A0A075B663_MOUSE Loading...

Immunoglobulin lambda variable 1

AlphaFold DB , UniProt , Accession A0A075B663, Species MOUSE (Mus musculus, Mouse), Gene Iglv1, Length 117 aa.

						>A0A075B663_MOUSE|A0A075B663|Iglv1
MAWISLILSLLALSSGAISQAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67	Low	74.9	Confident	207 Å²	207	120.9 Å²	120.9	100%	1.02	64%	0.641	S	S	*	*				0	-32.2	0	-68.5	176.7	74.2	0	0	113.4	W3 I4	M1-W3 VanDerWaalsContact C-N 3.31Å; M1-W3 PolarHBondContact O-N 3.49Å; M1-I4 PolarHBondContact O-N 2.93Å
2	A	75.6	Confident	74.6	Confident	74 Å²	74	116.3 Å²	116.3	61%	0.612	63%	0.633	S	S	*	*	H	α-helix	trans	-61.6	-28.1	179.6	0	0	0	0	0	115.8	I4 S5 L6	A2-I4 VanDerWaalsContact C-N 3.32Å; A2-I4 PolarHBondContact O-N 3.42Å; A2-S5 PolarHBondContact O-N 2.8Å; A2-L6 PolarHBondContact O-N 3.11Å; A2-L6 VanDerWaalsContact O-N 3.12Å
3	W	74.6	Confident	73.9	Confident	211 Å²	211	118.8 Å²	118.8	80%	0.799	64%	0.644	S	S	*	*	H	α-helix	trans	-70.4	-28.3	179.8	-60.9	-10	0	0	0	113.2	M1 L6 I7	M1-W3 VanDerWaalsContact C-N 3.31Å; M1-W3 PolarHBondContact O-N 3.49Å; W3-L6 PolarHBondContact O-N 3.35Å; W3-I7 WeakPolarHBondContact O-CB 3.44Å; W3-I7 VanDerWaalsContact O-CG1 3.23Å; W3-I7 WeakPolarHBondContact O-CG1 3.01Å; W3-I7 PolarHBondContact O-N 3.01Å
4	I	78.9	Confident	73.5	Confident	108 Å²	108	117.2 Å²	117.2	55%	0.554	65%	0.646	S	S	*	*	H	α-helix	trans	-65.1	-46.1	175.2	-61	166.5	0	0	0	108.8	M1 A2 L6 I7 L8	M1-I4 PolarHBondContact O-N 2.93Å; A2-I4 VanDerWaalsContact C-N 3.32Å; A2-I4 PolarHBondContact O-N 3.42Å; I4-L6 PolarHBondContact O-N 2.89Å; I4-I7 PolarHBondContact O-N 3.09Å; I4-L8 HydrophobicContact CG2-CD1 3.48Å; I4-L8 VanDerWaalsContact CG2-CD1 3.48Å; I4-L8 WeakPolarHBondContact O-CD1 3.28Å; I4-L8 PolarHBondContact O-N 3.31Å
5	S	77.4	Confident	73.3	Confident	77 Å²	77	115.7 Å²	115.7	54%	0.538	65%	0.647	S	S	.	*	H	α-helix	trans	-61.3	-41	175.2	-52.8	0	0	0	0	112.6	A2 L8 S9	A2-S5 PolarHBondContact O-N 2.8Å; S5-L8 PolarHBondContact O-N 2.91Å; S5-S9 WeakPolarHBondContact O-CB 3.31Å; S5-S9 PolarHBondContact O-N 3.06Å; S5-S9 PolarHBondContact O-OG 2.99Å
6	L	77.6	Confident	73.1	Confident	125 Å²	125	112.8 Å²	112.8	65%	0.654	65%	0.651	S	S	*	*	H	α-helix	trans	-65.6	-41.7	177.9	-160.4	83.5	0	0	0	112.1	A2 W3 I4 S9 L10	A2-L6 PolarHBondContact O-N 3.11Å; A2-L6 VanDerWaalsContact O-N 3.12Å; W3-L6 PolarHBondContact O-N 3.35Å; I4-L6 PolarHBondContact O-N 2.89Å; L6-S9 PolarHBondContact O-N 3.43Å; L6-L10 WeakPolarHBondContact O-CB 3.28Å; L6-L10 PolarHBondContact O-N 2.96Å
7	I	79.8	Confident	73.1	Confident	98 Å²	98	112 Å²	112	50%	0.503	66%	0.661	S	S	.	*	H	α-helix	trans	-64.6	-47.4	175.6	-70.5	167.8	0	0	0	110	W3 I4 S9 L10 L11	W3-I7 WeakPolarHBondContact O-CB 3.44Å; W3-I7 VanDerWaalsContact O-CG1 3.23Å; W3-I7 WeakPolarHBondContact O-CG1 3.01Å; W3-I7 PolarHBondContact O-N 3.01Å; I4-I7 PolarHBondContact O-N 3.09Å; I7-S9 VanDerWaalsContact C-N 3.32Å; I7-S9 PolarHBondContact O-N 3.37Å; I7-L10 PolarHBondContact O-N 2.91Å; I7-L10 VanDerWaalsContact O-N 3.15Å; I7-L11 HydrophobicContact CG2-CD1 3.37Å; I7-L11 WeakPolarHBondContact O-CD1 3.47Å; I7-L11 PolarHBondContact O-N 3.08Å
8	L	75.3	Confident	72.9	Confident	116 Å²	116	114.7 Å²	114.7	61%	0.607	67%	0.671	S	S	*	*	H	α-helix	trans	-59.6	-41.6	176.2	-90.7	98	0	0	0	112.3	I4 S5 L11 A12	I4-L8 HydrophobicContact CG2-CD1 3.48Å; I4-L8 VanDerWaalsContact CG2-CD1 3.48Å; I4-L8 WeakPolarHBondContact O-CD1 3.28Å; I4-L8 PolarHBondContact O-N 3.31Å; S5-L8 PolarHBondContact O-N 2.91Å; L8-L11 PolarHBondContact O-N 2.7Å; L8-A12 WeakPolarHBondContact O-CB 3.34Å; L8-A12 PolarHBondContact O-N 2.83Å
9	S	74.7	Confident	72.9	Confident	69 Å²	69	114.4 Å²	114.4	48%	0.483	68%	0.675	S	S	.	*	H	α-helix	trans	-62.9	-41.7	174.7	-61	0	0	0	0	111.9	S5 L6 I7 A12 L13	S5-S9 WeakPolarHBondContact O-CB 3.31Å; S5-S9 PolarHBondContact O-N 3.06Å; S5-S9 PolarHBondContact O-OG 2.99Å; L6-S9 PolarHBondContact O-N 3.43Å; I7-S9 VanDerWaalsContact C-N 3.32Å; I7-S9 PolarHBondContact O-N 3.37Å; S9-A12 PolarHBondContact O-N 2.98Å; S9-L13 WeakPolarHBondContact O-CD1 3.34Å; S9-L13 PolarHBondContact O-N 2.87Å
10	L	71.7	Confident	73.4	Confident	130 Å²	130	116.7 Å²	116.7	68%	0.681	68%	0.679	S	S	*	*	H	α-helix	trans	-67.7	-38.5	179.2	-166.2	70.4	0	0	0	112.3	L6 I7 A12 L13	L6-L10 WeakPolarHBondContact O-CB 3.28Å; L6-L10 PolarHBondContact O-N 2.96Å; I7-L10 PolarHBondContact O-N 2.91Å; I7-L10 VanDerWaalsContact O-N 3.15Å; L10-A12 VanDerWaalsContact C-N 3.31Å; L10-L13 PolarHBondContact O-N 2.94Å
11	L	71.5	Confident	74	Confident	115 Å²	115	112.8 Å²	112.8	60%	0.602	66%	0.661	S	S	*	*	H	α-helix	trans	-66.8	-31.4	172.7	-86.1	99.3	0	0	0	112.5	I7 L8 L13 S14	I7-L11 HydrophobicContact CG2-CD1 3.37Å; I7-L11 WeakPolarHBondContact O-CD1 3.47Å; I7-L11 PolarHBondContact O-N 3.08Å; L8-L11 PolarHBondContact O-N 2.7Å; L11-L13 VanDerWaalsContact C-N 3.33Å; L11-S14 PolarHBondContact O-OG 3.21Å
12	A	70.7	Confident	75.2	Confident	66 Å²	66	106.7 Å²	106.7	55%	0.545	64%	0.635	S	S	.	*	H	α-helix	trans	-72.8	-24.9	176.8	0	0	0	0	0	113.2	L8 S9 L10 S15	L8-A12 WeakPolarHBondContact O-CB 3.34Å; L8-A12 PolarHBondContact O-N 2.83Å; S9-A12 PolarHBondContact O-N 2.98Å; L10-A12 VanDerWaalsContact C-N 3.31Å; A12-S15 PolarHBondContact O-OG 3.26Å
13	L	65.4	Low	76.1	Confident	149 Å²	149	106 Å²	106	78%	0.78	62%	0.623	S	S	*	*	H	α-helix	trans	-82.7	-16.1	178.1	-92.9	82.2	0	0	0	113.9	S9 L10 L11	S9-L13 WeakPolarHBondContact O-CD1 3.34Å; S9-L13 PolarHBondContact O-N 2.87Å; L10-L13 PolarHBondContact O-N 2.94Å; L11-L13 VanDerWaalsContact C-N 3.33Å
14	S	69	Low	77.2	Confident	96 Å²	96	99.3 Å²	99.3	67%	0.671	61%	0.605	S	S	*	*	S	Bend	trans	-92.8	-3.6	-176.9	62.1	0	0	0	0	114.5	L11 G16	L11-S14 PolarHBondContact O-OG 3.21Å; S14-G16 PolarHBondContact O-N 3.25Å
15	S	71	Confident	78	Confident	94 Å²	94	97.6 Å²	97.6	66%	0.657	60%	0.595	S	S	*	*			trans	-81.9	66.3	173.4	46.4	0	0	0	0	111.3	A12 A17	A12-S15 PolarHBondContact O-OG 3.26Å; S15-A17 PolarHBondContact O-N 3.32Å
16	G	69	Low	78.7	Confident	69 Å²	69	99 Å²	99	71%	0.711	59%	0.593	S	S	*	*			trans	-61	107.5	160.9	0	0	0	0	0	109	S14 I18	S14-G16 PolarHBondContact O-N 3.25Å; G16-I18 PolarHBondContact O-N 3.2Å
17	A	74.3	Confident	79.2	Confident	100 Å²	100	99.4 Å²	99.4	83%	0.826	61%	0.606	S	S	*	*			trans	-76	107.2	174	0	0	0	0	0	109	S15 S19	S15-A17 PolarHBondContact O-N 3.32Å; A17-S19 PolarHBondContact O-N 3.45Å
18	I	69.5	Low	79.8	Confident	161 Å²	161	98.7 Å²	98.7	83%	0.826	62%	0.615	S	S	*	*			trans	-75.6	112.1	170.3	-56.2	173.3	0	0	0	106.8	G16 Q20	G16-I18 PolarHBondContact O-N 3.2Å; I18-Q20 PolarHBondContact O-N 3.18Å
19	S	72.9	Confident	80.7	Confident	109 Å²	109	96.2 Å²	96.2	76%	0.762	60%	0.602	S	S	*	*			trans	-75.4	115.5	171.2	-176.6	0	0	0	0	108.7	A17	A17-S19 PolarHBondContact O-N 3.45Å
20	Q	82.7	Confident	81.6	Confident	159 Å²	159	99.8 Å²	99.8	74%	0.743	62%	0.621	S	S	*	*			trans	-85.2	140.9	174.3	-174.1	175.4	-20.8	0	0	110.1	I18 V22	I18-Q20 PolarHBondContact O-N 3.18Å; Q20-V22 PolarHBondContact O-N 3.34Å
