CG2 3.97Å; V39-M41 HydrophobicContact CG1-CE 3.98Å; V39-M41 HydrophobicContact CG1-CG 4.25Å; V39-W95 CarbonylContact O-C 3.53Å; V39-W95 VanDerWaalsContact O-CA 3.27Å; V39-W95 WeakPolarHBondContact O-CA 3.25Å; V39-I96 HydrophobicContact CB-CB 4.11Å; V39-I96 HydrophobicContact CB-CG1 4.41Å; V39-I96 PolarHBondContact N-O 3.45Å; V39-I96 PolarHBondContact O-N 3.37Å
40	T	96	Very high	89.6	Confident	63 Å²	63	69.8 Å²	69.8	39%	0.387	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	129.2	166.5	-59.3	0	0	0	0	109.9	P28 L94	P28-T40 WeakPolarHBondContact CD-O 3.47Å; T40-L94 WeakPolarHBondContact CA-O 3.44Å
41	M	96.4	Very high	89	Confident	9 Å²	9	65.5 Å²	65.5	4%	0.044	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	141.2	168.8	-67.4	167	-81.7	0	0	108.9	S27 L31 V39 W54 S93 L94 I96 Y107	S27-M41 CarbonylContact O-C 3.55Å; S27-M41 WeakPolarHBondContact O-CA 3.36Å; L31-M41 HydrophobicContact CD2-CG 4.4Å; V39-M41 HydrophobicContact CG1-CE 3.98Å; V39-M41 HydrophobicContact CG1-CG 4.25Å; M41-W54 HydrophobicContact CB-CH2 3.86Å; M41-W54 HydrophobicContact CB-CZ3 4.22Å; M41-S93 CarbonylContact O-C 3.57Å; M41-S93 VanDerWaalsContact O-CA 3.3Å; M41-S93 WeakPolarHBondContact O-CA 3.27Å; M41-L94 HydrophobicContact CB-CB 4.46Å; M41-L94 HydrophobicContact CE-CD2 3.6Å; M41-L94 HydrophobicContact CE-CG 4.3Å; M41-L94 PolarHBondContact N-O 2.6Å; M41-L94 PolarHBondContact O-N 3.28Å; M41-I96 HydrophobicContact CE-CD1 4.09Å; M41-I96 HydrophobicContact CE-CG1 4.48Å; M41-Y107 HydrophobicContact CE-CD1 4.13Å; M41-Y107 HydrophobicContact CE-CD2 4.05Å; M41-Y107 HydrophobicContact CE-CG 3.79Å; M41-Y107 HydrophobicContact SD-CD2 4.25Å; M41-Y107 HydrophobicContact SD-CG 4.01Å
42	S	95.3	Very high	88.8	Confident	18 Å²	18	62.1 Å²	62.1	13%	0.126	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	152.2	179	81.4	0	0	0	0	111.1	Q26 S27 S92	Q26-S42 CarbonylContact C-O 3.56Å; Q26-S42 VanDerWaalsContact CA-O 3.27Å; Q26-S42 WeakPolarHBondContact CA-O 3.31Å; Q26-S42 WeakPolarHBondContact CG-O 3.49Å; S27-S42 PolarHBondContact N-O 2.96Å; S27-S42 PolarHBondContact O-N 2.83Å; S27-S42 PolarHBondContact OG-OG 2.81Å; S42-S92 CarbonylContact C-O 3.53Å; S42-S92 VanDerWaalsContact CA-O 3.31Å; S42-S92 WeakPolarHBondContact CA-O 3.01Å
43	C	93.4	Very high	88.6	Confident	0 Å²	0	55.7 Å²	55.7	0%	0	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.3	110.6	-177.1	-175	0	0	0	0	109.6	L24 H25 L52 W54 Q91 S92 C109	L24-C43 WeakPolarHBondContact CD1-SG 3.27Å; L24-C43 VanDerWaalsContact CG-SG 3.51Å; H25-C43 WeakPolarHBondContact O-CA 3.43Å; C43-L52 HydrophobicContact CB-CD1 4.24Å; C43-W54 HydrophobicContact CB-CH2 3.91Å; C43-W54 HydrophobicContact CB-CZ2 3.67Å; C43-Q91 CarbonylContact O-C 3.51Å; C43-Q91 WeakPolarHBondContact O-CA 3.47Å; C43-S92 PolarHBondContact N-O 2.99Å; C43-S92 PolarHBondContact O-N 2.98Å; C43-C109 HydrophobicContact CB-CB 3.6Å; C43-C109 WeakPolarHBondContact CB-SG 3.35Å; C43-C109 WeakPolarHBondContact SG-CB 3.47Å; C43-C109 CovalentContact SG-SG 2.02Å; C43-C109 PolarHBondContact SG-SG 2.96Å
44	N	90.1	Very high	88.6	Confident	52 Å²	52	52.8 Å²	52.8	28%	0.278	29%	0.287	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	138.9	177.9	-63.8	-44.7	0	0	0	110.2	L24 H25 Q91	L24-N44 WeakPolarHBondContact CA-O 3.37Å; H25-N44 HydrophobicContact CB-CB 4.36Å; H25-N44 PolarHBondContact N-O 2.93Å; H25-N44 PolarHBondContact O-N 2.87Å; N44-Q91 VanDerWaalsContact OD1-CB 3.27Å; N44-Q91 WeakPolarHBondContact OD1-CB 3.36Å; N44-Q91 WeakPolarHBondContact OD1-CG 3.46Å; N44-Q91 PolarHBondContact OD1-NE2 3.11Å
45	L	83.3	Confident	88.6	Confident	19 Å²	19	48.3 Å²	48.3	10%	0.099	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	132.1	177	-51.9	99.6	0	0	0	110.2	T47 L49 L52 L85 Q90	L45-T47 WeakPolarHBondContact CB-O 3.44Å; L45-T47 PolarHBondContact O-N 2.88Å; L45-L49 HydrophobicContact CD2-CB 4.01Å; L45-L49 HydrophobicContact CD2-CD1 3.15Å; L45-L49 HydrophobicContact CD2-CG 3.5Å; L45-L52 HydrophobicContact CD1-CD1 3.66Å; L45-L52 HydrophobicContact CD2-CD1 4.18Å; L45-L52 HydrophobicContact CG-CD1 4.22Å; L45-L85 HydrophobicContact CD1-CD1 4.44Å; L45-Q90 HydrophobicContact CB-CB 4.34Å; L45-Q90 HydrophobicContact CD1-CB 4.48Å; L45-Q90 WeakPolarHBondContact CD1-O 3.45Å; L45-Q90 PolarHBondContact N-O 3.4Å
46	S	78.8	Confident	88.5	Confident	76 Å²	76	45.2 Å²	45.2	53%	0.531	25%	0.247	S	C	.	.	S	Bend	trans	-72.6	-16.5	173.8	68.8	0	0	0	0	113.4	M23	M23-S46 PolarHBondContact N-OG 2.75Å; M23-S46 VanDerWaalsContact O-CB 3.26Å; M23-S46 WeakPolarHBondContact O-CB 3.31Å; M23-S46 PolarHBondContact O-N 2.75Å; M23-S46 PolarHBondContact O-OG 2.88Å; M23-S46 VanDerWaalsContact O-OG 3.11Å
47	T	75.8	Confident	88.5	Confident	55 Å²	55	46.6 Å²	46.6	34%	0.337	24%	0.241	S	C	.	.	S	Bend	trans	-135.9	155.5	-177.7	57.2	0	0	0	0	110.8	L45 L49	L45-T47 WeakPolarHBondContact CB-O 3.44Å; L45-T47 PolarHBondContact O-N 2.88Å; T47-L49 PolarHBondContact O-N 2.8Å
