A0A075B664_MOUSE Loading...

Immunoglobulin lambda variable 2

AlphaFold DB , UniProt , Accession A0A075B664, Species MOUSE (Mus musculus, Mouse), Gene Iglv2, Length 116 aa.

						>A0A075B664_MOUSE|A0A075B664|Iglv2
MAWTSLILSLLALCSASSQAVVTQESALTTSPGGTVILTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTSNRAPGVPVRFSGSLIGDKAALTITGAQTEDDAMYFCALWYSTHF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.7	Low	60.3	Low	209 Å²	209	119.4 Å²	119.4	100%	1.03	64%	0.642	S	S	*	*				0	-29.8	0	-67.4	177	68.4	0	0	113.7	T4	M1-T4 PolarHBondContact O-OG1 3.38Å
2	A	60.7	Low	60.3	Low	77 Å²	77	116.6 Å²	116.6	64%	0.636	65%	0.648	S	S	*	*	H	α-helix	trans	-73.8	-28.5	174.6	0	0	0	0	0	114.2	S5 L6	A2-S5 PolarHBondContact O-N 3.47Å; A2-L6 PolarHBondContact O-N 3.03Å
3	W	54	Low	60.4	Low	207 Å²	207	118 Å²	118	78%	0.784	65%	0.652	S	S	*	*	H	α-helix	trans	-69.5	-36.1	-179.9	-83.5	22.1	0	0	0	113.9	S5 L6 I7	W3-S5 VanDerWaalsContact C-N 3.31Å; W3-S5 PolarHBondContact O-N 3.46Å; W3-L6 PolarHBondContact O-N 3.29Å; W3-I7 WeakPolarHBondContact O-CB 3.35Å; W3-I7 WeakPolarHBondContact O-CD1 3.33Å; W3-I7 WeakPolarHBondContact O-CG1 3.26Å; W3-I7 PolarHBondContact O-N 3.06Å
4	T	60.5	Low	60.5	Low	92 Å²	92	117.3 Å²	117.3	56%	0.564	66%	0.658	S	S	*	*	H	α-helix	trans	-65.2	-37.8	175.5	45.2	0	0	0	0	111.3	M1 I7 L8	M1-T4 PolarHBondContact O-OG1 3.38Å; T4-I7 PolarHBondContact O-N 2.71Å; T4-L8 PolarHBondContact O-N 2.74Å
5	S	61.3	Low	60.8	Low	72 Å²	72	116.9 Å²	116.9	50%	0.503	67%	0.666	S	S	.	*	H	α-helix	trans	-68	-38.8	174.7	-51.6	0	0	0	0	112	A2 W3 S9	A2-S5 PolarHBondContact O-N 3.47Å; W3-S5 VanDerWaalsContact C-N 3.31Å; W3-S5 PolarHBondContact O-N 3.46Å; S5-S9 WeakPolarHBondContact O-CB 3.47Å; S5-S9 PolarHBondContact O-N 3.4Å; S5-S9 PolarHBondContact O-OG 3.45Å
6	L	60.8	Low	61.1	Low	118 Å²	118	115.9 Å²	115.9	62%	0.618	68%	0.676	S	S	*	*	H	α-helix	trans	-66	-41.5	175.8	-158.9	79.1	0	0	0	111.8	A2 W3 S9 L10	A2-L6 PolarHBondContact O-N 3.03Å; W3-L6 PolarHBondContact O-N 3.29Å; L6-S9 PolarHBondContact O-N 3.35Å; L6-L10 WeakPolarHBondContact O-CB 3.35Å; L6-L10 PolarHBondContact O-N 2.97Å
7	I	64.1	Low	61.4	Low	97 Å²	97	116.2 Å²	116.2	50%	0.497	69%	0.687	S	S	.	*	H	α-helix	trans	-66.4	-43.2	177.7	-67.9	162	0	0	0	111.2	W3 T4 S9 L10 L11	W3-I7 WeakPolarHBondContact O-CB 3.35Å; W3-I7 WeakPolarHBondContact O-CD1 3.33Å; W3-I7 WeakPolarHBondContact O-CG1 3.26Å; W3-I7 PolarHBondContact O-N 3.06Å; T4-I7 PolarHBondContact O-N 2.71Å; I7-S9 VanDerWaalsContact C-N 3.32Å; I7-S9 PolarHBondContact O-N 3.26Å; I7-L10 PolarHBondContact O-N 2.96Å; I7-L11 HydrophobicContact CG2-CD1 3.85Å; I7-L11 WeakPolarHBondContact O-CD1 3.47Å; I7-L11 WeakPolarHBondContact O-CG 3.38Å; I7-L11 PolarHBondContact O-N 3.47Å
8	L	60.4	Low	61.9	Low	127 Å²	127	116.1 Å²	116.1	67%	0.665	69%	0.693	S	S	*	*	H	α-helix	trans	-62.5	-38.6	174.1	-116.9	77.6	0	0	0	112.2	T4 L11 A12	T4-L8 PolarHBondContact O-N 2.74Å; L8-L11 PolarHBondContact O-N 2.84Å; L8-A12 PolarHBondContact O-N 3.35Å; L8-A12 VanDerWaalsContact O-N 3.14Å
9	S	61.7	Low	62.9	Low	69 Å²	69	118.9 Å²	118.9	48%	0.483	70%	0.698	S	S	.	*	H	α-helix	trans	-65.7	-40.4	176	-51.2	0	0	0	0	111.6	S5 L6 I7 A12 L13	S5-S9 WeakPolarHBondContact O-CB 3.47Å; S5-S9 PolarHBondContact O-N 3.4Å; S5-S9 PolarHBondContact O-OG 3.45Å; L6-S9 PolarHBondContact O-N 3.35Å; I7-S9 VanDerWaalsContact C-N 3.32Å; I7-S9 PolarHBondContact O-N 3.26Å; S9-A12 PolarHBondContact O-N 3.04Å; S9-L13 WeakPolarHBondContact O-CD1 3.46Å