21	A	86	Confident	82.7	Confident	36 Å²	36	96.3 Å²	96.3	30%	0.298	61%	0.605	S	S	.	*			trans	-64.2	129.4	171.1	0	0	0	0	0	110.4	T45 Y113	A21-T45 HydrophobicContact CB-CG2 3.7Å; A21-Y113 HydrophobicContact CB-CE2 4.46Å
22	V	92.4	Very high	83.9	Confident	79 Å²	79	94 Å²	94	48%	0.479	60%	0.598	S	S	.	*			trans	-116.1	134.7	179.9	-179.7	0	0	0	0	108.9	Q20 S44	Q20-V22 PolarHBondContact O-N 3.34Å; V22-S44 PolarHBondContact N-OG 3.42Å; V22-S44 PolarHBondContact O-N 2.6Å; V22-S44 PolarHBondContact O-OG 2.98Å
23	V	94.5	Very high	85.1	Confident	59 Å²	59	95.7 Å²	95.7	36%	0.358	60%	0.604	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.9	130	171.1	-176.7	0	0	0	0	108.2	C41 R42 C109 L111	V23-C41 WeakPolarHBondContact CG1-SG 3.25Å; V23-R42 WeakPolarHBondContact CA-O 3.26Å; V23-C109 HydrophobicContact CG1-CB 4.42Å; V23-L111 HydrophobicContact CG1-CD1 4.31Å; V23-L111 HydrophobicContact CG1-CG 4.34Å; V23-L111 HydrophobicContact CG2-CB 4.33Å; V23-L111 HydrophobicContact CG2-CD1 3.99Å; V23-L111 HydrophobicContact CG2-CG 4.04Å
24	T	95.9	Very high	86.6	Confident	71 Å²	71	91.2 Å²	91.2	44%	0.436	59%	0.594	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-118.6	129	177	-48.7	0	0	0	0	109.6	C41 R42	T24-C41 CarbonylContact O-C 3.59Å; T24-C41 WeakPolarHBondContact O-CA 3.31Å; T24-R42 PolarHBondContact N-O 2.87Å; T24-R42 PolarHBondContact O-N 2.92Å
25	Q	95.7	Very high	88	Confident	71 Å²	71	91.2 Å²	91.2	33%	0.332	58%	0.584	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-137.4	165.6	173.6	57.7	178.3	69.3	0	0	108.8	T40 C41 Y107 C109	Q25-T40 WeakPolarHBondContact CA-O 3.24Å; Q25-T40 VanDerWaalsContact CB-O 3.28Å; Q25-T40 WeakPolarHBondContact CB-O 3.44Å; Q25-C41 HydrophobicContact CB-CB 4.48Å; Q25-Y107 PolarHBondContact NE2-O 3.37Å; Q25-C109 VanDerWaalsContact OE1-N 3.13Å
26	E	92.1	Very high	89.3	Confident	108 Å²	108	90.8 Å²	90.8	51%	0.505	58%	0.577	S	S	.	*			trans	-65.6	140.6	172.4	-63.3	-161.4	146.8	0	0	110.7	L29	E26-L29 HydrophobicContact CB-CD1 3.56Å; E26-L29 HydrophobicContact CG-CD1 4.45Å; E26-L29 WeakPolarHBondContact OE2-CD1 3.38Å; E26-L29 WeakPolarHBondContact OE2-CD2 3.28Å; E26-L29 WeakPolarHBondContact OE2-CG 3.36Å
27	S	89.4	Confident	90.6	Very high	133 Å²	133	88.4 Å²	88.4	93%	0.93	55%	0.549	S	S	*	.	S	Bend	trans	-77.1	-35.2	-172.4	50.8	0	0	0	0	113.4
28	A	92.1	Very high	91.7	Very high	83 Å²	83	86 Å²	86	69%	0.686	52%	0.524	S	S	*	.			trans	-154	137.1	178.2	0	0	0	0	0	109.6
29	L	93.7	Very high	93.1	Very high	64 Å²	64	79.3 Å²	79.3	34%	0.335	49%	0.49	S	S	.	.			trans	-125.8	145.9	169.2	-73.4	87.7	0	0	0	108.9	E26 V37 L39	E26-L29 HydrophobicContact CB-CD1 3.56Å; E26-L29 HydrophobicContact CG-CD1 4.45Å; E26-L29 WeakPolarHBondContact OE2-CD1 3.38Å; E26-L29 WeakPolarHBondContact OE2-CD2 3.28Å; E26-L29 WeakPolarHBondContact OE2-CG 3.36Å; L29-V37 HydrophobicContact CB-CG2 4.35Å; L29-V37 HydrophobicContact CD2-CG2 3.61Å; L29-L39 HydrophobicContact CD1-CG 4.37Å
30	T	94.7	Very high	94.3	Very high	143 Å²	143	75.8 Å²	75.8	88%	0.877	46%	0.464	S	S	*	.			trans	-121	145.3	170.5	56.3	0	0	0	0	109.1
31	T	93.9	Very high	94.9	Very high	58 Å²	58	68.3 Å²	68.3	36%	0.356	43%	0.429	S	S	.	.			trans	-150.9	153.4	179.6	-170.7	0	0	0	0	109.7	E35 V37 A99	T31-E35 WeakPolarHBondContact OG1-CB 3.11Å; T31-E35 PolarHBondContact OG1-OE2 2.71Å; T31-V37 HydrophobicContact CG2-CB 4.12Å; T31-V37 HydrophobicContact CG2-CG1 4.06Å; T31-A99 HydrophobicContact CG2-CB 3.76Å
32	S	96.2	Very high	95.4	Very high	65 Å²	65	71.6 Å²	71.6	46%	0.455	43%	0.433	S	S	.	.			trans	-84.7	150.9	176.2	-51.4	0	0	0	0	111	G34 E35	S32-G34 PolarHBondContact O-N 2.8Å; S32-E35 PolarHBondContact N-OE2 2.96Å; S32-E35 WeakPolarHBondContact O-CB 3.44Å; S32-E35 PolarHBondContact O-N 2.93Å; S32-E35 VanDerWaalsContact O-N 3.11Å
33	P	96.6	Very high	95.5	Very high	103 Å²	103	68 Å²	68	67%	0.669	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.2	134.5	173.5	-27	35.2	0	0	0	112.5	E35 A99	P33-E35 VanDerWaalsContact C-N 3.33Å; P33-A99 CarbonylContact C-O 3.5Å; P33-A99 VanDerWaalsContact CA-O 3.28Å; P33-A99 WeakPolarHBondContact CA-O 3.28Å
34	G	97.3	Very high	95.4	Very high	55 Å²	55	68 Å²	68	57%	0.567	41%	0.414	S	S	*	.	T	Hydrogen-bonded Turn	trans	88	-12.8	-178.2	0	0	0	0	0	115.1	S32 A99	S32-G34 PolarHBondContact O-N 2.8Å; G34-A99 PolarHBondContact N-O 3.25Å
35	E	98	Very high	95.1	Very high	96 Å²	96	68.5 Å²	68.5	45%	0.449	42%	0.418	S	S	.	.			trans	-75.8	170.1	177.3	-69.8	-178.8	164.2	0	0	112.4	T31 S32 P33 G98 A99	T31-E35 WeakPolarHBondContact OG1-CB 3.11Å; T31-E35 PolarHBondContact OG1-OE2 2.71Å; S32-E35 PolarHBondContact N-OE2 2.96Å; S32-E35 WeakPolarHBondContact O-CB 3.44Å; S32-E35 PolarHBondContact O-N 2.93Å; S32-E35 VanDerWaalsContact O-N 3.11Å; P33-E35 VanDerWaalsContact C-N 3.33Å; E35-G98 WeakPolarHBondContact O-CA 3.35Å; E35-G98 PolarHBondContact O-N 3.21Å; E35-A99 PolarHBondContact O-N 3.21Å
36	T	98.1	Very high	94.8	Very high	85 Å²	85	66.8 Å²	66.8	52%	0.521	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	124.9	170.8	-62.4	0	0	0	0	109.4	T95 I96 T97	T36-T95 HydrophobicContact CG2-CG2 3.65Å; T36-I96 VanDerWaalsContact CA-O 3.31Å; T36-I96 WeakPolarHBondContact CA-O 3.29Å; T36-T97 HydrophobicContact CG2-CG2 3.94Å
37	V	97.2	Very high	94.9	Very high	19 Å²	19	63.9 Å²	63.9	12%	0.115	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	143.3	174.9	62	0	0	0	0	109.8	L29 T31 T95 I96	L29-V37 HydrophobicContact CB-CG2 4.35Å; L29-V37 HydrophobicContact CD2-CG2 3.61Å; T31-V37 HydrophobicContact CG2-CB 4.12Å; T31-V37 HydrophobicContact CG2-CG1 4.06Å; V37-T95 WeakPolarHBondContact O-CA 3.44Å; V37-I96 HydrophobicContact CG1-CB 3.82Å; V37-I96 HydrophobicContact CG1-CD1 4.11Å; V37-I96 HydrophobicContact CG1-CG1 4.23Å; V37-I96 PolarHBondContact N-O 3.04Å; V37-I96 PolarHBondContact O-N 3.24Å
38	T	97.8	Very high	95.2	Very high	50 Å²	50	57.7 Å²	57.7	31%	0.307	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	114.1	177.8	-58.4	0	0	0	0	109.8	T40 I88 A93 L94	T38-T40 HydrophobicContact CG2-CG2 4.32Å; T38-I88 HydrophobicContact CG2-CD1 3.94Å; T38-A93 HydrophobicContact CG2-CB 3.91Å; T38-L94 CarbonylContact C-O 3.09Å; T38-L94 WeakPolarHBondContact CA-O 3.47Å
39	L	97.6	Very high	95.3	Very high	20 Å²	20	56.1 Å²	56.1	11%	0.105	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.4	143.3	170.8	-60.7	87.5	0	0	0	108.6	L29 W56 A93 L94 I96 Y107	L29-L39 HydrophobicContact CD1-CG 4.37Å; L39-W56 HydrophobicContact CB-CH2 3.89Å; L39-W56 HydrophobicContact CB-CZ3 4.04Å; L39-A93 CarbonylContact O-C 3.52Å; L39-A93 WeakPolarHBondContact O-CA 3.31Å; L39-L94 HydrophobicContact CB-CB 4.4Å; L39-L94 HydrophobicContact CD1-CD2 4.33Å; L39-L94 PolarHBondContact N-O 3.31Å; L39-L94 PolarHBondContact O-N 2.9Å; L39-I96 HydrophobicContact CD1-CD1 4.04Å; L39-I96 HydrophobicContact CD1-CG1 4.48Å; L39-Y107 HydrophobicContact CD2-CD2 4.14Å; L39-Y107 HydrophobicContact CD2-CG 4.01Å