48	S	73	Confident	88.4	Confident	66 Å²	66	44 Å²	44	46%	0.462	23%	0.232	S	C	.	.			trans	-76.5	119.3	-179.2	-165.3	0	0	0	0	111.4	K71 Q90	S48-K71 WeakPolarHBondContact OG-CE 3.41Å; S48-K71 PolarHBondContact OG-NZ 3.12Å; S48-Q90 PolarHBondContact OG-NE2 2.8Å
49	L	72	Confident	88.3	Confident	14 Å²	14	47.4 Å²	47.4	7%	0.073	25%	0.254	C	S	.	.			trans	-103.8	160.5	178.8	-62.4	-166.3	0	0	0	113	L45 T47 K71	L45-L49 HydrophobicContact CD2-CB 4.01Å; L45-L49 HydrophobicContact CD2-CD1 3.15Å; L45-L49 HydrophobicContact CD2-CG 3.5Å; T47-L49 PolarHBondContact O-N 2.8Å; L49-K71 WeakPolarHBondContact O-CD 3.23Å
50	Y	75.9	Confident	88.3	Confident	184 Å²	184	52.9 Å²	52.9	72%	0.722	28%	0.283	S	S	*	.	S	Bend	trans	-80.3	-32.2	175.8	-72.9	-78.4	0	0	0	111.4	K71 K112	Y50-K71 VanDerWaalsContact O-CB 3.29Å; Y50-K71 WeakPolarHBondContact O-CB 3.3Å; Y50-K71 PolarHBondContact O-N 2.82Å; Y50-K112 PolarHBondContact N-O 3.4Å
51	A	83.1	Confident	88.1	Confident	13 Å²	13	51.7 Å²	51.7	11%	0.107	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.8	155.9	173.6	0	0	0	0	0	112	L53 L69 K112	A51-L53 HydrophobicContact CB-CD1 4.35Å; A51-L69 CarbonylContact C-O 3.55Å; A51-L69 VanDerWaalsContact CA-O 3.23Å; A51-L69 WeakPolarHBondContact CA-O 3.39Å; A51-L69 WeakPolarHBondContact CB-O 3.48Å; A51-K112 HydrophobicContact CB-CB 4.31Å; A51-K112 PolarHBondContact N-O 3.34Å; A51-K112 VanDerWaalsContact N-O 3.12Å; A51-K112 PolarHBondContact O-N 3.39Å
52	L	90.1	Very high	88	Confident	1 Å²	1	53.5 Å²	53.5	1%	0.005	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	139.3	167.7	-178.3	148.3	0	0	0	109.4	C43 L45 W54 L69 L85 S92 C109	C43-L52 HydrophobicContact CB-CD1 4.24Å; L45-L52 HydrophobicContact CD1-CD1 3.66Å; L45-L52 HydrophobicContact CD2-CD1 4.18Å; L45-L52 HydrophobicContact CG-CD1 4.22Å; L52-W54 HydrophobicContact CD2-CG 4.34Å; L52-L69 HydrophobicContact CD2-CD1 4.19Å; L52-L69 PolarHBondContact N-O 2.82Å; L52-L69 PolarHBondContact O-N 2.76Å; L52-L85 HydrophobicContact CB-CD1 4.42Å; L52-S92 VanDerWaalsContact CD1-CB 3.47Å; L52-S92 WeakPolarHBondContact CD2-OG 3.33Å; L52-C109 HydrophobicContact CD2-CB 4.42Å
53	L	91.3	Very high	88	Confident	9 Å²	9	57.2 Å²	57.2	5%	0.047	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	136	178.3	-70.7	83.3	0	0	0	109.6	A51 Y55 V67 T68 C109 G110 K112	A51-L53 HydrophobicContact CB-CD1 4.35Å; L53-Y55 HydrophobicContact CB-CD2 4.38Å; L53-Y55 HydrophobicContact CB-CE1 4.41Å; L53-Y55 HydrophobicContact CB-CE2 3.58Å; L53-Y55 HydrophobicContact CD2-CE1 4.39Å; L53-Y55 WeakPolarHBondContact CD2-OH 3.39Å; L53-V67 WeakPolarHBondContact CA-O 3.34Å; L53-T68 HydrophobicContact CD1-CG2 4.17Å; L53-T68 HydrophobicContact CD2-CG2 4.38Å; L53-T68 WeakPolarHBondContact CD2-OG1 3.25Å; L53-T68 HydrophobicContact CG-CG2 3.98Å; L53-C109 CarbonylContact O-C 3.5Å; L53-C109 VanDerWaalsContact O-CA 3.3Å; L53-C109 WeakPolarHBondContact O-CA 3.38Å; L53-G110 PolarHBondContact N-O 2.87Å; L53-G110 PolarHBondContact O-N 3.14Å; L53-K112 HydrophobicContact CD1-CB 4.25Å; L53-K112 HydrophobicContact CD1-CD 3.96Å; L53-K112 HydrophobicContact CD1-CG 3.94Å
54	W	94.4	Very high	88	Confident	0 Å²	0	61 Å²	61	0%	0	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.2	135.6	164.8	-76.7	99.2	0	0	0	109.3	Q26 M41 C43 L52 L66 V67 S92 L94 C109	Q26-W54 HydrophobicContact CG-CH2 4.31Å; Q26-W54 HydrophobicContact CG-CZ3 4.46Å; M41-W54 HydrophobicContact CB-CH2 3.86Å; M41-W54 HydrophobicContact CB-CZ3 4.22Å; C43-W54 HydrophobicContact CB-CH2 3.91Å; C43-W54 HydrophobicContact CB-CZ2 3.67Å; L52-W54 HydrophobicContact CD2-CG 4.34Å; W54-L66 HydrophobicContact CB-CB 4.48Å; W54-L66 WeakPolarHBondContact O-CB 3.45Å; W54-L66 PolarHBondContact O-N 2.02Å; W54-V67 PolarHBondContact N-O 2.9Å; W54-V67 PolarHBondContact O-N 2.9Å; W54-S92 PolarHBondContact NE1-OG 2.79Å; W54-L94 HydrophobicContact CB-CD1 4.22Å; W54-L94 HydrophobicContact CB-CD2 4.46Å; W54-L94 HydrophobicContact CD2-CB 3.8Å; W54-L94 HydrophobicContact CD2-CD1 4.23Å; W54-L94 HydrophobicContact CD2-CD2 3.84Å; W54-L94 HydrophobicContact CD2-CG 4.19Å; W54-L94 HydrophobicContact CE3-CB 4.16Å; W54-L94 HydrophobicContact CE3-CD2 3.66Å; W54-L94 HydrophobicContact CE3-CG 4.43Å; W54-L94 HydrophobicContact CG-CB 4.32Å; W54-L94 HydrophobicContact CG-CD1 3.92Å; W54-L94 HydrophobicContact CG-CD2 4.2Å; W54-L94 HydrophobicContact CG-CG 4.4Å; W54-L94 HydrophobicContact CH2-CB 4.07Å; W54-L94 HydrophobicContact CZ2-CB 3.73Å; W54-L94 HydrophobicContact CZ3-CB 4.28Å; W54-L94 HydrophobicContact CZ3-CD2 4.16Å; W54-C109 HydrophobicContact CD2-CB 4.02Å; W54-C109 HydrophobicContact CE3-CB 3.87Å; W54-C109 HydrophobicContact CH2-CB 4.02Å; W54-C109 HydrophobicContact CZ2-CB 4.14Å; W54-C109 HydrophobicContact CZ3-CB 3.88Å