10	L	59.5	Low	64	Low	127 Å²	127	114.9 Å²	114.9	67%	0.665	68%	0.679	S	S	*	*	H	α-helix	trans	-68.3	-36.6	178.3	-142.3	84.2	0	0	0	112.2	L6 I7 A12 L13	L6-L10 WeakPolarHBondContact O-CB 3.35Å; L6-L10 PolarHBondContact O-N 2.97Å; I7-L10 PolarHBondContact O-N 2.96Å; L10-A12 VanDerWaalsContact C-N 3.33Å; L10-L13 PolarHBondContact O-N 3.29Å
11	L	60.8	Low	65.4	Low	118 Å²	118	113.2 Å²	113.2	62%	0.618	67%	0.67	S	S	*	*	H	α-helix	trans	-68.3	-30.9	174.5	-77.7	155.8	0	0	0	112.5	I7 L8 L13 C14	I7-L11 HydrophobicContact CG2-CD1 3.85Å; I7-L11 WeakPolarHBondContact O-CD1 3.47Å; I7-L11 WeakPolarHBondContact O-CG 3.38Å; I7-L11 PolarHBondContact O-N 3.47Å; L8-L11 PolarHBondContact O-N 2.84Å; L11-L13 PolarHBondContact O-N 2.83Å; L11-C14 PolarHBondContact O-N 3.45Å
12	A	60.4	Low	67	Low	86 Å²	86	106.1 Å²	106.1	71%	0.711	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.4	-12.4	176.6	0	0	0	0	0	114	L8 S9 L10	L8-A12 PolarHBondContact O-N 3.35Å; L8-A12 VanDerWaalsContact O-N 3.14Å; S9-A12 PolarHBondContact O-N 3.04Å; L10-A12 VanDerWaalsContact C-N 3.33Å
13	L	60.6	Low	68.7	Low	135 Å²	135	105.3 Å²	105.3	71%	0.707	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.4	-2.5	175.3	-82	143.9	0	0	0	113.4	S9 L10 L11 S15	S9-L13 WeakPolarHBondContact O-CD1 3.46Å; L10-L13 PolarHBondContact O-N 3.29Å; L11-L13 PolarHBondContact O-N 2.83Å; L13-S15 VanDerWaalsContact C-N 3.33Å; L13-S15 PolarHBondContact O-N 3.32Å
14	C	61.9	Low	70.7	Confident	108 Å²	108	98.4 Å²	98.4	73%	0.73	60%	0.602	S	S	*	*			trans	-78.3	82.4	171.4	-101.2	0	0	0	0	110.1	L11 A16	L11-C14 PolarHBondContact O-N 3.45Å; C14-A16 PolarHBondContact O-N 3.12Å
15	S	64.9	Low	72.4	Confident	112 Å²	112	97 Å²	97	78%	0.783	59%	0.588	S	S	*	*			trans	-66.5	100.4	161.8	39.5	0	0	0	0	108.7	L13 S17	L13-S15 VanDerWaalsContact C-N 3.33Å; L13-S15 PolarHBondContact O-N 3.32Å; S15-S17 PolarHBondContact O-N 3.19Å; S15-S17 VanDerWaalsContact O-N 3.09Å
16	A	65.6	Low	73.9	Confident	100 Å²	100	99.5 Å²	99.5	83%	0.826	61%	0.606	S	S	*	*			trans	-68.8	102.6	173.4	0	0	0	0	0	109.5	C14 S18	C14-A16 PolarHBondContact O-N 3.12Å; A16-S18 PolarHBondContact O-N 2.87Å
17	S	67.5	Low	75.5	Confident	122 Å²	122	97.8 Å²	97.8	85%	0.853	61%	0.609	S	S	*	*			trans	-76.3	109.4	170.2	42	0	0	0	0	109.5	S15	S15-S17 PolarHBondContact O-N 3.19Å; S15-S17 VanDerWaalsContact O-N 3.09Å
18	S	69.8	Low	77	Confident	114 Å²	114	97.1 Å²	97.1	80%	0.797	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-86.5	127.5	173.6	-172.1	0	0	0	0	110.1	A16	A16-S18 PolarHBondContact O-N 2.87Å
19	Q	80.2	Confident	78.6	Confident	169 Å²	169	97.8 Å²	97.8	79%	0.79	62%	0.616	S	S	*	*	P	Polyproline II helix	trans	-85.4	138.4	174.4	-173	174.4	-0.1	0	0	110.1	V21	Q19-V21 PolarHBondContact O-N 3.46Å
20	A	85.7	Confident	80.2	Confident	38 Å²	38	97.5 Å²	97.5	31%	0.314	61%	0.611	S	S	.	*	P	Polyproline II helix	trans	-62.5	129.4	173	0	0	0	0	0	110.4	T44 Y112	A20-T44 HydrophobicContact CB-CG2 3.71Å; A20-Y112 HydrophobicContact CB-CE2 4.37Å
21	V	92.4	Very high	81.9	Confident	81 Å²	81	95.2 Å²	95.2	49%	0.491	61%	0.606	S	S	.	*			trans	-106.6	132.7	177.7	-179.6	0	0	0	0	108.4	Q19 S43	Q19-V21 PolarHBondContact O-N 3.46Å; V21-S43 PolarHBondContact N-OG 2.8Å; V21-S43 PolarHBondContact O-N 2.92Å