40	T	97.5	Very high	95.2	Very high	35 Å²	35	58.4 Å²	58.4	22%	0.215	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	151.3	176	65.2	0	0	0	0	112.3	Q25 T38 I88 A92 A93	Q25-T40 WeakPolarHBondContact CA-O 3.24Å; Q25-T40 VanDerWaalsContact CB-O 3.28Å; Q25-T40 WeakPolarHBondContact CB-O 3.44Å; T38-T40 HydrophobicContact CG2-CG2 4.32Å; T40-I88 HydrophobicContact CG2-CD1 4.37Å; T40-A92 CarbonylContact C-O 3.53Å; T40-A92 VanDerWaalsContact CA-O 3.26Å; T40-A92 WeakPolarHBondContact CA-O 3.16Å; T40-A93 HydrophobicContact CG2-CB 4.39Å
41	C	96	Very high	95	Very high	1 Å²	1	54.8 Å²	54.8	1%	0.007	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	131.7	-176.9	168.1	0	0	0	0	110.2	V23 T24 Q25 W56 K91 A92 C109	V23-C41 WeakPolarHBondContact CG1-SG 3.25Å; T24-C41 CarbonylContact O-C 3.59Å; T24-C41 WeakPolarHBondContact O-CA 3.31Å; Q25-C41 HydrophobicContact CB-CB 4.48Å; C41-W56 HydrophobicContact CB-CH2 3.74Å; C41-W56 HydrophobicContact CB-CZ2 3.81Å; C41-K91 CarbonylContact O-C 3.17Å; C41-K91 WeakPolarHBondContact O-CA 3.47Å; C41-K91 WeakPolarHBondContact O-CB 3.42Å; C41-A92 HydrophobicContact CB-CB 4.41Å; C41-A92 PolarHBondContact N-O 3.41Å; C41-A92 PolarHBondContact O-N 3.47Å; C41-C109 HydrophobicContact CB-CB 3.39Å; C41-C109 WeakPolarHBondContact CB-SG 3.05Å; C41-C109 WeakPolarHBondContact SG-CB 3.4Å; C41-C109 CovalentContact SG-SG 2.02Å; C41-C109 PolarHBondContact SG-SG 2.88Å
42	R	96.1	Very high	94.9	Very high	105 Å²	105	53.6 Å²	53.6	40%	0.396	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	156.3	179.7	64	179.5	-114.3	109.8	-2.9	112	V23 T24 D90 K91	V23-R42 WeakPolarHBondContact CA-O 3.26Å; T24-R42 PolarHBondContact N-O 2.87Å; T24-R42 PolarHBondContact O-N 2.92Å; R42-D90 IonicContact NH1-OD2 3.72Å; R42-K91 HydrophobicContact CB-CD 4.49Å; R42-K91 HydrophobicContact CB-CG 4.14Å
43	S	94.7	Very high	94.8	Very high	3 Å²	3	53.7 Å²	53.7	2%	0.021	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.4	147.3	171.4	175.3	0	0	0	0	111.4	T45 G46 Y113	S43-T45 VanDerWaalsContact C-N 3.3Å; S43-T45 PolarHBondContact OG-N 3.12Å; S43-T45 PolarHBondContact OG-OG1 2.84Å; S43-G46 WeakPolarHBondContact CB-O 3.49Å; S43-Y113 WeakPolarHBondContact CB-OH 3.41Å; S43-Y113 WeakPolarHBondContact OG-CE1 3.05Å; S43-Y113 PolarHBondContact OG-OH 3.37Å
44	S	92	Very high	94.7	Very high	60 Å²	60	48.8 Å²	48.8	42%	0.42	30%	0.3	S	S	.	.	S	Bend	trans	-75.5	-15.6	168	70.2	0	0	0	0	113.9	V22	V22-S44 PolarHBondContact N-OG 3.42Å; V22-S44 PolarHBondContact O-N 2.6Å; V22-S44 PolarHBondContact O-OG 2.98Å
45	T	89.8	Confident	94.7	Very high	82 Å²	82	48.5 Å²	48.5	50%	0.503	29%	0.285	S	S	.	.	S	Bend	trans	-108.8	-3.2	-172.2	57.3	0	0	0	0	114.1	A21 S43	A21-T45 HydrophobicContact CB-CG2 3.7Å; S43-T45 VanDerWaalsContact C-N 3.3Å; S43-T45 PolarHBondContact OG-N 3.12Å; S43-T45 PolarHBondContact OG-OG1 2.84Å
46	G	90.8	Very high	94.7	Very high	35 Å²	35	44 Å²	44	36%	0.361	26%	0.264	S	S	.	.	S	Bend	trans	167.7	-176.1	175.9	0	0	0	0	0	114.5	S43	S43-G46 WeakPolarHBondContact CB-O 3.49Å
47	A	94.3	Very high	94.6	Very high	47 Å²	47	41.7 Å²	41.7	39%	0.388	25%	0.25	S	C	.	.			trans	-73.3	139.5	176.2	0	0	0	0	0	111.2	T49 D90	A47-T49 HydrophobicContact CB-CG2 4.15Å; A47-D90 HydrophobicContact CB-CB 3.92Å
48	V	94.8	Very high	94.6	Very high	3 Å²	3	41.3 Å²	41.3	2%	0.018	25%	0.247	C	C	.	.			trans	-75.6	125.9	165.9	-173.1	0	0	0	0	107.7	N52 L87 D90 A92 L111	V48-N52 CarbonylContact C-O 3.53Å; V48-N52 VanDerWaalsContact CA-O 3.31Å; V48-N52 WeakPolarHBondContact CA-O 3.34Å; V48-N52 WeakPolarHBondContact CG1-O 3.43Å; V48-L87 HydrophobicContact CB-CD2 4.37Å; V48-L87 HydrophobicContact CG1-CD2 3.89Å; V48-D90 WeakPolarHBondContact CB-O 3.46Å; V48-D90 PolarHBondContact N-O 3.01Å; V48-A92 HydrophobicContact CG1-CB 3.83Å; V48-L111 HydrophobicContact CG1-CD2 4.03Å; V48-L111 HydrophobicContact CG2-CD1 4Å; V48-L111 HydrophobicContact CG2-CD2 3.9Å
49	T	94.6	Very high	94.4	Very high	50 Å²	50	42 Å²	42	31%	0.307	25%	0.246	S	C	.	.			trans	-137.3	-176.5	-175.5	68.8	0	0	0	0	110.2	A47 S51 N52 Y53	A47-T49 HydrophobicContact CB-CG2 4.15Å; T49-S51 PolarHBondContact O-N 3.29Å; T49-S51 PolarHBondContact OG1-N 2.88Å; T49-S51 VanDerWaalsContact OG1-N 3.14Å; T49-N52 PolarHBondContact N-O 2.78Å; T49-N52 CarbonylContact O-C 3.38Å; T49-N52 PolarHBondContact O-N 3.47Å; T49-N52 PolarHBondContact OG1-N 2.88Å; T49-Y53 VanDerWaalsContact O-CA 3.3Å; T49-Y53 WeakPolarHBondContact O-CA 3.36Å; T49-Y53 PolarHBondContact O-N 3.44Å
50	T	90.7	Very high	94.2	Very high	111 Å²	111	43.3 Å²	43.3	68%	0.681	25%	0.251	S	S	*	.	S	Bend	trans	-64.7	-20.8	169.8	52	0	0	0	0	113.1
51	S	90.9	Very high	93.7	Very high	68 Å²	68	47.5 Å²	47.5	48%	0.476	28%	0.279	S	S	.	.	S	Bend	trans	-95.6	-30.1	177.3	-56.6	0	0	0	0	112.8	T49 S114	T49-S51 PolarHBondContact O-N 3.29Å; T49-S51 PolarHBondContact OG1-N 2.88Å; T49-S51 VanDerWaalsContact OG1-N 3.14Å; S51-S114 WeakPolarHBondContact O-CB 3.26Å; S51-S114 PolarHBondContact O-OG 3.29Å
52	N	92.1	Very high	93.1	Very high	32 Å²	32	54.9 Å²	54.9	17%	0.171	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	76.6	171.8	-67.5	-24.3	0	0	0	108.1	V48 T49 W112 Y113 S114	V48-N52 CarbonylContact C-O 3.53Å; V48-N52 VanDerWaalsContact CA-O 3.31Å; V48-N52 WeakPolarHBondContact CA-O 3.34Å; V48-N52 WeakPolarHBondContact CG1-O 3.43Å; T49-N52 PolarHBondContact N-O 2.78Å; T49-N52 CarbonylContact O-C 3.38Å; T49-N52 PolarHBondContact O-N 3.47Å; T49-N52 PolarHBondContact OG1-N 2.88Å; N52-W112 CarbonylContact C-O 3.57Å; N52-W112 VanDerWaalsContact CA-O 3.23Å; N52-W112 WeakPolarHBondContact CA-O 3.47Å; N52-Y113 HydrophobicContact CB-CD1 4.15Å; N52-Y113 WeakPolarHBondContact OD1-CA 3.48Å; N52-S114 PolarHBondContact OD1-N 3.37Å; N52-S114 PolarHBondContact OD1-OG 3.47Å
53	Y	93.3	Very high	92.2	Very high	68 Å²	68	55.4 Å²	55.4	27%	0.267	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	160.7	-164.7	53.9	-96.6	0	0	0	112.7	T49 T72 L111 W112	T49-Y53 VanDerWaalsContact O-CA 3.3Å; T49-Y53 WeakPolarHBondContact O-CA 3.36Å; T49-Y53 PolarHBondContact O-N 3.44Å; Y53-T72 WeakPolarHBondContact CB-OG1 3.49Å; Y53-L111 WeakPolarHBondContact O-CA 3.43Å; Y53-W112 HydrophobicContact CD2-CB 4.08Å; Y53-W112 HydrophobicContact CE1-CB 4.42Å; Y53-W112 AromaticContact CE1-CD1 3.78Å; Y53-W112 HydrophobicContact CE1-CG 4.36Å; Y53-W112 HydrophobicContact CE2-CB 3.66Å; Y53-W112 HydrophobicContact CE2-CG 4.09Å; Y53-W112 AromaticContact CZ-CD1 3.56Å; Y53-W112 AromaticContact CZ-CG 3.8Å; Y53-W112 PolarHBondContact N-O 2.81Å; Y53-W112 VanDerWaalsContact N-O 3.13Å; Y53-W112 PolarHBondContact O-N 3.21Å
54	A	95.6	Very high	91.9	Very high	0 Å²	0	62.8 Å²	62.8	0%	0	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	149.8	172.3	0	0	0	0	0	111.8	T72 A92 A110 L111	A54-T72 PolarHBondContact O-N 3.08Å; A54-T72 VanDerWaalsContact O-N 3.08Å; A54-A92 HydrophobicContact CB-CB 3.23Å; A54-A110 CarbonylContact C-O 3.49Å; A54-A110 WeakPolarHBondContact CA-O 3.18Å; A54-L111 HydrophobicContact CB-CD2 3.58Å