55	Y	94.9	Very high	88.1	Confident	46 Å²	46	61.2 Å²	61.2	18%	0.18	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	150.1	179.2	-56.9	-88.8	0	0	0	109.9	L53 L63 V64 Y107 L108	L53-Y55 HydrophobicContact CB-CD2 4.38Å; L53-Y55 HydrophobicContact CB-CE1 4.41Å; L53-Y55 HydrophobicContact CB-CE2 3.58Å; L53-Y55 HydrophobicContact CD2-CE1 4.39Å; L53-Y55 WeakPolarHBondContact CD2-OH 3.39Å; Y55-L63 HydrophobicContact CD1-CB 3.85Å; Y55-L63 HydrophobicContact CG-CB 4.19Å; Y55-V64 CarbonylContact C-O 3.52Å; Y55-V64 VanDerWaalsContact CA-O 3.25Å; Y55-V64 WeakPolarHBondContact CA-O 3.35Å; Y55-Y107 WeakPolarHBondContact O-CA 3.31Å; Y55-L108 WeakPolarHBondContact CD2-O 3.32Å; Y55-L108 PolarHBondContact N-O 2.79Å; Y55-L108 PolarHBondContact O-N 3.43Å
56	R	95.1	Very high	88.5	Confident	74 Å²	74	62.2 Å²	62.2	28%	0.279	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	134.6	159.7	-169.1	172.5	178.8	174.2	2	108.1	V64 L66 S102 S104 Y107	R56-V64 PolarHBondContact N-O 2.94Å; R56-V64 PolarHBondContact O-N 3.37Å; R56-L66 HydrophobicContact CB-CD1 3.95Å; R56-L66 HydrophobicContact CB-CD2 3.97Å; R56-L66 HydrophobicContact CB-CG 3.96Å; R56-S102 VanDerWaalsContact CZ-O 3.3Å; R56-S102 PolarHBondContact NH1-O 2.89Å; R56-S102 PolarHBondContact NH2-O 3.18Å; R56-S104 PolarHBondContact NH2-O 2.88Å; R56-Y107 HydrophobicContact CG-CE1 4.46Å
57	Q	95.9	Very high	89.2	Confident	75 Å²	75	59 Å²	59	35%	0.35	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.7	126.4	170.9	-164.6	170.9	28.7	0	0	109.2	S62 T106	Q57-S62 CarbonylContact C-O 3.57Å; Q57-S62 WeakPolarHBondContact CA-O 3.17Å; Q57-T106 HydrophobicContact CB-CG2 4.32Å; Q57-T106 PolarHBondContact N-O 3.02Å
58	G	93.3	Very high	89.8	Confident	22 Å²	22	58.7 Å²	58.7	23%	0.227	32%	0.323	C	S	.	.			trans	-74.2	165.7	169.6	0	0	0	0	0	111.5	D60 G61 S62	G58-D60 PolarHBondContact O-N 3.05Å; G58-G61 WeakPolarHBondContact O-CA 3.29Å; G58-G61 PolarHBondContact O-N 3.19Å; G58-S62 PolarHBondContact N-O 3.44Å
59	D	90.7	Very high	90.6	Very high	186 Å²	186	55.6 Å²	55.6	100%	0.995	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.7	-24.3	-179.2	-58.4	-28.8	0	0	0	112.6	G61	D59-G61 VanDerWaalsContact C-N 3.26Å; D59-G61 PolarHBondContact O-N 2.61Å
60	D	94.4	Very high	91.3	Very high	129 Å²	129	60.7 Å²	60.7	69%	0.69	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.1	1.8	174.1	69.8	-20.7	0	0	0	113.5	G58 S62	G58-D60 PolarHBondContact O-N 3.05Å; D60-S62 VanDerWaalsContact C-N 3.29Å; D60-S62 WeakPolarHBondContact OD1-CB 3.39Å; D60-S62 PolarHBondContact OD1-N 2.71Å; D60-S62 PolarHBondContact OD1-OG 2.8Å; D60-S62 PolarHBondContact OD2-OG 2.84Å
61	G	93.3	Very high	91.1	Very high	37 Å²	37	56.4 Å²	56.4	38%	0.381	31%	0.31	S	S	.	.	S	Bend	trans	83	-1.6	-176.3	0	0	0	0	0	114.6	G58 D59	G58-G61 WeakPolarHBondContact O-CA 3.29Å; G58-G61 PolarHBondContact O-N 3.19Å; D59-G61 VanDerWaalsContact C-N 3.26Å; D59-G61 PolarHBondContact O-N 2.61Å
62	S	94.8	Very high	90.3	Very high	48 Å²	48	57.9 Å²	57.9	34%	0.336	33%	0.327	S	S	.	.			trans	-67.2	149.9	178.6	68	0	0	0	0	112	Q57 G58 D60	Q57-S62 CarbonylContact C-O 3.57Å; Q57-S62 WeakPolarHBondContact CA-O 3.17Å; G58-S62 PolarHBondContact N-O 3.44Å; D60-S62 VanDerWaalsContact C-N 3.29Å; D60-S62 WeakPolarHBondContact OD1-CB 3.39Å; D60-S62 PolarHBondContact OD1-N 2.71Å; D60-S62 PolarHBondContact OD1-OG 2.8Å; D60-S62 PolarHBondContact OD2-OG 2.84Å
63	L	95.1	Very high	89.1	Confident	96 Å²	96	60.1 Å²	60.1	50%	0.503	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	107.1	175.8	-61.9	-175.4	0	0	0	110.2	Y55 L108	Y55-L63 HydrophobicContact CD1-CB 3.85Å; Y55-L63 HydrophobicContact CG-CB 4.19Å; L63-L108 HydrophobicContact CD2-CD1 3.62Å
64	V	93.6	Very high	88.1	Confident	78 Å²	78	61.9 Å²	61.9	47%	0.473	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	120.3	175.9	-176.2	0	0	0	0	108.9	Y55 R56 L66	Y55-V64 CarbonylContact C-O 3.52Å; Y55-V64 VanDerWaalsContact CA-O 3.25Å; Y55-V64 WeakPolarHBondContact CA-O 3.35Å; R56-V64 PolarHBondContact N-O 2.94Å; R56-V64 PolarHBondContact O-N 3.37Å; V64-L66 PolarHBondContact O-N 2.75Å
65	S	91.9	Very high	87.5	Confident	57 Å²	57	68.8 Å²	68.8	40%	0.399	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.8	124.9	178.2	-173	0	0	0	0	110.8
66	L	92	Very high	87.1	Confident	40 Å²	40	70.4 Å²	70.4	21%	0.209	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.8	-56.2	173.8	-67.2	174	0	0	0	110.8	W54 R56 V64 Y107	W54-L66 HydrophobicContact CB-CB 4.48Å; W54-L66 WeakPolarHBondContact O-CB 3.45Å; W54-L66 PolarHBondContact O-N 2.02Å; R56-L66 HydrophobicContact CB-CD1 3.95Å; R56-L66 HydrophobicContact CB-CD2 3.97Å; R56-L66 HydrophobicContact CB-CG 3.96Å; V64-L66 PolarHBondContact O-N 2.75Å; L66-Y107 HydrophobicContact CD1-CD1 3.56Å; L66-Y107 HydrophobicContact CD1-CE1 3.56Å