22	V	94.6	Very high	83.6	Confident	60 Å²	60	95.2 Å²	95.2	36%	0.364	61%	0.613	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-101	130.7	173.2	-175.2	0	0	0	0	108.2	C40 R41 C108 L110	V22-C40 WeakPolarHBondContact CG1-SG 3.48Å; V22-R41 WeakPolarHBondContact CA-O 3.3Å; V22-C108 WeakPolarHBondContact CG1-SG 3.46Å; V22-L110 HydrophobicContact CG1-CD1 4.36Å; V22-L110 HydrophobicContact CG1-CG 4.26Å; V22-L110 HydrophobicContact CG2-CB 4.36Å; V22-L110 HydrophobicContact CG2-CD1 3.96Å; V22-L110 HydrophobicContact CG2-CG 4.01Å
23	T	96.2	Very high	85.4	Confident	60 Å²	60	93.8 Å²	93.8	37%	0.368	61%	0.606	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-124.3	136.7	179.1	-40.8	0	0	0	0	110.4	C40 R41	T23-C40 WeakPolarHBondContact O-CA 3.5Å; T23-R41 PolarHBondContact N-O 3.45Å; T23-R41 PolarHBondContact O-N 3.41Å
24	Q	96.3	Very high	87.2	Confident	62 Å²	62	88 Å²	88	29%	0.29	58%	0.58	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-136.5	171.8	174.1	58.1	176.9	71.7	0	0	109.6	T39 Y106 C108	Q24-T39 VanDerWaalsContact CA-O 3.26Å; Q24-T39 WeakPolarHBondContact CA-O 3.26Å; Q24-T39 VanDerWaalsContact CB-O 3.26Å; Q24-T39 WeakPolarHBondContact CB-O 3.39Å; Q24-Y106 PolarHBondContact NE2-O 3.02Å; Q24-C108 VanDerWaalsContact OE1-N 3.13Å
25	E	95.6	Very high	88.9	Confident	61 Å²	61	86.6 Å²	86.6	29%	0.285	57%	0.568	S	S	.	*			trans	-62.4	143.9	173.1	-60.4	77.8	-166.2	0	0	111.1	L28 T39	E25-L28 HydrophobicContact CB-CD1 3.99Å; E25-L28 HydrophobicContact CB-CD2 4.3Å; E25-L28 HydrophobicContact CB-CG 3.95Å; E25-L28 HydrophobicContact CG-CD1 4.08Å; E25-L28 HydrophobicContact CG-CD2 4.22Å; E25-L28 HydrophobicContact CG-CG 4.28Å; E25-T39 WeakPolarHBondContact OE1-CB 3.48Å; E25-T39 PolarHBondContact OE1-N 3.33Å; E25-T39 PolarHBondContact OE1-OG1 3.26Å; E25-T39 PolarHBondContact OE2-N 2.95Å; E25-T39 VanDerWaalsContact OE2-O 3.11Å
26	S	92.9	Very high	90.4	Very high	126 Å²	126	82.4 Å²	82.4	88%	0.881	54%	0.537	S	S	*	.	S	Bend	trans	-75.6	-36.8	-179.5	51.9	0	0	0	0	113
27	A	94.6	Very high	92	Very high	82 Å²	82	81.3 Å²	81.3	68%	0.678	52%	0.517	S	S	*	.			trans	-158.6	144.2	175.4	0	0	0	0	0	109.7
28	L	95.3	Very high	93.4	Very high	83 Å²	83	76.2 Å²	76.2	44%	0.435	48%	0.48	S	S	.	.			trans	-135.1	144.1	175.1	-70	168.3	0	0	0	108.6	E25 V36 L38	E25-L28 HydrophobicContact CB-CD1 3.99Å; E25-L28 HydrophobicContact CB-CD2 4.3Å; E25-L28 HydrophobicContact CB-CG 3.95Å; E25-L28 HydrophobicContact CG-CD1 4.08Å; E25-L28 HydrophobicContact CG-CD2 4.22Å; E25-L28 HydrophobicContact CG-CG 4.28Å; L28-V36 HydrophobicContact CB-CG2 3.9Å; L28-V36 HydrophobicContact CD1-CG2 3.99Å; L28-L38 HydrophobicContact CD1-CB 4.42Å; L28-L38 HydrophobicContact CD1-CG 3.96Å
29	T	94.8	Very high	94.8	Very high	140 Å²	140	71.9 Å²	71.9	86%	0.859	45%	0.448	S	S	*	.			trans	-126.5	148.7	177.1	57.6	0	0	0	0	110
30	T	95.3	Very high	95.5	Very high	63 Å²	63	63.8 Å²	63.8	39%	0.387	41%	0.411	S	S	.	.			trans	-149.9	157.9	176.5	-163.9	0	0	0	0	109.7	T35 V36 A98	T30-T35 PolarHBondContact OG1-O 3.32Å; T30-V36 HydrophobicContact CG2-CB 4.16Å; T30-V36 HydrophobicContact CG2-CG1 4.32Å; T30-A98 HydrophobicContact CG2-CB 3.59Å
31	S	95.4	Very high	96	Very high	79 Å²	79	68.3 Å²	68.3	55%	0.552	42%	0.42	S	S	*	.			trans	-77	154.8	173.9	57.2	0	0	0	0	110.7	G33 G34	S31-G33 PolarHBondContact O-N 3.47Å; S31-G34 WeakPolarHBondContact O-CA 3.31Å; S31-G34 PolarHBondContact O-N 2.98Å
32	P	96.1	Very high	96.2	Very high	119 Å²	119	65.2 Å²	65.2	77%	0.773	40%	0.401	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.8	134	170.2	-26.2	35.1	0	0	0	111.4	G34	P32-G34 PolarHBondContact O-N 2.9Å