55	N	96.8	Very high	91.9	Very high	48 Å²	48	66.2 Å²	66.2	26%	0.257	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	142	161.1	-51	-83.4	0	0	0	108	I69 G70 G71 C109 A110	N55-I69 CarbonylContact C-O 3.57Å; N55-I69 WeakPolarHBondContact CA-O 3.39Å; N55-G70 WeakPolarHBondContact OD1-CA 3.38Å; N55-G71 PolarHBondContact OD1-N 3.13Å; N55-G71 VanDerWaalsContact OD1-N 3.14Å; N55-C109 WeakPolarHBondContact O-CA 3.36Å; N55-A110 PolarHBondContact N-O 2.82Å; N55-A110 PolarHBondContact O-N 3.06Å
56	W	97.7	Very high	92.1	Very high	2 Å²	2	65.1 Å²	65.1	1%	0.008	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	132.1	179.6	-70.3	97.2	0	0	0	110	L39 C41 L68 I69 A92 L94 F108 C109	L39-W56 HydrophobicContact CB-CH2 3.89Å; L39-W56 HydrophobicContact CB-CZ3 4.04Å; C41-W56 HydrophobicContact CB-CH2 3.74Å; C41-W56 HydrophobicContact CB-CZ2 3.81Å; W56-L68 HydrophobicContact CB-CB 4.27Å; W56-L68 WeakPolarHBondContact O-CB 3.47Å; W56-L68 PolarHBondContact O-N 3.14Å; W56-I69 HydrophobicContact CB-CB 4.21Å; W56-I69 HydrophobicContact CB-CG1 4.46Å; W56-I69 PolarHBondContact N-O 3.06Å; W56-I69 PolarHBondContact O-N 3.31Å; W56-A92 HydrophobicContact CZ2-CB 4.34Å; W56-L94 HydrophobicContact CB-CD1 4.27Å; W56-L94 HydrophobicContact CB-CD2 4.23Å; W56-L94 HydrophobicContact CD2-CB 3.52Å; W56-L94 HydrophobicContact CD2-CD2 4.03Å; W56-L94 HydrophobicContact CD2-CG 4.27Å; W56-L94 HydrophobicContact CE3-CB 3.86Å; W56-L94 HydrophobicContact CE3-CD2 3.84Å; W56-L94 HydrophobicContact CE3-CG 4.47Å; W56-L94 HydrophobicContact CG-CB 3.92Å; W56-L94 HydrophobicContact CG-CD1 4.2Å; W56-L94 HydrophobicContact CG-CD2 4.22Å; W56-L94 HydrophobicContact CG-CG 4.35Å; W56-L94 HydrophobicContact CH2-CB 4.13Å; W56-L94 HydrophobicContact CZ2-CB 3.83Å; W56-L94 HydrophobicContact CZ3-CB 4.15Å; W56-L94 HydrophobicContact CZ3-CD2 4.47Å; W56-F108 WeakPolarHBondContact CA-O 3.41Å; W56-C109 HydrophobicContact CD2-CB 4.47Å; W56-C109 HydrophobicContact CE3-CB 4.11Å; W56-C109 HydrophobicContact CH2-CB 4.05Å; W56-C109 HydrophobicContact CZ2-CB 4.38Å; W56-C109 HydrophobicContact CZ3-CB 3.9Å
57	V	96.5	Very high	92.4	Very high	37 Å²	37	65.3 Å²	65.3	22%	0.224	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	141.2	-179.4	-176.7	0	0	0	0	109	F65 T66 Y107 F108	V57-F65 HydrophobicContact CG1-CB 3.85Å; V57-F65 HydrophobicContact CG1-CD1 3.81Å; V57-F65 HydrophobicContact CG1-CG 4.3Å; V57-T66 CarbonylContact C-O 3.55Å; V57-T66 WeakPolarHBondContact CA-O 3.35Å; V57-T66 WeakPolarHBondContact CG1-O 3.5Å; V57-Y107 CarbonylContact O-C 3.59Å; V57-Y107 WeakPolarHBondContact O-CA 3.47Å; V57-F108 PolarHBondContact N-O 3.01Å; V57-F108 PolarHBondContact O-N 3.45Å
58	Q	96.5	Very high	92.6	Very high	11 Å²	11	63.2 Å²	63.2	5%	0.051	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	133.4	174.6	-167.8	-179.8	39.6	0	0	110	K60 T66 L68 A105 I106 Y107	Q58-K60 HydrophobicContact CG-CG 4.26Å; Q58-K60 VanDerWaalsContact NE2-CE 3.33Å; Q58-T66 PolarHBondContact N-O 3.13Å; Q58-T66 PolarHBondContact O-N 2.81Å; Q58-L68 HydrophobicContact CB-CD1 3.93Å; Q58-L68 HydrophobicContact CB-CD2 4.1Å; Q58-L68 HydrophobicContact CB-CG 3.98Å; Q58-A105 HydrophobicContact CG-CB 3.44Å; Q58-A105 VanDerWaalsContact CG-CB 3.44Å; Q58-I106 WeakPolarHBondContact CA-O 3.36Å; Q58-Y107 HydrophobicContact CB-CD1 4.42Å; Q58-Y107 HydrophobicContact CB-CE1 4.31Å; Q58-Y107 HydrophobicContact CG-CD1 4.33Å; Q58-Y107 HydrophobicContact CG-CE1 3.93Å; Q58-Y107 PolarHBondContact NE2-OH 2.85Å
59	E	95.1	Very high	92.7	Very high	64 Å²	64	63.3 Å²	63.3	30%	0.299	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	119.3	169.2	-175.5	-178.1	-175.1	0	0	108.6	F65 A105 I106 F108	E59-F65 HydrophobicContact CB-CD1 3.95Å; E59-F65 HydrophobicContact CB-CE1 3.8Å; E59-F65 HydrophobicContact CG-CD1 4.29Å; E59-F65 HydrophobicContact CG-CE1 3.93Å; E59-F65 HydrophobicContact CG-CZ 4.28Å; E59-F65 WeakPolarHBondContact OE2-CE1 3.5Å; E59-A105 WeakPolarHBondContact O-CB 3.44Å; E59-I106 HydrophobicContact CB-CB 4.34Å; E59-I106 PolarHBondContact N-O 3.12Å; E59-I106 PolarHBondContact O-N 3.34Å; E59-F108 HydrophobicContact CB-CD2 4.47Å; E59-F108 HydrophobicContact CB-CE2 3.9Å; E59-F108 WeakPolarHBondContact OE2-CE2 3.47Å
60	K	93.1	Very high	92.8	Very high	48 Å²	48	62 Å²	62	21%	0.209	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	150.7	173.6	-59.4	-175.5	-179.2	-168.9	0	108.8	Q58 D62 H63 E102 A105	Q58-K60 HydrophobicContact CG-CG 4.26Å; Q58-K60 VanDerWaalsContact NE2-CE 3.33Å; K60-D62 PolarHBondContact O-N 2.83Å; K60-H63 HydrophobicContact CB-CB 4.06Å; K60-H63 PolarHBondContact O-N 2.84Å; K60-H63 VanDerWaalsContact O-O 3.08Å; K60-E102 VanDerWaalsContact CE-O 3.26Å; K60-E102 WeakPolarHBondContact CE-O 3.47Å; K60-E102 PolarHBondContact NZ-O 2.9Å; K60-A105 HydrophobicContact CG-CB 3.91Å
61	P	86.4	Confident	92.9	Very high	123 Å²	123	57.9 Å²	57.9	80%	0.799	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49	-37.6	-177	-29.7	35.3	0	0	0	114.9
62	D	83.7	Confident	92.9	Very high	155 Å²	155	55.1 Å²	55.1	83%	0.829	31%	0.306	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.5	-0.1	-176.2	-55.8	-49.6	0	0	0	114.5	K60	K60-D62 PolarHBondContact O-N 2.83Å
63	H	77.7	Confident	93.1	Very high	117 Å²	117	58.5 Å²	58.5	54%	0.542	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	147.8	-175	-61.8	63.4	0	0	0	111.5	K60	K60-H63 HydrophobicContact CB-CB 4.06Å; K60-H63 PolarHBondContact O-N 2.84Å; K60-H63 VanDerWaalsContact O-O 3.08Å
64	L	87.1	Confident	93.3	Very high	158 Å²	158	60.2 Å²	60.2	83%	0.827	34%	0.338	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-62.4	157	167.1	-59.7	179.1	0	0	0	110.5	T66	L64-T66 PolarHBondContact O-N 2.91Å; L64-T66 PolarHBondContact O-OG1 3.16Å
65	F	92.4	Very high	93.4	Very high	131 Å²	131	65.9 Å²	65.9	58%	0.575	36%	0.359	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-46.2	122.5	172.3	-70.8	-77.8	0	0	0	111.4	V57 E59 F108	V57-F65 HydrophobicContact CG1-CB 3.85Å; V57-F65 HydrophobicContact CG1-CD1 3.81Å; V57-F65 HydrophobicContact CG1-CG 4.3Å; E59-F65 HydrophobicContact CB-CD1 3.95Å; E59-F65 HydrophobicContact CB-CE1 3.8Å; E59-F65 HydrophobicContact CG-CD1 4.29Å; E59-F65 HydrophobicContact CG-CE1 3.93Å; E59-F65 HydrophobicContact CG-CZ 4.28Å; E59-F65 WeakPolarHBondContact OE2-CE1 3.5Å; F65-F108 HydrophobicContact CE1-CD2 4.14Å; F65-F108 AromaticContact CE1-CE2 3.9Å; F65-F108 HydrophobicContact CE1-CE2 3.9Å
66	T	94.7	Very high	93.4	Very high	59 Å²	59	65 Å²	65	36%	0.362	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	119.9	179.9	-60.8	0	0	0	0	109.6	V57 Q58 L64 L68	V57-T66 CarbonylContact C-O 3.55Å; V57-T66 WeakPolarHBondContact CA-O 3.35Å; V57-T66 WeakPolarHBondContact CG1-O 3.5Å; Q58-T66 PolarHBondContact N-O 3.13Å; Q58-T66 PolarHBondContact O-N 2.81Å; L64-T66 PolarHBondContact O-N 2.91Å; L64-T66 PolarHBondContact O-OG1 3.16Å; T66-L68 PolarHBondContact O-N 3.14Å