67	V	91.6	Very high	86.6	Confident	9 Å²	9	70.8 Å²	70.8	6%	0.055	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.4	138.4	-172.7	-176.5	0	0	0	0	109.6	L53 W54 L69 K76 A83	L53-V67 WeakPolarHBondContact CA-O 3.34Å; W54-V67 PolarHBondContact N-O 2.9Å; W54-V67 PolarHBondContact O-N 2.9Å; V67-L69 HydrophobicContact CG1-CD2 3.7Å; V67-L69 HydrophobicContact CG1-CG 4.02Å; V67-K76 HydrophobicContact CG1-CB 3.56Å; V67-K76 HydrophobicContact CG1-CD 4.02Å; V67-K76 HydrophobicContact CG1-CG 4.33Å; V67-A83 HydrophobicContact CB-CB 4.25Å; V67-A83 HydrophobicContact CG1-CB 4.02Å; V67-A83 HydrophobicContact CG2-CB 4.37Å
68	T	90	Very high	85.9	Confident	49 Å²	49	73 Å²	73	30%	0.301	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	120.9	170.9	-61.1	0	0	0	0	109.5	L53 K76	L53-T68 HydrophobicContact CD1-CG2 4.17Å; L53-T68 HydrophobicContact CD2-CG2 4.38Å; L53-T68 WeakPolarHBondContact CD2-OG1 3.25Å; L53-T68 HydrophobicContact CG-CG2 3.98Å; T68-K76 VanDerWaalsContact O-CD 3.32Å; T68-K76 WeakPolarHBondContact O-CD 3.22Å; T68-K76 WeakPolarHBondContact O-CE 3.34Å; T68-K76 PolarHBondContact O-NZ 3.43Å
69	L	89.8	Confident	85.3	Confident	0 Å²	0	77.7 Å²	77.7	0%	0	44%	0.442	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	118.1	-178.3	-56.6	170.4	0	0	0	108.4	A51 L52 V67 D74 K76 A83 N84 L85 S92	A51-L69 CarbonylContact C-O 3.55Å; A51-L69 VanDerWaalsContact CA-O 3.23Å; A51-L69 WeakPolarHBondContact CA-O 3.39Å; A51-L69 WeakPolarHBondContact CB-O 3.48Å; L52-L69 HydrophobicContact CD2-CD1 4.19Å; L52-L69 PolarHBondContact N-O 2.82Å; L52-L69 PolarHBondContact O-N 2.76Å; V67-L69 HydrophobicContact CG1-CD2 3.7Å; V67-L69 HydrophobicContact CG1-CG 4.02Å; L69-D74 HydrophobicContact CD2-CB 4.37Å; L69-D74 WeakPolarHBondContact CD2-O 3.16Å; L69-K76 HydrophobicContact CD2-CB 4.24Å; L69-K76 HydrophobicContact CD2-CD 4.35Å; L69-K76 HydrophobicContact CD2-CG 4.22Å; L69-A83 HydrophobicContact CD1-CB 3.9Å; L69-A83 HydrophobicContact CD2-CB 4.31Å; L69-A83 HydrophobicContact CG-CB 4.47Å; L69-N84 VanDerWaalsContact CD1-C 3.44Å; L69-N84 VanDerWaalsContact CD1-O 3.22Å; L69-N84 WeakPolarHBondContact CD1-O 3.43Å; L69-L85 HydrophobicContact CB-CB 4.02Å; L69-L85 HydrophobicContact CB-CD2 4.44Å; L69-L85 HydrophobicContact CD1-CB 4.1Å; L69-S92 WeakPolarHBondContact CD1-OG 3.34Å
70	Q	85.5	Confident	85.1	Confident	122 Å²	122	73.9 Å²	73.9	57%	0.57	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.9	166.4	178	-63.8	-173.2	5	0	0	110	G72 D74	Q70-G72 PolarHBondContact O-N 2.77Å; Q70-D74 PolarHBondContact N-OD2 2.78Å
71	K	71.8	Confident	84.9	Confident	93 Å²	93	68.4 Å²	68.4	40%	0.404	39%	0.387	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.2	46.7	168.5	-159.2	178.2	-169	161.8	0	111.9	S48 L49 Y50 K87	S48-K71 WeakPolarHBondContact OG-CE 3.41Å; S48-K71 PolarHBondContact OG-NZ 3.12Å; L49-K71 WeakPolarHBondContact O-CD 3.23Å; Y50-K71 VanDerWaalsContact O-CB 3.29Å; Y50-K71 WeakPolarHBondContact O-CB 3.3Å; Y50-K71 PolarHBondContact O-N 2.82Å; K71-K87 VanDerWaalsContact C-CE 3.42Å; K71-K87 HydrophobicContact CG-CD 4.38Å; K71-K87 WeakPolarHBondContact O-CE 3.39Å; K71-K87 PolarHBondContact O-NZ 2.87Å
72	G	66.7	Low	85	Confident	44 Å²	44	67.4 Å²	67.4	45%	0.454	37%	0.374	S	S	.	.	T	Hydrogen-bonded Turn	trans	-114.6	-25.2	178.7	0	0	0	0	0	112.9	Q70 K87	Q70-G72 PolarHBondContact O-N 2.77Å; G72-K87 VanDerWaalsContact CA-CE 3.49Å; G72-K87 WeakPolarHBondContact O-CE 3.36Å; G72-K87 PolarHBondContact O-NZ 3.36Å
73	G	65.1	Low	85	Confident	48 Å²	48	65.1 Å²	65.1	50%	0.495	36%	0.358	S	S	.	.	T	Hydrogen-bonded Turn	trans	84.7	69.7	-172.4	0	0	0	0	0	106.1
74	D	69.6	Low	84.8	Confident	46 Å²	46	62.7 Å²	62.7	25%	0.246	35%	0.345	C	S	.	.			trans	-107.4	128.1	-176	-55.1	-29.1	0	0	0	107.2	L69 Q70 K76	L69-D74 HydrophobicContact CD2-CB 4.37Å; L69-D74 WeakPolarHBondContact CD2-O 3.16Å; Q70-D74 PolarHBondContact N-OD2 2.78Å; D74-K76 HydrophobicContact CB-CG 4.37Å
75	E	83.3	Confident	84.7	Confident	145 Å²	145	59.8 Å²	59.8	68%	0.678	33%	0.327	S	S	*	.			trans	-94.1	131.2	156.4	-174.7	175.2	106.8	0	0	107	T82 A83	E75-T82 HydrophobicContact CG-CG2 3.61Å; E75-A83 WeakPolarHBondContact CA-O 3.21Å
76	K	84.8	Confident	84.5	Confident	81 Å²	81	60 Å²	60	35%	0.352	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	133.7	177.2	-69.7	-173.3	-177.4	178.9	0	109.6	V67 T68 L69 D74 T82 A83	V67-K76 HydrophobicContact CG1-CB 3.56Å; V67-K76 HydrophobicContact CG1-CD 4.02Å; V67-K76 HydrophobicContact CG1-CG 4.33Å; T68-K76 VanDerWaalsContact O-CD 3.32Å; T68-K76 WeakPolarHBondContact O-CD 3.22Å; T68-K76 WeakPolarHBondContact O-CE 3.34Å; T68-K76 PolarHBondContact O-NZ 3.43Å; L69-K76 HydrophobicContact CD2-CB 4.24Å; L69-K76 HydrophobicContact CD2-CD 4.35Å; L69-K76 HydrophobicContact CD2-CG 4.22Å; D74-K76 HydrophobicContact CB-CG 4.37Å; K76-T82 CarbonylContact O-C 3.53Å; K76-T82 VanDerWaalsContact O-CA 3.32Å; K76-T82 WeakPolarHBondContact O-CA 3.3Å; K76-A83 PolarHBondContact N-O 2.87Å; K76-A83 PolarHBondContact O-N 3.13Å