33	G	97.3	Very high	96	Very high	55 Å²	55	65.9 Å²	65.9	57%	0.567	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.3	-6.4	-173.9	0	0	0	0	0	115	S31 G97 A98	S31-G33 PolarHBondContact O-N 3.47Å; G33-G97 WeakPolarHBondContact O-CA 3.19Å; G33-A98 PolarHBondContact N-O 3.37Å
34	G	98.1	Very high	95.7	Very high	15 Å²	15	67 Å²	67	16%	0.155	42%	0.416	C	S	.	.			trans	-69.9	175.5	176.7	0	0	0	0	0	113	S31 P32 G97 A98	S31-G34 WeakPolarHBondContact O-CA 3.31Å; S31-G34 PolarHBondContact O-N 2.98Å; P32-G34 PolarHBondContact O-N 2.9Å; G34-G97 PolarHBondContact O-N 3.41Å; G34-A98 PolarHBondContact O-N 2.85Å
35	T	98.1	Very high	95.4	Very high	78 Å²	78	66 Å²	66	48%	0.479	42%	0.423	S	S	.	.			trans	-111.6	137.2	172.4	-61.2	0	0	0	0	109.3	T30 I37 T94 I95 T96	T30-T35 PolarHBondContact OG1-O 3.32Å; T35-I37 HydrophobicContact CG2-CG1 4.37Å; T35-T94 HydrophobicContact CG2-CG2 3.89Å; T35-I95 VanDerWaalsContact CA-O 3.3Å; T35-I95 WeakPolarHBondContact CA-O 3.26Å; T35-T96 HydrophobicContact CG2-CG2 4.02Å
36	V	97.4	Very high	95.4	Very high	23 Å²	23	65.5 Å²	65.5	14%	0.139	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	142.1	170.8	61.4	0	0	0	0	109.3	L28 T30 L38 T94 I95	L28-V36 HydrophobicContact CB-CG2 3.9Å; L28-V36 HydrophobicContact CD1-CG2 3.99Å; T30-V36 HydrophobicContact CG2-CB 4.16Å; T30-V36 HydrophobicContact CG2-CG1 4.32Å; V36-L38 HydrophobicContact CG1-CD1 4.38Å; V36-L38 HydrophobicContact CG2-CD1 4.38Å; V36-T94 WeakPolarHBondContact O-CA 3.45Å; V36-I95 HydrophobicContact CG1-CB 3.79Å; V36-I95 HydrophobicContact CG1-CD1 4.04Å; V36-I95 HydrophobicContact CG1-CG1 4.17Å; V36-I95 PolarHBondContact N-O 3.36Å; V36-I95 PolarHBondContact O-N 3.37Å
37	I	98.1	Very high	95.5	Very high	78 Å²	78	59.6 Å²	59.6	40%	0.4	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	112.6	178.6	-55.1	177	0	0	0	107.3	T35 T39 I87 A92 L93 T94	T35-I37 HydrophobicContact CG2-CG1 4.37Å; I37-T39 HydrophobicContact CG2-CG2 4.39Å; I37-I87 HydrophobicContact CG2-CD1 3.83Å; I37-A92 HydrophobicContact CG2-CB 4.05Å; I37-L93 CarbonylContact C-O 3.15Å; I37-L93 WeakPolarHBondContact CA-O 2.93Å; I37-T94 HydrophobicContact CG1-CG2 4.13Å
38	L	97.9	Very high	95.5	Very high	15 Å²	15	58 Å²	58	8%	0.079	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	141.1	172.5	-57.7	84.8	0	0	0	108.4	L28 V36 W55 A92 L93 I95 Y106	L28-L38 HydrophobicContact CD1-CB 4.42Å; L28-L38 HydrophobicContact CD1-CG 3.96Å; V36-L38 HydrophobicContact CG1-CD1 4.38Å; V36-L38 HydrophobicContact CG2-CD1 4.38Å; L38-W55 HydrophobicContact CB-CH2 3.7Å; L38-W55 HydrophobicContact CB-CZ3 3.81Å; L38-W55 HydrophobicContact CD2-CZ3 4.33Å; L38-A92 CarbonylContact O-C 3.57Å; L38-A92 VanDerWaalsContact O-CA 3.23Å; L38-A92 WeakPolarHBondContact O-CA 3.48Å; L38-L93 HydrophobicContact CB-CB 4.37Å; L38-L93 HydrophobicContact CD1-CB 4.44Å; L38-L93 HydrophobicContact CD1-CD2 4.18Å; L38-L93 HydrophobicContact CD1-CG 4.34Å; L38-L93 PolarHBondContact N-O 2.85Å; L38-L93 PolarHBondContact O-N 2.99Å; L38-I95 HydrophobicContact CD1-CD1 3.99Å; L38-I95 HydrophobicContact CD1-CG1 4.36Å; L38-Y106 HydrophobicContact CD2-CD2 4.14Å; L38-Y106 HydrophobicContact CD2-CG 3.87Å