67	G	96.6	Very high	93.4	Very high	40 Å²	40	71.3 Å²	71.3	41%	0.412	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.8	127.8	172.2	0	0	0	0	0	110.8	A76 V79	G67-A76 WeakPolarHBondContact O-CB 3.39Å; G67-V79 WeakPolarHBondContact O-CG2 3.28Å
68	L	98	Very high	93.4	Very high	3 Å²	3	73.6 Å²	73.6	2%	0.016	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	-59.8	178.8	-63.6	179.9	0	0	0	111.6	W56 Q58 T66 R75 A76 V79 F83 L94 Y107	W56-L68 HydrophobicContact CB-CB 4.27Å; W56-L68 WeakPolarHBondContact O-CB 3.47Å; W56-L68 PolarHBondContact O-N 3.14Å; Q58-L68 HydrophobicContact CB-CD1 3.93Å; Q58-L68 HydrophobicContact CB-CD2 4.1Å; Q58-L68 HydrophobicContact CB-CG 3.98Å; T66-L68 PolarHBondContact O-N 3.14Å; L68-R75 WeakPolarHBondContact O-CA 3.4Å; L68-A76 PolarHBondContact O-N 2.84Å; L68-V79 HydrophobicContact CD2-CG1 3.92Å; L68-V79 HydrophobicContact CD2-CG2 4.23Å; L68-F83 HydrophobicContact CD1-CD1 4.02Å; L68-F83 HydrophobicContact CD1-CE1 4.15Å; L68-F83 HydrophobicContact CD2-CD1 4.42Å; L68-L94 HydrophobicContact CD1-CD1 4.43Å; L68-L94 HydrophobicContact CD1-CD2 3.84Å; L68-Y107 HydrophobicContact CD1-CD1 3.73Å; L68-Y107 HydrophobicContact CD1-CE1 3.62Å
69	I	98.2	Very high	93.4	Very high	4 Å²	4	73.9 Å²	73.9	2%	0.021	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	130.9	-176.1	-51.2	-63.7	0	0	0	108.4	N55 W56 N74 R75 L94	N55-I69 CarbonylContact C-O 3.57Å; N55-I69 WeakPolarHBondContact CA-O 3.39Å; W56-I69 HydrophobicContact CB-CB 4.21Å; W56-I69 HydrophobicContact CB-CG1 4.46Å; W56-I69 PolarHBondContact N-O 3.06Å; W56-I69 PolarHBondContact O-N 3.31Å; I69-N74 CarbonylContact C-O 3.52Å; I69-N74 WeakPolarHBondContact CA-O 3.39Å; I69-R75 HydrophobicContact CD1-CB 3.94Å; I69-R75 HydrophobicContact CD1-CG 4.19Å; I69-L94 HydrophobicContact CG1-CD1 3.72Å
70	G	96.2	Very high	93.5	Very high	23 Å²	23	73.2 Å²	73.2	24%	0.237	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	153.7	167.9	0	0	0	0	0	112	N55 T72 N74	N55-G70 WeakPolarHBondContact OD1-CA 3.38Å; G70-T72 PolarHBondContact O-N 3.37Å; G70-N74 PolarHBondContact N-O 2.82Å; G70-N74 WeakPolarHBondContact O-CA 3.2Å; G70-N74 WeakPolarHBondContact O-CB 3.26Å; G70-N74 PolarHBondContact O-N 2.87Å
71	G	92.6	Very high	93.7	Very high	24 Å²	24	74.7 Å²	74.7	25%	0.247	46%	0.455	C	S	.	.	T	Hydrogen-bonded Turn	trans	56.5	45.5	170.4	0	0	0	0	0	114.1	N55 N73	N55-G71 PolarHBondContact OD1-N 3.13Å; N55-G71 VanDerWaalsContact OD1-N 3.14Å; G71-N73 VanDerWaalsContact C-N 3.26Å; G71-N73 PolarHBondContact O-N 3.47Å
72	T	90.8	Very high	94.3	Very high	11 Å²	11	71 Å²	71	7%	0.067	43%	0.425	C	S	.	.	T	Hydrogen-bonded Turn	trans	75.2	-47.9	-178.5	-58.4	0	0	0	0	115.8	Y53 A54 G70 G85 S86 L87	Y53-T72 WeakPolarHBondContact CB-OG1 3.49Å; A54-T72 PolarHBondContact O-N 3.08Å; A54-T72 VanDerWaalsContact O-N 3.08Å; G70-T72 PolarHBondContact O-N 3.37Å; T72-G85 CarbonylContact O-C 3.55Å; T72-G85 VanDerWaalsContact O-CA 3.25Å; T72-G85 WeakPolarHBondContact O-CA 3.21Å; T72-S86 PolarHBondContact O-N 3.25Å; T72-L87 HydrophobicContact CG2-CD1 4.14Å; T72-L87 HydrophobicContact CG2-CD2 3.79Å; T72-L87 HydrophobicContact CG2-CG 3.59Å
73	N	95.8	Very high	95	Very high	102 Å²	102	63.7 Å²	63.7	55%	0.545	39%	0.386	S	S	.	.	T	Hydrogen-bonded Turn	trans	-142.1	1.2	-172.6	67.5	-11.2	0	0	0	115.5	G71 R75 G85	G71-N73 VanDerWaalsContact C-N 3.26Å; G71-N73 PolarHBondContact O-N 3.47Å; N73-R75 PolarHBondContact O-N 2.82Å; N73-G85 VanDerWaalsContact CB-O 3.24Å; N73-G85 WeakPolarHBondContact CB-O 3.32Å
74	N	97.3	Very high	96	Very high	105 Å²	105	60.5 Å²	60.5	56%	0.561	38%	0.377	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.1	103.3	-180	-59.4	-35.5	0	0	0	110.2	I69 G70 A76	I69-N74 CarbonylContact C-O 3.52Å; I69-N74 WeakPolarHBondContact CA-O 3.39Å; G70-N74 PolarHBondContact N-O 2.82Å; G70-N74 WeakPolarHBondContact O-CA 3.2Å; G70-N74 WeakPolarHBondContact O-CB 3.26Å; G70-N74 PolarHBondContact O-N 2.87Å; N74-A76 PolarHBondContact O-N 2.94Å
75	R	97.8	Very high	96.5	Very high	119 Å²	119	53.4 Å²	53.4	45%	0.449	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.1	129.6	176	-176.1	170.3	66.2	-130.3	-2.7	111.2	L68 I69 N73 V79 P80 A81 F83	L68-R75 WeakPolarHBondContact O-CA 3.4Å; I69-R75 HydrophobicContact CD1-CB 3.94Å; I69-R75 HydrophobicContact CD1-CG 4.19Å; N73-R75 PolarHBondContact O-N 2.82Å; R75-V79 VanDerWaalsContact CD-O 3.31Å; R75-V79 WeakPolarHBondContact CD-O 3.44Å; R75-V79 HydrophobicContact CG-CB 3.63Å; R75-V79 HydrophobicContact CG-CG1 3.75Å; R75-V79 PolarHBondContact NE-O 2.88Å; R75-P80 WeakPolarHBondContact CD-O 3.34Å; R75-A81 PolarHBondContact NH1-O 2.88Å; R75-F83 WeakPolarHBondContact CD-O 3.18Å; R75-F83 PolarHBondContact NH1-O 3.17Å
76	A	97.8	Very high	96.7	Very high	30 Å²	30	49.2 Å²	49.2	25%	0.248	33%	0.329	C	S	.	.	P	Polyproline II helix	trans	-67.1	153.5	179.7	0	0	0	0	0	111.8	G67 L68 N74 G78 V79	G67-A76 WeakPolarHBondContact O-CB 3.39Å; L68-A76 PolarHBondContact O-N 2.84Å; N74-A76 PolarHBondContact O-N 2.94Å; A76-G78 PolarHBondContact O-N 2.87Å; A76-V79 HydrophobicContact CB-CG2 3.88Å; A76-V79 WeakPolarHBondContact O-CB 3.34Å; A76-V79 PolarHBondContact O-N 2.93Å
77	P	96.8	Very high	96.8	Very high	134 Å²	134	49.5 Å²	49.5	87%	0.87	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.8	137.2	176.5	-24.8	34.6	0	0	0	112.2	V79	P77-V79 PolarHBondContact O-N 2.02Å
78	G	95.9	Very high	96.8	Very high	85 Å²	85	51.6 Å²	51.6	88%	0.876	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	81	-10.9	-179.8	0	0	0	0	0	115.3	A76	A76-G78 PolarHBondContact O-N 2.87Å
79	V	96.9	Very high	96.7	Very high	17 Å²	17	55 Å²	55	10%	0.103	37%	0.365	C	S	.	.			trans	-74.4	130.1	176.6	178	0	0	0	0	109.9	G67 L68 R75 A76 P77 F83	G67-V79 WeakPolarHBondContact O-CG2 3.28Å; L68-V79 HydrophobicContact CD2-CG1 3.92Å; L68-V79 HydrophobicContact CD2-CG2 4.23Å; R75-V79 VanDerWaalsContact CD-O 3.31Å; R75-V79 WeakPolarHBondContact CD-O 3.44Å; R75-V79 HydrophobicContact CG-CB 3.63Å; R75-V79 HydrophobicContact CG-CG1 3.75Å; R75-V79 PolarHBondContact NE-O 2.88Å; A76-V79 HydrophobicContact CB-CG2 3.88Å; A76-V79 WeakPolarHBondContact O-CB 3.34Å; A76-V79 PolarHBondContact O-N 2.93Å; P77-V79 PolarHBondContact O-N 2.02Å; V79-F83 HydrophobicContact CG1-CB 3.78Å; V79-F83 HydrophobicContact CG1-CD2 3.9Å; V79-F83 HydrophobicContact CG1-CG 4Å
80	P	97.8	Very high	96.6	Very high	50 Å²	50	57.4 Å²	57.4	33%	0.325	38%	0.378	S	S	.	.			trans	-58.9	150.9	-177.6	-28.2	36.4	0	0	0	114.5	R75 R82 F83	R75-P80 WeakPolarHBondContact CD-O 3.34Å; P80-R82 HydrophobicContact CB-CG 3.77Å; P80-R82 VanDerWaalsContact CB-NH1 3.29Å; P80-R82 PolarHBondContact O-N 2.88Å; P80-R82 VanDerWaalsContact O-N 3.09Å; P80-F83 HydrophobicContact CB-CD2 4.04Å; P80-F83 HydrophobicContact CB-CE2 4.27Å; P80-F83 HydrophobicContact CG-CD2 4.27Å; P80-F83 HydrophobicContact CG-CE2 4.16Å; P80-F83 PolarHBondContact O-N 2.85Å