77	S	85.1	Confident	84	Confident	81 Å²	81	62.1 Å²	62.1	57%	0.566	33%	0.331	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.2	137.6	177.4	-165.4	0	0	0	0	110.6	I81 T82	S77-I81 CarbonylContact C-O 3.55Å; S77-I81 VanDerWaalsContact CA-O 3.29Å; S77-I81 WeakPolarHBondContact CA-O 3.48Å; S77-T82 WeakPolarHBondContact CB-OG1 3.23Å; S77-T82 PolarHBondContact OG-OG1 2.92Å
78	K	81.4	Confident	83.5	Confident	121 Å²	121	71.2 Å²	71.2	53%	0.526	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.9	130	172.8	-176.9	-178.4	175.2	-170.8	0	108.3	K80 I81	K78-K80 VanDerWaalsContact C-N 3.33Å; K78-K80 PolarHBondContact O-N 2.96Å; K78-I81 PolarHBondContact N-O 2.92Å; K78-I81 WeakPolarHBondContact O-CA 3.16Å; K78-I81 VanDerWaalsContact O-CB 3.31Å; K78-I81 WeakPolarHBondContact O-CB 3.41Å; K78-I81 PolarHBondContact O-N 2.95Å; K78-I81 VanDerWaalsContact O-O 3.12Å
79	D	81.9	Confident	83.2	Confident	122 Å²	122	74.7 Å²	74.7	65%	0.652	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.7	45.8	173	-54.3	-35.7	0	0	0	114.2	I81	D79-I81 PolarHBondContact O-N 2.77Å
80	K	85.6	Confident	83	Confident	106 Å²	106	76.4 Å²	76.4	46%	0.461	39%	0.392	S	S	.	.	T	Hydrogen-bonded Turn	trans	64.7	8	-175.3	-52.8	177.8	178.3	-180	0	115.6	K78 Q97 Q100	K78-K80 VanDerWaalsContact C-N 3.33Å; K78-K80 PolarHBondContact O-N 2.96Å; K80-Q97 PolarHBondContact O-N 3.4Å; K80-Q100 VanDerWaalsContact NZ-NE2 3.12Å
81	I	91.3	Very high	83.2	Confident	13 Å²	13	72.9 Å²	72.9	7%	0.067	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	118.3	172	-54.5	-177.7	0	0	0	107.9	S77 K78 D79 L94 W95 I96 Y107	S77-I81 CarbonylContact C-O 3.55Å; S77-I81 VanDerWaalsContact CA-O 3.29Å; S77-I81 WeakPolarHBondContact CA-O 3.48Å; K78-I81 PolarHBondContact N-O 2.92Å; K78-I81 WeakPolarHBondContact O-CA 3.16Å; K78-I81 VanDerWaalsContact O-CB 3.31Å; K78-I81 WeakPolarHBondContact O-CB 3.41Å; K78-I81 PolarHBondContact O-N 2.95Å; K78-I81 VanDerWaalsContact O-O 3.12Å; D79-I81 PolarHBondContact O-N 2.77Å; I81-L94 HydrophobicContact CG2-CD1 3.36Å; I81-L94 HydrophobicContact CG2-CD2 4.34Å; I81-L94 HydrophobicContact CG2-CG 3.91Å; I81-W95 CarbonylContact C-O 3.55Å; I81-W95 VanDerWaalsContact CA-O 3.25Å; I81-W95 WeakPolarHBondContact CA-O 3.15Å; I81-I96 HydrophobicContact CG1-CG1 4.16Å; I81-I96 HydrophobicContact CG1-CG2 4.45Å; I81-I96 HydrophobicContact CG2-CG1 4.46Å; I81-Y107 HydrophobicContact CD1-CE1 4.25Å
82	T	93.9	Very high	84.2	Confident	17 Å²	17	68.4 Å²	68.4	10%	0.104	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	142.6	177.5	-60.3	0	0	0	0	109.3	E75 K76 S77 L94 W95	E75-T82 HydrophobicContact CG-CG2 3.61Å; K76-T82 CarbonylContact O-C 3.53Å; K76-T82 VanDerWaalsContact O-CA 3.32Å; K76-T82 WeakPolarHBondContact O-CA 3.3Å; S77-T82 WeakPolarHBondContact CB-OG1 3.23Å; S77-T82 PolarHBondContact OG-OG1 2.92Å; T82-L94 CarbonylContact O-C 3.52Å; T82-L94 WeakPolarHBondContact O-CA 3.44Å; T82-W95 HydrophobicContact CG2-CE3 4.01Å; T82-W95 HydrophobicContact CG2-CZ3 4.26Å; T82-W95 PolarHBondContact N-O 2.93Å; T82-W95 PolarHBondContact O-N 3.5Å
83	A	94.6	Very high	85.6	Confident	0 Å²	0	67.2 Å²	67.2	0%	0	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	147.2	173.8	0	0	0	0	0	111.5	V67 L69 E75 K76 S93 L94	V67-A83 HydrophobicContact CB-CB 4.25Å; V67-A83 HydrophobicContact CG1-CB 4.02Å; V67-A83 HydrophobicContact CG2-CB 4.37Å; L69-A83 HydrophobicContact CD1-CB 3.9Å; L69-A83 HydrophobicContact CD2-CB 4.31Å; L69-A83 HydrophobicContact CG-CB 4.47Å; E75-A83 WeakPolarHBondContact CA-O 3.21Å; K76-A83 PolarHBondContact N-O 2.87Å; K76-A83 PolarHBondContact O-N 3.13Å; A83-S93 CarbonylContact C-O 3.5Å; A83-S93 WeakPolarHBondContact CA-O 3.29Å; A83-L94 HydrophobicContact CB-CD1 3.62Å
84	N	92.5	Very high	87	Confident	44 Å²	44	65 Å²	65	24%	0.235	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	165.6	174	81.8	-18.3	0	0	0	112.2	L69 S92 S93 W95	L69-N84 VanDerWaalsContact CD1-C 3.44Å; L69-N84 VanDerWaalsContact CD1-O 3.22Å; L69-N84 WeakPolarHBondContact CD1-O 3.43Å; N84-S92 WeakPolarHBondContact O-CA 2.94Å; N84-S92 VanDerWaalsContact O-CB 3.23Å; N84-S92 WeakPolarHBondContact O-CB 3.42Å; N84-S92 PolarHBondContact O-OG 3.1Å; N84-S93 PolarHBondContact N-O 3.4Å; N84-S93 PolarHBondContact O-N 3.05Å; N84-S93 WeakPolarHBondContact OD1-CB 3.27Å; N84-S93 PolarHBondContact OD1-N 2.86Å; N84-W95 HydrophobicContact CB-CH2 3.81Å; N84-W95 HydrophobicContact CB-CZ3 3.75Å; N84-W95 WeakPolarHBondContact ND2-CH2 3.38Å; N84-W95 VanDerWaalsContact OD1-CH2 3.29Å; N84-W95 WeakPolarHBondContact OD1-CH2 3.39Å