39	T	98	Very high	95.4	Very high	22 Å²	22	59 Å²	59	14%	0.135	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	150.4	176.4	78.5	0	0	0	0	112.7	Q24 E25 I37 A91	Q24-T39 VanDerWaalsContact CA-O 3.26Å; Q24-T39 WeakPolarHBondContact CA-O 3.26Å; Q24-T39 VanDerWaalsContact CB-O 3.26Å; Q24-T39 WeakPolarHBondContact CB-O 3.39Å; E25-T39 WeakPolarHBondContact OE1-CB 3.48Å; E25-T39 PolarHBondContact OE1-N 3.33Å; E25-T39 PolarHBondContact OE1-OG1 3.26Å; E25-T39 PolarHBondContact OE2-N 2.95Å; E25-T39 VanDerWaalsContact OE2-O 3.11Å; I37-T39 HydrophobicContact CG2-CG2 4.39Å; T39-A91 CarbonylContact C-O 3.6Å; T39-A91 VanDerWaalsContact CA-O 3.26Å; T39-A91 WeakPolarHBondContact CA-O 3.29Å
40	C	96.2	Very high	95.2	Very high	0 Å²	0	55.4 Å²	55.4	0%	0	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.1	126.5	-177.7	-180	0	0	0	0	109.7	V22 T23 W55 K90 A91 C108	V22-C40 WeakPolarHBondContact CG1-SG 3.48Å; T23-C40 WeakPolarHBondContact O-CA 3.5Å; C40-W55 HydrophobicContact CB-CH2 3.87Å; C40-W55 HydrophobicContact CB-CZ2 3.82Å; C40-K90 WeakPolarHBondContact O-CA 2.97Å; C40-K90 WeakPolarHBondContact O-CB 3.32Å; C40-A91 HydrophobicContact CB-CB 4.26Å; C40-A91 PolarHBondContact N-O 2.89Å; C40-A91 PolarHBondContact O-N 2.95Å; C40-C108 HydrophobicContact CB-CB 3.45Å; C40-C108 VanDerWaalsContact CB-CB 3.45Å; C40-C108 WeakPolarHBondContact CB-SG 3.47Å; C40-C108 WeakPolarHBondContact SG-CB 3.48Å; C40-C108 CovalentContact SG-SG 2.02Å; C40-C108 PolarHBondContact SG-SG 2.95Å
41	R	96.2	Very high	95.1	Very high	133 Å²	133	54.8 Å²	54.8	50%	0.502	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	154.7	179.3	69.7	174.9	-175.3	154.5	-0	112.2	V22 T23 K90	V22-R41 WeakPolarHBondContact CA-O 3.3Å; T23-R41 PolarHBondContact N-O 3.45Å; T23-R41 PolarHBondContact O-N 3.41Å; R41-K90 HydrophobicContact CB-CD 4.35Å; R41-K90 HydrophobicContact CB-CG 4.05Å
42	S	95	Very high	95	Very high	15 Å²	15	54 Å²	54	11%	0.105	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	146.5	170.7	-179.9	0	0	0	0	111.4	T44 G45 Y112	S42-T44 PolarHBondContact O-N 3.2Å; S42-T44 PolarHBondContact OG-N 2.95Å; S42-T44 PolarHBondContact OG-OG1 2.88Å; S42-G45 WeakPolarHBondContact CB-O 3.36Å; S42-Y112 VanDerWaalsContact CB-OH 3.25Å; S42-Y112 WeakPolarHBondContact CB-OH 3.43Å; S42-Y112 PolarHBondContact OG-OH 3.3Å
43	S	92.3	Very high	95	Very high	74 Å²	74	48.4 Å²	48.4	52%	0.517	30%	0.302	S	S	.	.	S	Bend	trans	-73.6	-12.6	167.1	66.5	0	0	0	0	113.9	V21	V21-S43 PolarHBondContact N-OG 2.8Å; V21-S43 PolarHBondContact O-N 2.92Å
44	T	89.1	Confident	94.9	Very high	84 Å²	84	48.2 Å²	48.2	52%	0.515	29%	0.288	S	S	.	.	S	Bend	trans	-110.2	-1.5	-170.1	57.5	0	0	0	0	114.2	A20 S42	A20-T44 HydrophobicContact CB-CG2 3.71Å; S42-T44 PolarHBondContact O-N 3.2Å; S42-T44 PolarHBondContact OG-N 2.95Å; S42-T44 PolarHBondContact OG-OG1 2.88Å
45	G	90.6	Very high	94.9	Very high	42 Å²	42	47.6 Å²	47.6	43%	0.433	28%	0.281	S	S	.	.	S	Bend	trans	156.4	-172.1	176.3	0	0	0	0	0	113.9	S42	S42-G45 WeakPolarHBondContact CB-O 3.36Å
46	A	94.7	Very high	94.9	Very high	49 Å²	49	45.9 Å²	45.9	41%	0.405	27%	0.271	S	S	.	.			trans	-72.8	138.8	180	0	0	0	0	0	112.1	T48 D89	A46-T48 HydrophobicContact CB-CG2 4.18Å; A46-D89 HydrophobicContact CB-CB 3.82Å
47	V	95.3	Very high	94.8	Very high	3 Å²	3	45.3 Å²	45.3	2%	0.018	27%	0.267	C	S	.	.			trans	-78.3	126.1	165.3	-173	0	0	0	0	107.9	N51 A53 L86 D89 A91 L110	V47-N51 CarbonylContact C-O 3.57Å; V47-N51 WeakPolarHBondContact CA-O 3.44Å; V47-N51 VanDerWaalsContact CG1-O 3.27Å; V47-N51 WeakPolarHBondContact CG1-O 3.32Å; V47-A53 HydrophobicContact CG1-CB 4.45Å; V47-L86 HydrophobicContact CB-CD2 4.48Å; V47-L86 HydrophobicContact CG1-CD2 4.1Å; V47-D89 WeakPolarHBondContact CB-O 3.17Å; V47-D89 PolarHBondContact N-O 2.62Å; V47-A91 HydrophobicContact CG1-CB 3.8Å; V47-L110 HydrophobicContact CG1-CD2 3.9Å; V47-L110 HydrophobicContact CG2-CD1 3.9Å; V47-L110 HydrophobicContact CG2-CD2 3.88Å