81	A	97.8	Very high	96.6	Very high	78 Å²	78	59.4 Å²	59.4	65%	0.645	38%	0.38	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.9	-22.3	-177.4	0	0	0	0	0	114.6	R75 F83	R75-A81 PolarHBondContact NH1-O 2.88Å; A81-F83 PolarHBondContact O-N 2.9Å
82	R	97.9	Very high	96.8	Very high	45 Å²	45	58.3 Å²	58.3	17%	0.17	37%	0.368	C	S	.	.	T	Hydrogen-bonded Turn	trans	-61.7	-24.4	174.6	54	169.9	-170.6	-79.9	5.1	114.3	P80 I96 T97 D103	P80-R82 HydrophobicContact CB-CG 3.77Å; P80-R82 VanDerWaalsContact CB-NH1 3.29Å; P80-R82 PolarHBondContact O-N 2.88Å; P80-R82 VanDerWaalsContact O-N 3.09Å; R82-I96 WeakPolarHBondContact O-CA 3.2Å; R82-T97 WeakPolarHBondContact CA-OG1 3.15Å; R82-T97 WeakPolarHBondContact CB-O 2.95Å; R82-T97 PolarHBondContact O-N 2.97Å; R82-T97 PolarHBondContact O-OG1 3.23Å; R82-D103 IonicContact CZ-OD1 3.75Å; R82-D103 VanDerWaalsContact CZ-OD1 3.3Å; R82-D103 IonicContact CZ-OD2 3.8Å; R82-D103 IonicContact NE-OD1 2.96Å; R82-D103 PolarHBondContact NE-OD1 3.41Å; R82-D103 VanDerWaalsContact NE-OD1 3.08Å; R82-D103 IonicContact NE-OD2 3.3Å; R82-D103 PolarHBondContact NE-OD2 3.44Å; R82-D103 IonicContact NH2-OD1 2.7Å; R82-D103 PolarHBondContact NH2-OD1 2.97Å; R82-D103 IonicContact NH2-OD2 3.08Å
83	F	98.4	Very high	97.2	Very high	3 Å²	3	57.8 Å²	57.8	1%	0.013	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.4	130.7	175.4	-64.4	-90.5	0	0	0	109.9	L68 R75 V79 P80 A81 L94 T95 I96 D103 Y107	L68-F83 HydrophobicContact CD1-CD1 4.02Å; L68-F83 HydrophobicContact CD1-CE1 4.15Å; L68-F83 HydrophobicContact CD2-CD1 4.42Å; R75-F83 WeakPolarHBondContact CD-O 3.18Å; R75-F83 PolarHBondContact NH1-O 3.17Å; V79-F83 HydrophobicContact CG1-CB 3.78Å; V79-F83 HydrophobicContact CG1-CD2 3.9Å; V79-F83 HydrophobicContact CG1-CG 4Å; P80-F83 HydrophobicContact CB-CD2 4.04Å; P80-F83 HydrophobicContact CB-CE2 4.27Å; P80-F83 HydrophobicContact CG-CD2 4.27Å; P80-F83 HydrophobicContact CG-CE2 4.16Å; P80-F83 PolarHBondContact O-N 2.85Å; A81-F83 PolarHBondContact O-N 2.9Å; F83-L94 HydrophobicContact CD1-CD1 4.42Å; F83-T95 WeakPolarHBondContact CA-O 2.91Å; F83-I96 HydrophobicContact CD1-CD1 4.15Å; F83-I96 HydrophobicContact CD1-CG1 3.73Å; F83-I96 HydrophobicContact CD1-CG2 4.29Å; F83-I96 HydrophobicContact CE1-CB 4.43Å; F83-I96 HydrophobicContact CE1-CD1 3.62Å; F83-I96 HydrophobicContact CE1-CG1 3.69Å; F83-I96 HydrophobicContact CE1-CG2 3.95Å; F83-I96 HydrophobicContact CZ-CG2 4.17Å; F83-D103 VanDerWaalsContact CZ-OD1 3.28Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.17Å; F83-Y107 HydrophobicContact CE1-CE1 4.04Å
84	S	98.3	Very high	97.3	Very high	49 Å²	49	52.9 Å²	52.9	34%	0.343	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.2	144.8	173.6	57.9	0	0	0	0	110.8	L94 T95	S84-L94 WeakPolarHBondContact O-CA 3.3Å; S84-T95 PolarHBondContact N-O 3.37Å; S84-T95 PolarHBondContact O-N 2.79Å
85	G	98	Very high	97.3	Very high	9 Å²	9	49 Å²	49	9%	0.093	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	146.1	171.9	0	0	0	0	0	111.4	T72 N73 A93	T72-G85 CarbonylContact O-C 3.55Å; T72-G85 VanDerWaalsContact O-CA 3.25Å; T72-G85 WeakPolarHBondContact O-CA 3.21Å; N73-G85 VanDerWaalsContact CB-O 3.24Å; N73-G85 WeakPolarHBondContact CB-O 3.32Å; G85-A93 VanDerWaalsContact CA-O 3.26Å; G85-A93 WeakPolarHBondContact CA-O 3.43Å
86	S	97.6	Very high	97.4	Very high	44 Å²	44	43.5 Å²	43.5	31%	0.308	30%	0.299	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.6	178.5	-179.6	63.1	0	0	0	0	111.1	T72 A93	T72-S86 PolarHBondContact O-N 3.25Å; S86-A93 PolarHBondContact N-O 2.69Å; S86-A93 PolarHBondContact O-N 2.98Å
87	L	97.4	Very high	97.4	Very high	64 Å²	64	45.2 Å²	45.2	34%	0.335	31%	0.306	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	133.8	170.4	-62.8	173.6	0	0	0	109.3	V48 T72 K91	V48-L87 HydrophobicContact CB-CD2 4.37Å; V48-L87 HydrophobicContact CG1-CD2 3.89Å; T72-L87 HydrophobicContact CG2-CD1 4.14Å; T72-L87 HydrophobicContact CG2-CD2 3.79Å; T72-L87 HydrophobicContact CG2-CG 3.59Å; L87-K91 WeakPolarHBondContact CA-O 3.5Å
88	I	96.2	Very high	97.4	Very high	84 Å²	84	40.2 Å²	40.2	43%	0.431	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	98	170.3	-58.9	176.4	0	0	0	107.2	T38 T40 D90 K91 A93	T38-I88 HydrophobicContact CG2-CD1 3.94Å; T40-I88 HydrophobicContact CG2-CD1 4.37Å; I88-D90 PolarHBondContact O-N 3Å; I88-D90 VanDerWaalsContact O-N 3.13Å; I88-K91 PolarHBondContact N-O 2.9Å; I88-K91 PolarHBondContact O-N 3.47Å; I88-K91 VanDerWaalsContact O-N 3.16Å; I88-A93 HydrophobicContact CD1-CB 3.65Å; I88-A93 HydrophobicContact CG1-CB 3.81Å
89	G	95.3	Very high	97.5	Very high	75 Å²	75	36.6 Å²	36.6	77%	0.773	24%	0.241	S	C	*	.	T	Hydrogen-bonded Turn	trans	61.1	-114.2	-173.1	0	0	0	0	0	111.2
90	D	95.3	Very high	97.5	Very high	55 Å²	55	39.6 Å²	39.6	29%	0.294	25%	0.254	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.1	8.2	-178.1	69.6	-28.8	0	0	0	114.2	R42 A47 V48 I88	R42-D90 IonicContact NH1-OD2 3.72Å; A47-D90 HydrophobicContact CB-CB 3.92Å; V48-D90 WeakPolarHBondContact CB-O 3.46Å; V48-D90 PolarHBondContact N-O 3.01Å; I88-D90 PolarHBondContact O-N 3Å; I88-D90 VanDerWaalsContact O-N 3.13Å
91	K	97.3	Very high	97.4	Very high	64 Å²	64	42.2 Å²	42.2	28%	0.278	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	146.7	-172.5	-39.7	-173.8	-138.6	-55.5	0	111.2	C41 R42 L87 I88	C41-K91 CarbonylContact O-C 3.17Å; C41-K91 WeakPolarHBondContact O-CA 3.47Å; C41-K91 WeakPolarHBondContact O-CB 3.42Å; R42-K91 HydrophobicContact CB-CD 4.49Å; R42-K91 HydrophobicContact CB-CG 4.14Å; L87-K91 WeakPolarHBondContact CA-O 3.5Å; I88-K91 PolarHBondContact N-O 2.9Å; I88-K91 PolarHBondContact O-N 3.47Å; I88-K91 VanDerWaalsContact O-N 3.16Å
92	A	97.2	Very high	97.2	Very high	1 Å²	1	43 Å²	43	1%	0.008	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.7	145.1	160.1	0	0	0	0	0	110.3	T40 C41 V48 A54 W56	T40-A92 CarbonylContact C-O 3.53Å; T40-A92 VanDerWaalsContact CA-O 3.26Å; T40-A92 WeakPolarHBondContact CA-O 3.16Å; C41-A92 HydrophobicContact CB-CB 4.41Å; C41-A92 PolarHBondContact N-O 3.41Å; C41-A92 PolarHBondContact O-N 3.47Å; V48-A92 HydrophobicContact CG1-CB 3.83Å; A54-A92 HydrophobicContact CB-CB 3.23Å; W56-A92 HydrophobicContact CZ2-CB 4.34Å
93	A	97.9	Very high	97.1	Very high	0 Å²	0	41.4 Å²	41.4	0%	0	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	141.6	174.7	0	0	0	0	0	110.5	T38 L39 T40 G85 S86 I88	T38-A93 HydrophobicContact CG2-CB 3.91Å; L39-A93 CarbonylContact O-C 3.52Å; L39-A93 WeakPolarHBondContact O-CA 3.31Å; T40-A93 HydrophobicContact CG2-CB 4.39Å; G85-A93 VanDerWaalsContact CA-O 3.26Å; G85-A93 WeakPolarHBondContact CA-O 3.43Å; S86-A93 PolarHBondContact N-O 2.69Å; S86-A93 PolarHBondContact O-N 2.98Å; I88-A93 HydrophobicContact CD1-CB 3.65Å; I88-A93 HydrophobicContact CG1-CB 3.81Å