85	L	90.8	Very high	88.3	Confident	18 Å²	18	65.4 Å²	65.4	9%	0.094	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.8	112.4	171.3	178.4	64	0	0	0	110.2	L45 L52 L69 K87	L45-L85 HydrophobicContact CD1-CD1 4.44Å; L52-L85 HydrophobicContact CB-CD1 4.42Å; L69-L85 HydrophobicContact CB-CB 4.02Å; L69-L85 HydrophobicContact CB-CD2 4.44Å; L69-L85 HydrophobicContact CD1-CB 4.1Å; L85-K87 PolarHBondContact O-N 2.83Å
86	D	88.1	Confident	88.8	Confident	61 Å²	61	58.7 Å²	58.7	33%	0.326	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.1	110.2	166.6	-169.6	-45.6	0	0	0	109.7	K88 M89 Q90 Q91	D86-K88 WeakPolarHBondContact OD1-CA 3.4Å; D86-K88 WeakPolarHBondContact OD1-CB 3.31Å; D86-K88 PolarHBondContact OD1-N 3.38Å; D86-M89 HydrophobicContact CB-CB 4.24Å; D86-M89 PolarHBondContact OD1-N 2.9Å; D86-Q90 WeakPolarHBondContact O-CA 3Å; D86-Q90 PolarHBondContact O-N 2.98Å; D86-Q91 PolarHBondContact N-O 3.06Å; D86-Q91 PolarHBondContact O-N 2.71Å; D86-Q91 VanDerWaalsContact O-N 3.13Å
87	K	81.1	Confident	89.2	Confident	84 Å²	84	60 Å²	60	37%	0.365	29%	0.292	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.7	-30.8	-179.5	-55.7	-174.7	-163.6	-178.3	0	113.6	K71 G72 L85 Q90	K71-K87 VanDerWaalsContact C-CE 3.42Å; K71-K87 HydrophobicContact CG-CD 4.38Å; K71-K87 WeakPolarHBondContact O-CE 3.39Å; K71-K87 PolarHBondContact O-NZ 2.87Å; G72-K87 VanDerWaalsContact CA-CE 3.49Å; G72-K87 WeakPolarHBondContact O-CE 3.36Å; G72-K87 PolarHBondContact O-NZ 3.36Å; L85-K87 PolarHBondContact O-N 2.83Å; K87-Q90 PolarHBondContact O-NE2 3.34Å
88	K	81.4	Confident	89.6	Confident	200 Å²	200	58.5 Å²	58.5	87%	0.87	28%	0.284	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.9	-41.3	-177.5	-67.3	-179.5	179.6	176.9	0	109.6	D86	D86-K88 WeakPolarHBondContact OD1-CA 3.4Å; D86-K88 WeakPolarHBondContact OD1-CB 3.31Å; D86-K88 PolarHBondContact OD1-N 3.38Å
89	M	83.9	Confident	90.1	Very high	122 Å²	122	53.1 Å²	53.1	60%	0.601	26%	0.262	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.4	-10.9	-179.2	-61.3	-171.3	63.3	0	0	113.3	D86 Q91	D86-M89 HydrophobicContact CB-CB 4.24Å; D86-M89 PolarHBondContact OD1-N 2.9Å; M89-Q91 HydrophobicContact CB-CB 3.99Å; M89-Q91 PolarHBondContact O-N 3.12Å
90	Q	85.5	Confident	90.8	Very high	37 Å²	37	50.9 Å²	50.9	17%	0.173	25%	0.248	C	C	.	.	T	Hydrogen-bonded Turn	trans	51.3	47.4	-171.1	-62.4	-63.7	-46.5	0	0	110.3	L45 S48 D86 K87	L45-Q90 HydrophobicContact CB-CB 4.34Å; L45-Q90 HydrophobicContact CD1-CB 4.48Å; L45-Q90 WeakPolarHBondContact CD1-O 3.45Å; L45-Q90 PolarHBondContact N-O 3.4Å; S48-Q90 PolarHBondContact OG-NE2 2.8Å; D86-Q90 WeakPolarHBondContact O-CA 3Å; D86-Q90 PolarHBondContact O-N 2.98Å; K87-Q90 PolarHBondContact O-NE2 3.34Å
91	Q	89.8	Confident	91.2	Very high	47 Å²	47	50.5 Å²	50.5	22%	0.22	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	130.1	-174.7	179.3	168.9	17.1	0	0	109.5	C43 N44 D86 M89	C43-Q91 CarbonylContact O-C 3.51Å; C43-Q91 WeakPolarHBondContact O-CA 3.47Å; N44-Q91 VanDerWaalsContact OD1-CB 3.27Å; N44-Q91 WeakPolarHBondContact OD1-CB 3.36Å; N44-Q91 WeakPolarHBondContact OD1-CG 3.46Å; N44-Q91 PolarHBondContact OD1-NE2 3.11Å; D86-Q91 PolarHBondContact N-O 3.06Å; D86-Q91 PolarHBondContact O-N 2.71Å; D86-Q91 VanDerWaalsContact O-N 3.13Å; M89-Q91 HydrophobicContact CB-CB 3.99Å; M89-Q91 PolarHBondContact O-N 3.12Å
92	S	92.7	Very high	91.2	Very high	0 Å²	0	53.2 Å²	53.2	0%	0	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	145.8	169.2	179.1	0	0	0	0	110.6	S42 C43 L52 W54 L69 N84	S42-S92 CarbonylContact C-O 3.53Å; S42-S92 VanDerWaalsContact CA-O 3.31Å; S42-S92 WeakPolarHBondContact CA-O 3.01Å; C43-S92 PolarHBondContact N-O 2.99Å; C43-S92 PolarHBondContact O-N 2.98Å; L52-S92 VanDerWaalsContact CD1-CB 3.47Å; L52-S92 WeakPolarHBondContact CD2-OG 3.33Å; W54-S92 PolarHBondContact NE1-OG 2.79Å; L69-S92 WeakPolarHBondContact CD1-OG 3.34Å; N84-S92 WeakPolarHBondContact O-CA 2.94Å; N84-S92 VanDerWaalsContact O-CB 3.23Å; N84-S92 WeakPolarHBondContact O-CB 3.42Å; N84-S92 PolarHBondContact O-OG 3.1Å
93	S	94.4	Very high	91.2	Very high	19 Å²	19	53.7 Å²	53.7	13%	0.133	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.3	147.6	169.6	-52.9	0	0	0	0	110.5	M41 A83 N84	M41-S93 CarbonylContact O-C 3.57Å; M41-S93 VanDerWaalsContact O-CA 3.3Å; M41-S93 WeakPolarHBondContact O-CA 3.27Å; A83-S93 CarbonylContact C-O 3.5Å; A83-S93 WeakPolarHBondContact CA-O 3.29Å; N84-S93 PolarHBondContact N-O 3.4Å; N84-S93 PolarHBondContact O-N 3.05Å; N84-S93 WeakPolarHBondContact OD1-CB 3.27Å; N84-S93 PolarHBondContact OD1-N 2.86Å