48	T	95.1	Very high	94.7	Very high	49 Å²	49	43.4 Å²	43.4	30%	0.301	26%	0.256	S	S	.	.			trans	-134.1	-174.6	-176.1	70.1	0	0	0	0	110.2	A46 S50 N51 Y52 T71	A46-T48 HydrophobicContact CB-CG2 4.18Å; T48-S50 PolarHBondContact O-N 3.33Å; T48-S50 PolarHBondContact OG1-N 3.44Å; T48-S50 VanDerWaalsContact OG1-N 3.12Å; T48-N51 PolarHBondContact N-O 2.8Å; T48-N51 CarbonylContact O-C 3.54Å; T48-N51 VanDerWaalsContact O-C 3.29Å; T48-N51 VanDerWaalsContact O-O 3.11Å; T48-N51 PolarHBondContact OG1-N 2.86Å; T48-Y52 WeakPolarHBondContact O-CA 3.34Å; T48-Y52 WeakPolarHBondContact O-CB 3.37Å; T48-Y52 PolarHBondContact O-N 3.1Å; T48-T71 PolarHBondContact O-OG1 3.39Å
49	T	92.8	Very high	94.1	Very high	102 Å²	102	47 Å²	47	63%	0.626	27%	0.271	S	S	*	.	S	Bend	trans	-71.5	-15.9	169.5	50	0	0	0	0	113.3	Y52	T49-Y52 WeakPolarHBondContact O-CD1 3.4Å
50	S	90.9	Very high	93.5	Very high	66 Å²	66	51.6 Å²	51.6	46%	0.462	30%	0.301	S	S	.	.	S	Bend	trans	-96.2	-33.4	175	-53.7	0	0	0	0	112.6	T48 S113	T48-S50 PolarHBondContact O-N 3.33Å; T48-S50 PolarHBondContact OG1-N 3.44Å; T48-S50 VanDerWaalsContact OG1-N 3.12Å; S50-S113 WeakPolarHBondContact O-CB 3.47Å; S50-S113 PolarHBondContact O-N 2.82Å
51	N	92	Very high	93	Very high	49 Å²	49	56 Å²	56	26%	0.262	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	77.3	171.9	-66	-34.1	0	0	0	108.3	V47 T48 W111 Y112 S113	V47-N51 CarbonylContact C-O 3.57Å; V47-N51 WeakPolarHBondContact CA-O 3.44Å; V47-N51 VanDerWaalsContact CG1-O 3.27Å; V47-N51 WeakPolarHBondContact CG1-O 3.32Å; T48-N51 PolarHBondContact N-O 2.8Å; T48-N51 CarbonylContact O-C 3.54Å; T48-N51 VanDerWaalsContact O-C 3.29Å; T48-N51 VanDerWaalsContact O-O 3.11Å; T48-N51 PolarHBondContact OG1-N 2.86Å; N51-W111 CarbonylContact C-O 3.5Å; N51-W111 VanDerWaalsContact CA-O 3.26Å; N51-W111 WeakPolarHBondContact CA-O 3.42Å; N51-Y112 HydrophobicContact CB-CD1 4.19Å; N51-Y112 WeakPolarHBondContact OD1-CA 3.43Å; N51-S113 PolarHBondContact OD1-N 3.07Å; N51-S113 VanDerWaalsContact OD1-N 3.12Å
52	Y	93.4	Very high	92.4	Very high	64 Å²	64	56.1 Å²	56.1	25%	0.251	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	159	-161.4	54	-96.8	0	0	0	113.3	T48 T49 G70 T71 L110 W111	T48-Y52 WeakPolarHBondContact O-CA 3.34Å; T48-Y52 WeakPolarHBondContact O-CB 3.37Å; T48-Y52 PolarHBondContact O-N 3.1Å; T49-Y52 WeakPolarHBondContact O-CD1 3.4Å; Y52-G70 VanDerWaalsContact CD2-CA 3.45Å; Y52-T71 WeakPolarHBondContact CB-OG1 3.18Å; Y52-L110 WeakPolarHBondContact O-CA 3.42Å; Y52-W111 HydrophobicContact CD2-CB 4.11Å; Y52-W111 HydrophobicContact CE1-CB 4.46Å; Y52-W111 AromaticContact CE1-CD1 3.92Å; Y52-W111 HydrophobicContact CE1-CG 4.45Å; Y52-W111 HydrophobicContact CE2-CB 3.72Å; Y52-W111 HydrophobicContact CE2-CG 4.2Å; Y52-W111 AromaticContact CZ-CD1 3.74Å; Y52-W111 AromaticContact CZ-CG 3.92Å; Y52-W111 PolarHBondContact N-O 2.93Å; Y52-W111 VanDerWaalsContact N-O 3.07Å; Y52-W111 PolarHBondContact O-N 3.5Å
53	A	95.7	Very high	92.2	Very high	0 Å²	0	60.4 Å²	60.4	0%	0	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	149	170.7	0	0	0	0	0	111.9	V47 T71 A91 A109 L110	V47-A53 HydrophobicContact CG1-CB 4.45Å; A53-T71 PolarHBondContact O-N 2.88Å; A53-A91 HydrophobicContact CB-CB 3.28Å; A53-A109 CarbonylContact C-O 3.36Å; A53-A109 WeakPolarHBondContact CA-O 3.33Å; A53-L110 HydrophobicContact CB-CD2 3.63Å