94	L	98.3	Very high	96.9	Very high	0 Å²	0	49 Å²	49	0%	0	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	115.1	165.3	175	69.5	0	0	0	107.4	T38 L39 W56 L68 I69 F83 S84 I96 Y107	T38-L94 CarbonylContact C-O 3.09Å; T38-L94 WeakPolarHBondContact CA-O 3.47Å; L39-L94 HydrophobicContact CB-CB 4.4Å; L39-L94 HydrophobicContact CD1-CD2 4.33Å; L39-L94 PolarHBondContact N-O 3.31Å; L39-L94 PolarHBondContact O-N 2.9Å; W56-L94 HydrophobicContact CB-CD1 4.27Å; W56-L94 HydrophobicContact CB-CD2 4.23Å; W56-L94 HydrophobicContact CD2-CB 3.52Å; W56-L94 HydrophobicContact CD2-CD2 4.03Å; W56-L94 HydrophobicContact CD2-CG 4.27Å; W56-L94 HydrophobicContact CE3-CB 3.86Å; W56-L94 HydrophobicContact CE3-CD2 3.84Å; W56-L94 HydrophobicContact CE3-CG 4.47Å; W56-L94 HydrophobicContact CG-CB 3.92Å; W56-L94 HydrophobicContact CG-CD1 4.2Å; W56-L94 HydrophobicContact CG-CD2 4.22Å; W56-L94 HydrophobicContact CG-CG 4.35Å; W56-L94 HydrophobicContact CH2-CB 4.13Å; W56-L94 HydrophobicContact CZ2-CB 3.83Å; W56-L94 HydrophobicContact CZ3-CB 4.15Å; W56-L94 HydrophobicContact CZ3-CD2 4.47Å; L68-L94 HydrophobicContact CD1-CD1 4.43Å; L68-L94 HydrophobicContact CD1-CD2 3.84Å; I69-L94 HydrophobicContact CG1-CD1 3.72Å; F83-L94 HydrophobicContact CD1-CD1 4.42Å; S84-L94 WeakPolarHBondContact O-CA 3.3Å; L94-I96 HydrophobicContact CG-CG1 4.46Å; L94-Y107 HydrophobicContact CD2-CD1 3.6Å; L94-Y107 HydrophobicContact CD2-CE1 4.04Å; L94-Y107 HydrophobicContact CD2-CG 4.44Å
95	T	98.2	Very high	96.7	Very high	23 Å²	23	48 Å²	48	14%	0.141	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	130.4	177.3	-52.3	0	0	0	0	109.5	T36 V37 F83 S84 T97	T36-T95 HydrophobicContact CG2-CG2 3.65Å; V37-T95 WeakPolarHBondContact O-CA 3.44Å; F83-T95 WeakPolarHBondContact CA-O 2.91Å; S84-T95 PolarHBondContact N-O 3.37Å; S84-T95 PolarHBondContact O-N 2.79Å; T95-T97 HydrophobicContact CG2-CG2 4.09Å
96	I	98.2	Very high	96.6	Very high	4 Å²	4	52.2 Å²	52.2	2%	0.021	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	109	174.8	-46.8	174.4	0	0	0	106.8	T36 V37 L39 R82 F83 L94 Y107	T36-I96 VanDerWaalsContact CA-O 3.31Å; T36-I96 WeakPolarHBondContact CA-O 3.29Å; V37-I96 HydrophobicContact CG1-CB 3.82Å; V37-I96 HydrophobicContact CG1-CD1 4.11Å; V37-I96 HydrophobicContact CG1-CG1 4.23Å; V37-I96 PolarHBondContact N-O 3.04Å; V37-I96 PolarHBondContact O-N 3.24Å; L39-I96 HydrophobicContact CD1-CD1 4.04Å; L39-I96 HydrophobicContact CD1-CG1 4.48Å; R82-I96 WeakPolarHBondContact O-CA 3.2Å; F83-I96 HydrophobicContact CD1-CD1 4.15Å; F83-I96 HydrophobicContact CD1-CG1 3.73Å; F83-I96 HydrophobicContact CD1-CG2 4.29Å; F83-I96 HydrophobicContact CE1-CB 4.43Å; F83-I96 HydrophobicContact CE1-CD1 3.62Å; F83-I96 HydrophobicContact CE1-CG1 3.69Å; F83-I96 HydrophobicContact CE1-CG2 3.95Å; F83-I96 HydrophobicContact CZ-CG2 4.17Å; L94-I96 HydrophobicContact CG-CG1 4.46Å; I96-Y107 HydrophobicContact CD1-CE1 3.94Å; I96-Y107 HydrophobicContact CD1-CE2 4.43Å
97	T	98.2	Very high	96.6	Very high	65 Å²	65	51.1 Å²	51.1	40%	0.399	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.6	133.5	179.5	60.5	0	0	0	0	111.1	T36 R82 T95	T36-T97 HydrophobicContact CG2-CG2 3.94Å; R82-T97 WeakPolarHBondContact CA-OG1 3.15Å; R82-T97 WeakPolarHBondContact CB-O 2.95Å; R82-T97 PolarHBondContact O-N 2.97Å; R82-T97 PolarHBondContact O-OG1 3.23Å; T95-T97 HydrophobicContact CG2-CG2 4.09Å
98	G	98	Very high	96.5	Very high	30 Å²	30	52.1 Å²	52.1	31%	0.309	30%	0.295	S	S	.	.	S	Bend	trans	69	51	-178.9	0	0	0	0	0	110.9	E35 Q100	E35-G98 WeakPolarHBondContact O-CA 3.35Å; E35-G98 PolarHBondContact O-N 3.21Å; G98-Q100 VanDerWaalsContact O-CG 3.28Å; G98-Q100 WeakPolarHBondContact O-CG 3.48Å; G98-Q100 PolarHBondContact O-N 3.37Å
99	A	98	Very high	96.5	Very high	8 Å²	8	48.7 Å²	48.7	7%	0.066	28%	0.278	C	S	.	.			trans	-50.2	136.6	-177.5	0	0	0	0	0	111.4	T31 P33 G34 E35	T31-A99 HydrophobicContact CG2-CB 3.76Å; P33-A99 CarbonylContact C-O 3.5Å; P33-A99 VanDerWaalsContact CA-O 3.28Å; P33-A99 WeakPolarHBondContact CA-O 3.28Å; G34-A99 PolarHBondContact N-O 3.25Å; E35-A99 PolarHBondContact O-N 3.21Å
100	Q	97.2	Very high	96.5	Very high	80 Å²	80	47.6 Å²	47.6	37%	0.374	26%	0.262	S	S	.	.			trans	-119.9	161.5	-178.6	-47.8	-172.5	-73.1	0	0	110.6	G98 E102 D103	G98-Q100 VanDerWaalsContact O-CG 3.28Å; G98-Q100 WeakPolarHBondContact O-CG 3.48Å; G98-Q100 PolarHBondContact O-N 3.37Å; Q100-E102 HydrophobicContact CB-CG 4.13Å; Q100-E102 WeakPolarHBondContact CB-OE2 3.39Å; Q100-E102 VanDerWaalsContact CD-OE1 3.3Å; Q100-E102 PolarHBondContact O-N 3.03Å; Q100-E102 PolarHBondContact OE1-OE1 2.94Å; Q100-D103 PolarHBondContact N-OD2 2.93Å; Q100-D103 VanDerWaalsContact O-CB 3.29Å; Q100-D103 WeakPolarHBondContact O-CB 3.23Å; Q100-D103 PolarHBondContact O-N 3.15Å
101	T	94.5	Very high	96.5	Very high	106 Å²	106	46.2 Å²	46.2	65%	0.65	25%	0.254	S	S	*	.	G	3₁₀ helix	trans	-59.9	-34.2	179.2	-55.6	0	0	0	0	111.7	D103 E104	T101-D103 PolarHBondContact O-N 3.39Å; T101-E104 WeakPolarHBondContact O-CB 3.37Å; T101-E104 PolarHBondContact O-N 3.47Å
102	E	93.7	Very high	96.2	Very high	95 Å²	95	50.5 Å²	50.5	44%	0.444	27%	0.269	S	S	.	.	G	3₁₀ helix	trans	-69.5	-9.2	175.3	66.4	-96.9	-139.9	0	0	114.6	K60 Q100 E104	K60-E102 VanDerWaalsContact CE-O 3.26Å; K60-E102 WeakPolarHBondContact CE-O 3.47Å; K60-E102 PolarHBondContact NZ-O 2.9Å; Q100-E102 HydrophobicContact CB-CG 4.13Å; Q100-E102 WeakPolarHBondContact CB-OE2 3.39Å; Q100-E102 VanDerWaalsContact CD-OE1 3.3Å; Q100-E102 PolarHBondContact O-N 3.03Å; Q100-E102 PolarHBondContact OE1-OE1 2.94Å; E102-E104 VanDerWaalsContact C-N 3.3Å
103	D	95.2	Very high	95.8	Very high	11 Å²	11	52.4 Å²	52.4	6%	0.059	28%	0.276	C	S	.	.	G	3₁₀ helix	trans	-84.7	-6.2	176.2	-60.7	-32.4	0	0	0	111.9	R82 F83 Q100 T101 A105 Y107	R82-D103 IonicContact CZ-OD1 3.75Å; R82-D103 VanDerWaalsContact CZ-OD1 3.3Å; R82-D103 IonicContact CZ-OD2 3.8Å; R82-D103 IonicContact NE-OD1 2.96Å; R82-D103 PolarHBondContact NE-OD1 3.41Å; R82-D103 VanDerWaalsContact NE-OD1 3.08Å; R82-D103 IonicContact NE-OD2 3.3Å; R82-D103 PolarHBondContact NE-OD2 3.44Å; R82-D103 IonicContact NH2-OD1 2.7Å; R82-D103 PolarHBondContact NH2-OD1 2.97Å; R82-D103 IonicContact NH2-OD2 3.08Å; F83-D103 VanDerWaalsContact CZ-OD1 3.28Å; F83-D103 WeakPolarHBondContact CZ-OD1 3.17Å; Q100-D103 PolarHBondContact N-OD2 2.93Å; Q100-D103 VanDerWaalsContact O-CB 3.29Å; Q100-D103 WeakPolarHBondContact O-CB 3.23Å; Q100-D103 PolarHBondContact O-N 3.15Å; T101-D103 PolarHBondContact O-N 3.39Å; D103-A105 PolarHBondContact O-N 2.93Å; D103-A105 VanDerWaalsContact O-N 3.12Å; D103-Y107 WeakPolarHBondContact O-CE2 3.12Å; D103-Y107 PolarHBondContact O-OH 3.44Å
104	E	94.6	Very high	94.7	Very high	161 Å²	161	54.7 Å²	54.7	75%	0.752	29%	0.292	S	S	*	.			trans	-64.3	111.1	171.2	-170.9	175.4	172.1	0	0	110	T101 E102	T101-E104 WeakPolarHBondContact O-CB 3.37Å; T101-E104 PolarHBondContact O-N 3.47Å; E102-E104 VanDerWaalsContact C-N 3.3Å
105	A	95.2	Very high	93.3	Very high	28 Å²	28	61 Å²	61	23%	0.231	33%	0.326	C	S	.	.	S	Bend	trans	-165.1	169.8	-171.8	0	0	0	0	0	110.8	Q58 E59 K60 D103 Y107	Q58-A105 HydrophobicContact CG-CB 3.44Å; Q58-A105 VanDerWaalsContact CG-CB 3.44Å; E59-A105 WeakPolarHBondContact O-CB 3.44Å; K60-A105 HydrophobicContact CG-CB 3.91Å; D103-A105 PolarHBondContact O-N 2.93Å; D103-A105 VanDerWaalsContact O-N 3.12Å; A105-Y107 HydrophobicContact CB-CD2 4.43Å; A105-Y107 HydrophobicContact CB-CE2 3.86Å; A105-Y107 WeakPolarHBondContact O-CD2 3.38Å