94	L	96	Very high	91.2	Very high	0 Å²	0	58.3 Å²	58.3	0%	0	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	126.4	173.5	-174	75.4	0	0	0	108.1	T40 M41 W54 I81 T82 A83 Y107	T40-L94 WeakPolarHBondContact CA-O 3.44Å; M41-L94 HydrophobicContact CB-CB 4.46Å; M41-L94 HydrophobicContact CE-CD2 3.6Å; M41-L94 HydrophobicContact CE-CG 4.3Å; M41-L94 PolarHBondContact N-O 2.6Å; M41-L94 PolarHBondContact O-N 3.28Å; W54-L94 HydrophobicContact CB-CD1 4.22Å; W54-L94 HydrophobicContact CB-CD2 4.46Å; W54-L94 HydrophobicContact CD2-CB 3.8Å; W54-L94 HydrophobicContact CD2-CD1 4.23Å; W54-L94 HydrophobicContact CD2-CD2 3.84Å; W54-L94 HydrophobicContact CD2-CG 4.19Å; W54-L94 HydrophobicContact CE3-CB 4.16Å; W54-L94 HydrophobicContact CE3-CD2 3.66Å; W54-L94 HydrophobicContact CE3-CG 4.43Å; W54-L94 HydrophobicContact CG-CB 4.32Å; W54-L94 HydrophobicContact CG-CD1 3.92Å; W54-L94 HydrophobicContact CG-CD2 4.2Å; W54-L94 HydrophobicContact CG-CG 4.4Å; W54-L94 HydrophobicContact CH2-CB 4.07Å; W54-L94 HydrophobicContact CZ2-CB 3.73Å; W54-L94 HydrophobicContact CZ3-CB 4.28Å; W54-L94 HydrophobicContact CZ3-CD2 4.16Å; I81-L94 HydrophobicContact CG2-CD1 3.36Å; I81-L94 HydrophobicContact CG2-CD2 4.34Å; I81-L94 HydrophobicContact CG2-CG 3.91Å; T82-L94 CarbonylContact O-C 3.52Å; T82-L94 WeakPolarHBondContact O-CA 3.44Å; A83-L94 HydrophobicContact CB-CD1 3.62Å; L94-Y107 HydrophobicContact CD2-CD1 3.73Å; L94-Y107 HydrophobicContact CD2-CE1 4.35Å; L94-Y107 HydrophobicContact CD2-CG 4.42Å
95	W	95.6	Very high	91.3	Very high	56 Å²	56	58.4 Å²	58.4	21%	0.212	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	138.1	179.4	-57.4	-87.8	0	0	0	110.6	V39 I81 T82 N84	V39-W95 CarbonylContact O-C 3.53Å; V39-W95 VanDerWaalsContact O-CA 3.27Å; V39-W95 WeakPolarHBondContact O-CA 3.25Å; I81-W95 CarbonylContact C-O 3.55Å; I81-W95 VanDerWaalsContact CA-O 3.25Å; I81-W95 WeakPolarHBondContact CA-O 3.15Å; T82-W95 HydrophobicContact CG2-CE3 4.01Å; T82-W95 HydrophobicContact CG2-CZ3 4.26Å; T82-W95 PolarHBondContact N-O 2.93Å; T82-W95 PolarHBondContact O-N 3.5Å; N84-W95 HydrophobicContact CB-CH2 3.81Å; N84-W95 HydrophobicContact CB-CZ3 3.75Å; N84-W95 WeakPolarHBondContact ND2-CH2 3.38Å; N84-W95 VanDerWaalsContact OD1-CH2 3.29Å; N84-W95 WeakPolarHBondContact OD1-CH2 3.39Å
96	I	95.3	Very high	91.5	Very high	4 Å²	4	60.8 Å²	60.8	2%	0.021	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	112.4	168.8	-50	-178.7	0	0	0	106.8	E38 V39 M41 I81 H103 Y107	E38-I96 WeakPolarHBondContact CA-O 3.44Å; V39-I96 HydrophobicContact CB-CB 4.11Å; V39-I96 HydrophobicContact CB-CG1 4.41Å; V39-I96 PolarHBondContact N-O 3.45Å; V39-I96 PolarHBondContact O-N 3.37Å; M41-I96 HydrophobicContact CE-CD1 4.09Å; M41-I96 HydrophobicContact CE-CG1 4.48Å; I81-I96 HydrophobicContact CG1-CG1 4.16Å; I81-I96 HydrophobicContact CG1-CG2 4.45Å; I81-I96 HydrophobicContact CG2-CG1 4.46Å; I96-H103 HydrophobicContact CD1-CB 4.4Å; I96-H103 HydrophobicContact CG2-CB 4.06Å; I96-H103 WeakPolarHBondContact CG2-ND1 3.43Å; I96-Y107 HydrophobicContact CD1-CE1 4.03Å; I96-Y107 HydrophobicContact CD1-CE2 4.14Å
97	Q	92.4	Very high	91.9	Very high	108 Å²	108	58.6 Å²	58.6	51%	0.505	32%	0.324	S	S	.	.	S	Bend	trans	-87	142.1	178.3	-64.8	-174.3	-46.1	0	0	110.7	K80	K80-Q97 PolarHBondContact O-N 3.4Å
98	A	93	Very high	92.6	Very high	49 Å²	49	57.7 Å²	57.7	41%	0.405	32%	0.322	S	S	.	.	S	Bend	trans	47.4	68.9	178.8	0	0	0	0	0	111.1	G36	G36-A98 WeakPolarHBondContact O-CA 3.08Å
99	S	93.4	Very high	93.1	Very high	9 Å²	9	48.8 Å²	48.8	6%	0.063	29%	0.285	C	S	.	.			trans	-49.5	143.7	-177.4	72.5	0	0	0	0	111.4	I33 Q34 E35 G36 D37	I33-S99 WeakPolarHBondContact CD1-OG 3.47Å; Q34-S99 PolarHBondContact O-OG 2.98Å; E35-S99 WeakPolarHBondContact CA-OG 3.41Å; E35-S99 VanDerWaalsContact CG-O 3.28Å; E35-S99 WeakPolarHBondContact CG-O 3.41Å; G36-S99 PolarHBondContact N-O 3.3Å; G36-S99 PolarHBondContact N-OG 3.18Å; D37-S99 PolarHBondContact N-OG 3.42Å; D37-S99 VanDerWaalsContact O-CB 3.23Å; D37-S99 WeakPolarHBondContact O-CB 3.4Å; D37-S99 PolarHBondContact O-N 3.39Å; D37-S99 PolarHBondContact O-OG 3.39Å
100	Q	95.1	Very high	93.4	Very high	75 Å²	75	43.8 Å²	43.8	35%	0.35	27%	0.265	S	S	.	.			trans	-133.9	159.1	177.6	-76.5	166	75	0	0	107.9	K80 S102 H103	K80-Q100 VanDerWaalsContact NZ-NE2 3.12Å; Q100-S102 PolarHBondContact O-N 3.29Å; Q100-H103 PolarHBondContact N-ND1 2.97Å; Q100-H103 WeakPolarHBondContact O-CB 3.36Å; Q100-H103 PolarHBondContact O-N 3.4Å
101	P	94.1	Very high	93.3	Very high	97 Å²	97	43.6 Å²	43.6	63%	0.63	27%	0.273	S	S	*	.	G	3₁₀ helix	trans	-53	-32.6	177.7	-29	36	0	0	0	113.8	H103 S104	P101-H103 PolarHBondContact O-N 3.07Å; P101-S104 WeakPolarHBondContact O-CB 3.26Å; P101-S104 PolarHBondContact O-N 3.21Å; P101-S104 VanDerWaalsContact O-N 3.15Å
102	S	92.3	Very high	92.5	Very high	71 Å²	71	49.2 Å²	49.2	50%	0.497	30%	0.296	S	S	.	.	G	3₁₀ helix	trans	-67.4	-14.3	176.2	60.1	0	0	0	0	114.6	R56 Q100	R56-S102 VanDerWaalsContact CZ-O 3.3Å; R56-S102 PolarHBondContact NH1-O 2.89Å; R56-S102 PolarHBondContact NH2-O 3.18Å; Q100-S102 PolarHBondContact O-N 3.29Å