54	N	97	Very high	92.2	Very high	51 Å²	51	63.3 Å²	63.3	27%	0.273	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	140.7	157.9	-53	-81.7	0	0	0	107.7	I68 G69 G70 C108 A109	N54-I68 CarbonylContact C-O 3.58Å; N54-I68 VanDerWaalsContact CA-O 3.27Å; N54-I68 WeakPolarHBondContact CA-O 3.27Å; N54-G69 WeakPolarHBondContact OD1-CA 3.39Å; N54-G70 PolarHBondContact OD1-N 2.91Å; N54-C108 WeakPolarHBondContact O-CA 3.28Å; N54-A109 PolarHBondContact N-O 3.14Å; N54-A109 PolarHBondContact O-N 3.44Å
55	W	97.9	Very high	92.4	Very high	2 Å²	2	61.4 Å²	61.4	1%	0.008	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	131.6	179	-71.5	96.7	0	0	0	109.8	L38 C40 L67 I68 A91 L93 C108	L38-W55 HydrophobicContact CB-CH2 3.7Å; L38-W55 HydrophobicContact CB-CZ3 3.81Å; L38-W55 HydrophobicContact CD2-CZ3 4.33Å; C40-W55 HydrophobicContact CB-CH2 3.87Å; C40-W55 HydrophobicContact CB-CZ2 3.82Å; W55-L67 HydrophobicContact CB-CB 4.21Å; W55-L67 PolarHBondContact O-N 2.79Å; W55-I68 HydrophobicContact CB-CB 4.27Å; W55-I68 PolarHBondContact N-O 3.29Å; W55-I68 PolarHBondContact O-N 3.24Å; W55-A91 HydrophobicContact CZ2-CB 4.41Å; W55-L93 HydrophobicContact CB-CD1 4.4Å; W55-L93 HydrophobicContact CB-CD2 4.22Å; W55-L93 HydrophobicContact CD2-CB 3.48Å; W55-L93 VanDerWaalsContact CD2-CB 3.48Å; W55-L93 HydrophobicContact CD2-CD2 3.96Å; W55-L93 HydrophobicContact CD2-CG 4.23Å; W55-L93 VanDerWaalsContact CE2-CB 3.46Å; W55-L93 HydrophobicContact CE3-CB 3.79Å; W55-L93 HydrophobicContact CE3-CD2 3.74Å; W55-L93 HydrophobicContact CE3-CG 4.39Å; W55-L93 HydrophobicContact CG-CB 3.92Å; W55-L93 HydrophobicContact CG-CD1 4.29Å; W55-L93 HydrophobicContact CG-CD2 4.18Å; W55-L93 HydrophobicContact CG-CG 4.37Å; W55-L93 HydrophobicContact CH2-CB 4.04Å; W55-L93 HydrophobicContact CZ2-CB 3.76Å; W55-L93 HydrophobicContact CZ3-CB 4.05Å; W55-L93 HydrophobicContact CZ3-CD2 4.36Å; W55-C108 HydrophobicContact CD2-CB 4.22Å; W55-C108 HydrophobicContact CE3-CB 3.99Å; W55-C108 HydrophobicContact CH2-CB 4.1Å; W55-C108 HydrophobicContact CZ2-CB 4.31Å; W55-C108 HydrophobicContact CZ3-CB 3.93Å
56	V	97	Very high	92.7	Very high	43 Å²	43	61.3 Å²	61.3	26%	0.261	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	147.2	176.1	-59.2	0	0	0	0	110	F64 T65 Y106 F107	V56-F64 HydrophobicContact CG2-CD1 4.4Å; V56-T65 CarbonylContact C-O 3.58Å; V56-T65 VanDerWaalsContact CA-O 3.32Å; V56-T65 WeakPolarHBondContact CA-O 3.21Å; V56-Y106 WeakPolarHBondContact O-CA 3.45Å; V56-F107 HydrophobicContact CG2-CB 3.72Å; V56-F107 HydrophobicContact CG2-CD2 4.34Å; V56-F107 PolarHBondContact N-O 3.01Å; V56-F107 PolarHBondContact O-N 3.34Å
57	Q	96.4	Very high	92.9	Very high	11 Å²	11	59.1 Å²	59.1	5%	0.051	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	130.3	173.7	-172.9	-175.5	23	0	0	108.6	F64 T65 L67 A104 M105 Y106	Q57-F64 CarbonylContact O-C 3.53Å; Q57-F64 WeakPolarHBondContact O-CA 3.34Å; Q57-T65 PolarHBondContact N-O 2.83Å; Q57-T65 PolarHBondContact O-N 3.31Å; Q57-L67 HydrophobicContact CB-CD1 3.94Å; Q57-L67 HydrophobicContact CB-CD2 4.14Å; Q57-L67 HydrophobicContact CB-CG 4.05Å; Q57-A104 HydrophobicContact CG-CB 3.68Å; Q57-A104 VanDerWaalsContact NE2-CB 3.33Å; Q57-M105 CarbonylContact C-O 3.29Å; Q57-M105 WeakPolarHBondContact CA-O 3.36Å; Q57-Y106 HydrophobicContact CB-CD1 4.16Å; Q57-Y106 HydrophobicContact CB-CE1 4.07Å; Q57-Y106 HydrophobicContact CG-CD1 4.16Å; Q57-Y106 HydrophobicContact CG-CE1 3.77Å; Q57-Y106 PolarHBondContact NE2-OH 2.92Å; Q57-Y106 VanDerWaalsContact NE2-OH 3.16Å