106	I	95.7	Very high	91.1	Very high	98 Å²	98	66.7 Å²	66.7	50%	0.503	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.4	133	165.6	-54.5	175.8	0	0	0	108.1	Q58 E59 F108	Q58-I106 WeakPolarHBondContact CA-O 3.36Å; E59-I106 HydrophobicContact CB-CB 4.34Å; E59-I106 PolarHBondContact N-O 3.12Å; E59-I106 PolarHBondContact O-N 3.34Å; I106-F108 HydrophobicContact CB-CE2 4.12Å; I106-F108 HydrophobicContact CB-CZ 4.42Å; I106-F108 HydrophobicContact CG2-CD2 4.18Å; I106-F108 HydrophobicContact CG2-CE1 4.07Å; I106-F108 HydrophobicContact CG2-CE2 3.44Å; I106-F108 VanDerWaalsContact CG2-CE2 3.44Å; I106-F108 HydrophobicContact CG2-CZ 3.4Å
107	Y	96.7	Very high	88.5	Confident	21 Å²	21	79.3 Å²	79.3	8%	0.082	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	127.2	179.7	-66.6	-94.4	0	0	0	110.3	Q25 L39 V57 Q58 L68 F83 L94 I96 D103 A105	Q25-Y107 PolarHBondContact NE2-O 3.37Å; L39-Y107 HydrophobicContact CD2-CD2 4.14Å; L39-Y107 HydrophobicContact CD2-CG 4.01Å; V57-Y107 CarbonylContact O-C 3.59Å; V57-Y107 WeakPolarHBondContact O-CA 3.47Å; Q58-Y107 HydrophobicContact CB-CD1 4.42Å; Q58-Y107 HydrophobicContact CB-CE1 4.31Å; Q58-Y107 HydrophobicContact CG-CD1 4.33Å; Q58-Y107 HydrophobicContact CG-CE1 3.93Å; Q58-Y107 PolarHBondContact NE2-OH 2.85Å; L68-Y107 HydrophobicContact CD1-CD1 3.73Å; L68-Y107 HydrophobicContact CD1-CE1 3.62Å; F83-Y107 HydrophobicContact CE1-CE1 4.04Å; L94-Y107 HydrophobicContact CD2-CD1 3.6Å; L94-Y107 HydrophobicContact CD2-CE1 4.04Å; L94-Y107 HydrophobicContact CD2-CG 4.44Å; I96-Y107 HydrophobicContact CD1-CE1 3.94Å; I96-Y107 HydrophobicContact CD1-CE2 4.43Å; D103-Y107 WeakPolarHBondContact O-CE2 3.12Å; D103-Y107 PolarHBondContact O-OH 3.44Å; A105-Y107 HydrophobicContact CB-CD2 4.43Å; A105-Y107 HydrophobicContact CB-CE2 3.86Å; A105-Y107 WeakPolarHBondContact O-CD2 3.38Å
108	F	96	Very high	88	Confident	85 Å²	85	80 Å²	80	37%	0.373	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	134.6	178.7	-62.6	-82.1	0	0	0	111.3	W56 V57 E59 F65 I106	W56-F108 WeakPolarHBondContact CA-O 3.41Å; V57-F108 PolarHBondContact N-O 3.01Å; V57-F108 PolarHBondContact O-N 3.45Å; E59-F108 HydrophobicContact CB-CD2 4.47Å; E59-F108 HydrophobicContact CB-CE2 3.9Å; E59-F108 WeakPolarHBondContact OE2-CE2 3.47Å; F65-F108 HydrophobicContact CE1-CD2 4.14Å; F65-F108 AromaticContact CE1-CE2 3.9Å; F65-F108 HydrophobicContact CE1-CE2 3.9Å; I106-F108 HydrophobicContact CB-CE2 4.12Å; I106-F108 HydrophobicContact CB-CZ 4.42Å; I106-F108 HydrophobicContact CG2-CD2 4.18Å; I106-F108 HydrophobicContact CG2-CE1 4.07Å; I106-F108 HydrophobicContact CG2-CE2 3.44Å; I106-F108 VanDerWaalsContact CG2-CE2 3.44Å; I106-F108 HydrophobicContact CG2-CZ 3.4Å
109	C	96.3	Very high	87.4	Confident	13 Å²	13	82.6 Å²	82.6	9%	0.088	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	125.5	167.1	175.8	0	0	0	0	110.9	V23 Q25 C41 N55 W56	V23-C109 HydrophobicContact CG1-CB 4.42Å; Q25-C109 VanDerWaalsContact OE1-N 3.13Å; C41-C109 HydrophobicContact CB-CB 3.39Å; C41-C109 WeakPolarHBondContact CB-SG 3.05Å; C41-C109 WeakPolarHBondContact SG-CB 3.4Å; C41-C109 CovalentContact SG-SG 2.02Å; C41-C109 PolarHBondContact SG-SG 2.88Å; N55-C109 WeakPolarHBondContact O-CA 3.36Å; W56-C109 HydrophobicContact CD2-CB 4.47Å; W56-C109 HydrophobicContact CE3-CB 4.11Å; W56-C109 HydrophobicContact CH2-CB 4.05Å; W56-C109 HydrophobicContact CZ2-CB 4.38Å; W56-C109 HydrophobicContact CZ3-CB 3.9Å
110	A	94.8	Very high	86.9	Confident	52 Å²	52	86.8 Å²	86.8	43%	0.43	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	117.8	172.8	0	0	0	0	0	110.2	A54 N55	A54-A110 CarbonylContact C-O 3.49Å; A54-A110 WeakPolarHBondContact CA-O 3.18Å; N55-A110 PolarHBondContact N-O 2.82Å; N55-A110 PolarHBondContact O-N 3.06Å
111	L	94.5	Very high	86.3	Confident	25 Å²	25	87.2 Å²	87.2	13%	0.131	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	132.7	178.8	-62.8	-176.3	0	0	0	111.2	V23 V48 Y53 A54 Y113	V23-L111 HydrophobicContact CG1-CD1 4.31Å; V23-L111 HydrophobicContact CG1-CG 4.34Å; V23-L111 HydrophobicContact CG2-CB 4.33Å; V23-L111 HydrophobicContact CG2-CD1 3.99Å; V23-L111 HydrophobicContact CG2-CG 4.04Å; V48-L111 HydrophobicContact CG1-CD2 4.03Å; V48-L111 HydrophobicContact CG2-CD1 4Å; V48-L111 HydrophobicContact CG2-CD2 3.9Å; Y53-L111 WeakPolarHBondContact O-CA 3.43Å; A54-L111 HydrophobicContact CB-CD2 3.58Å; L111-Y113 HydrophobicContact CB-CE2 4.11Å; L111-Y113 WeakPolarHBondContact CD1-OH 3.23Å
112	W	92.5	Very high	85.7	Confident	155 Å²	155	86 Å²	86	59%	0.587	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.8	123.5	170.9	-174.9	-89.3	0	0	0	109.4	N52 Y53	N52-W112 CarbonylContact C-O 3.57Å; N52-W112 VanDerWaalsContact CA-O 3.23Å; N52-W112 WeakPolarHBondContact CA-O 3.47Å; Y53-W112 HydrophobicContact CD2-CB 4.08Å; Y53-W112 HydrophobicContact CE1-CB 4.42Å; Y53-W112 AromaticContact CE1-CD1 3.78Å; Y53-W112 HydrophobicContact CE1-CG 4.36Å; Y53-W112 HydrophobicContact CE2-CB 3.66Å; Y53-W112 HydrophobicContact CE2-CG 4.09Å; Y53-W112 AromaticContact CZ-CD1 3.56Å; Y53-W112 AromaticContact CZ-CG 3.8Å; Y53-W112 PolarHBondContact N-O 2.81Å; Y53-W112 VanDerWaalsContact N-O 3.13Å; Y53-W112 PolarHBondContact O-N 3.21Å
113	Y	87.4	Confident	85.2	Confident	41 Å²	41	85.4 Å²	85.4	16%	0.161	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.7	125.9	177.6	-52.5	-85.3	0	0	0	109.5	A21 S43 N52 L111 N115	A21-Y113 HydrophobicContact CB-CE2 4.46Å; S43-Y113 WeakPolarHBondContact CB-OH 3.41Å; S43-Y113 WeakPolarHBondContact OG-CE1 3.05Å; S43-Y113 PolarHBondContact OG-OH 3.37Å; N52-Y113 HydrophobicContact CB-CD1 4.15Å; N52-Y113 WeakPolarHBondContact OD1-CA 3.48Å; L111-Y113 HydrophobicContact CB-CE2 4.11Å; L111-Y113 WeakPolarHBondContact CD1-OH 3.23Å; Y113-N115 VanDerWaalsContact C-N 3.3Å; Y113-N115 PolarHBondContact O-N 3.31Å
114	S	76.6	Confident	84.5	Confident	48 Å²	48	90.7 Å²	90.7	34%	0.336	44%	0.444	S	S	.	.	T	Hydrogen-bonded Turn	trans	-72.9	-22.3	179.5	37.9	0	0	0	0	113.4	S51 N52	S51-S114 WeakPolarHBondContact O-CB 3.26Å; S51-S114 PolarHBondContact O-OG 3.29Å; N52-S114 PolarHBondContact OD1-N 3.37Å; N52-S114 PolarHBondContact OD1-OG 3.47Å
115	N	67.4	Low	83.7	Confident	133 Å²	133	85.3 Å²	85.3	71%	0.711	42%	0.42	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.5	39.2	-172.9	-61.7	-21.5	0	0	0	114.1	Y113	Y113-N115 VanDerWaalsContact C-N 3.3Å; Y113-N115 PolarHBondContact O-N 3.31Å
116	H	53.4	Low	82.8	Confident	141 Å²	141	90.1 Å²	90.1	65%	0.653	44%	0.436	S	S	*	.			trans	-97.6	74.7	166.7	-90.5	-67.9	0	0	0	110.6
117	F	42.1	Very low	81.6	Confident	269 Å²	269	89.4 Å²	89.4	100%	1.18	43%	0.43	S	S	*	.			trans	-134.6	0	155.4	-62.7	-75.1	0	0	0	107.8

Retrieved 117 of 117 residues in 78.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).