103	H	93.4	Very high	92.4	Very high	26 Å²	26	51.7 Å²	51.7	12%	0.12	31%	0.311	C	S	.	.	G	3₁₀ helix	trans	-89	-5.9	174.6	-56.6	158.6	0	0	0	112.9	I96 Q100 P101 Y107	I96-H103 HydrophobicContact CD1-CB 4.4Å; I96-H103 HydrophobicContact CG2-CB 4.06Å; I96-H103 WeakPolarHBondContact CG2-ND1 3.43Å; Q100-H103 PolarHBondContact N-ND1 2.97Å; Q100-H103 WeakPolarHBondContact O-CB 3.36Å; Q100-H103 PolarHBondContact O-N 3.4Å; P101-H103 PolarHBondContact O-N 3.07Å; H103-Y107 WeakPolarHBondContact O-CE2 3.39Å; H103-Y107 PolarHBondContact O-OH 3.04Å
104	S	94.3	Very high	92.3	Very high	97 Å²	97	53.4 Å²	53.4	68%	0.678	32%	0.321	S	S	*	.			trans	-68.2	135.4	175.9	-171.1	0	0	0	0	111.2	R56 P101	R56-S104 PolarHBondContact NH2-O 2.88Å; P101-S104 WeakPolarHBondContact O-CB 3.26Å; P101-S104 PolarHBondContact O-N 3.21Å; P101-S104 VanDerWaalsContact O-N 3.15Å
105	G	94.4	Very high	92.1	Very high	46 Å²	46	56.3 Å²	56.3	47%	0.474	34%	0.338	S	S	.	.	S	Bend	trans	156.7	-175.2	176.7	0	0	0	0	0	113.1	Y107	G105-Y107 WeakPolarHBondContact O-CD2 3.42Å
106	T	96.1	Very high	91.9	Very high	69 Å²	69	56.4 Å²	56.4	42%	0.423	35%	0.346	S	S	.	.			trans	-93.3	124.6	178.7	-59.4	0	0	0	0	110	Q57 L108	Q57-T106 HydrophobicContact CB-CG2 4.32Å; Q57-T106 PolarHBondContact N-O 3.02Å; T106-L108 HydrophobicContact CG2-CD1 4.41Å; T106-L108 HydrophobicContact CG2-CD2 4.2Å; T106-L108 HydrophobicContact CG2-CG 4.07Å
107	Y	95.8	Very high	91.7	Very high	15 Å²	15	59.6 Å²	59.6	6%	0.059	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	134.7	176.3	-67.6	-99.9	0	0	0	109	Q26 M41 Y55 R56 L66 I81 L94 I96 H103 G105	Q26-Y107 PolarHBondContact NE2-O 3.29Å; M41-Y107 HydrophobicContact CE-CD1 4.13Å; M41-Y107 HydrophobicContact CE-CD2 4.05Å; M41-Y107 HydrophobicContact CE-CG 3.79Å; M41-Y107 HydrophobicContact SD-CD2 4.25Å; M41-Y107 HydrophobicContact SD-CG 4.01Å; Y55-Y107 WeakPolarHBondContact O-CA 3.31Å; R56-Y107 HydrophobicContact CG-CE1 4.46Å; L66-Y107 HydrophobicContact CD1-CD1 3.56Å; L66-Y107 HydrophobicContact CD1-CE1 3.56Å; I81-Y107 HydrophobicContact CD1-CE1 4.25Å; L94-Y107 HydrophobicContact CD2-CD1 3.73Å; L94-Y107 HydrophobicContact CD2-CE1 4.35Å; L94-Y107 HydrophobicContact CD2-CG 4.42Å; I96-Y107 HydrophobicContact CD1-CE1 4.03Å; I96-Y107 HydrophobicContact CD1-CE2 4.14Å; H103-Y107 WeakPolarHBondContact O-CE2 3.39Å; H103-Y107 PolarHBondContact O-OH 3.04Å; G105-Y107 WeakPolarHBondContact O-CD2 3.42Å
108	L	95.3	Very high	91.7	Very high	64 Å²	64	56.4 Å²	56.4	34%	0.335	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	137.7	-177.4	-63.8	170.2	0	0	0	109.5	Y55 L63 T106	Y55-L108 WeakPolarHBondContact CD2-O 3.32Å; Y55-L108 PolarHBondContact N-O 2.79Å; Y55-L108 PolarHBondContact O-N 3.43Å; L63-L108 HydrophobicContact CD2-CD1 3.62Å; T106-L108 HydrophobicContact CG2-CD1 4.41Å; T106-L108 HydrophobicContact CG2-CD2 4.2Å; T106-L108 HydrophobicContact CG2-CG 4.07Å
109	C	93.3	Very high	91.6	Very high	13 Å²	13	56.9 Å²	56.9	9%	0.088	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	150.9	167.8	61.2	0	0	0	0	111.4	L24 Q26 C43 L52 L53 W54	L24-C109 WeakPolarHBondContact CD2-SG 3.32Å; Q26-C109 PolarHBondContact OE1-SG 3.37Å; Q26-C109 VanDerWaalsContact OE1-SG 3.37Å; C43-C109 HydrophobicContact CB-CB 3.6Å; C43-C109 WeakPolarHBondContact CB-SG 3.35Å; C43-C109 WeakPolarHBondContact SG-CB 3.47Å; C43-C109 CovalentContact SG-SG 2.02Å; C43-C109 PolarHBondContact SG-SG 2.96Å; L52-C109 HydrophobicContact CD2-CB 4.42Å; L53-C109 CarbonylContact O-C 3.5Å; L53-C109 VanDerWaalsContact O-CA 3.3Å; L53-C109 WeakPolarHBondContact O-CA 3.38Å; W54-C109 HydrophobicContact CD2-CB 4.02Å; W54-C109 HydrophobicContact CE3-CB 3.87Å; W54-C109 HydrophobicContact CH2-CB 4.02Å; W54-C109 HydrophobicContact CZ2-CB 4.14Å; W54-C109 HydrophobicContact CZ3-CB 3.88Å
110	G	89.4	Confident	91.4	Very high	17 Å²	17	60.6 Å²	60.6	18%	0.175	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.3	149	179	0	0	0	0	0	112.1	L53	L53-G110 PolarHBondContact N-O 2.87Å; L53-G110 PolarHBondContact O-N 3.14Å
111	G	83.7	Confident	91.1	Very high	33 Å²	33	59.4 Å²	59.4	34%	0.34	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	148.2	-178.4	0	0	0	0	0	114.8
112	K	71.8	Confident	90.9	Very high	165 Å²	165	56 Å²	56	72%	0.717	36%	0.355	S	S	*	.			trans	-127	0	165.4	-85.3	-168.4	179.8	179	0	112.5	Y50 A51 L53	Y50-K112 PolarHBondContact N-O 3.4Å; A51-K112 HydrophobicContact CB-CB 4.31Å; A51-K112 PolarHBondContact N-O 3.34Å; A51-K112 VanDerWaalsContact N-O 3.12Å; A51-K112 PolarHBondContact O-N 3.39Å; L53-K112 HydrophobicContact CD1-CB 4.25Å; L53-K112 HydrophobicContact CD1-CD 3.96Å; L53-K112 HydrophobicContact CD1-CG 3.94Å

Retrieved 112 of 112 residues in 109 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).