58	E	94.9	Very high	93.1	Very high	38 Å²	38	59.2 Å²	59.2	18%	0.178	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	115.5	165.6	-179.6	-175.5	-171.1	0	0	108.3	H62 F64 A104 M105 F107	E58-H62 IonicContact OE1-CE1 3.45Å; E58-H62 IonicContact OE1-CG 2.84Å; E58-H62 IonicContact OE1-ND1 3.82Å; E58-H62 PolarHBondContact OE1-ND1 2.63Å; E58-F64 HydrophobicContact CB-CD1 4.06Å; E58-F64 HydrophobicContact CB-CE1 3.79Å; E58-F64 HydrophobicContact CB-CZ 4.31Å; E58-F64 HydrophobicContact CG-CE1 4.15Å; E58-F64 HydrophobicContact CG-CZ 4.16Å; E58-A104 WeakPolarHBondContact O-CB 3.42Å; E58-M105 HydrophobicContact CB-CB 4.15Å; E58-M105 PolarHBondContact N-O 3.16Å; E58-M105 PolarHBondContact O-N 2.98Å; E58-F107 HydrophobicContact CB-CE2 3.91Å; E58-F107 WeakPolarHBondContact OE2-CE2 3.32Å
59	K	85.4	Confident	93.1	Very high	89 Å²	89	57.9 Å²	57.9	39%	0.387	32%	0.32	S	S	.	.			trans	-79.7	165.1	177	-71.7	-177.4	-177.6	-178.6	0	110.9	D61 H62 L63	K59-D61 WeakPolarHBondContact CB-OD1 3.29Å; K59-D61 PolarHBondContact O-N 2.82Å; K59-H62 PolarHBondContact O-N 2.88Å; K59-L63 PolarHBondContact N-O 3.25Å; K59-L63 VanDerWaalsContact N-O 3.1Å
60	P	85	Confident	93.1	Very high	119 Å²	119	54 Å²	54	77%	0.773	30%	0.301	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.4	-17.5	-179.4	-27.7	35.9	0	0	0	115.7	H62	P60-H62 VanDerWaalsContact C-N 3.29Å
61	D	86.4	Confident	93.2	Very high	92 Å²	92	51.2 Å²	51.2	49%	0.492	28%	0.282	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.1	10.5	174.6	60.5	-1.3	0	0	0	113.7	K59 L63	K59-D61 WeakPolarHBondContact CB-OD1 3.29Å; K59-D61 PolarHBondContact O-N 2.82Å; D61-L63 HydrophobicContact CB-CG 4.5Å; D61-L63 PolarHBondContact O-N 3.15Å; D61-L63 WeakPolarHBondContact OD1-CB 3.33Å; D61-L63 PolarHBondContact OD1-N 2.89Å; D61-L63 VanDerWaalsContact OD1-N 3.14Å; D61-L63 WeakPolarHBondContact OD2-CD1 3.15Å
62	H	84.3	Confident	93.4	Very high	136 Å²	136	52.4 Å²	52.4	63%	0.63	29%	0.293	S	S	*	.	S	Bend	trans	61	19	-175.4	-59	-67.2	0	0	0	114.6	E58 K59 P60	E58-H62 IonicContact OE1-CE1 3.45Å; E58-H62 IonicContact OE1-CG 2.84Å; E58-H62 IonicContact OE1-ND1 3.82Å; E58-H62 PolarHBondContact OE1-ND1 2.63Å; K59-H62 PolarHBondContact O-N 2.88Å; P60-H62 VanDerWaalsContact C-N 3.29Å
63	L	89.5	Confident	93.6	Very high	106 Å²	106	54.5 Å²	54.5	56%	0.555	31%	0.309	S	S	*	.			trans	-86.5	125.6	172.5	-62.4	-176.9	0	0	0	110.6	K59 D61	K59-L63 PolarHBondContact N-O 3.25Å; K59-L63 VanDerWaalsContact N-O 3.1Å; D61-L63 HydrophobicContact CB-CG 4.5Å; D61-L63 PolarHBondContact O-N 3.15Å; D61-L63 WeakPolarHBondContact OD1-CB 3.33Å; D61-L63 PolarHBondContact OD1-N 2.89Å; D61-L63 VanDerWaalsContact OD1-N 3.14Å; D61-L63 WeakPolarHBondContact OD2-CD1 3.15Å
64	F	92.6	Very high	93.7	Very high	134 Å²	134	59.8 Å²	59.8	59%	0.588	33%	0.329	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82	124	174	-68.3	-86.9	0	0	0	110.6	V56 Q57 E58 F107	V56-F64 HydrophobicContact CG2-CD1 4.4Å; Q57-F64 CarbonylContact O-C 3.53Å; Q57-F64 WeakPolarHBondContact O-CA 3.34Å; E58-F64 HydrophobicContact CB-CD1 4.06Å; E58-F64 HydrophobicContact CB-CE1 3.79Å; E58-F64 HydrophobicContact CB-CZ 4.31Å; E58-F64 HydrophobicContact CG-CE1 4.15Å; E58-F64 HydrophobicContact CG-CZ 4.16Å; F64-F107 HydrophobicContact CE1-CD2 4.13Å; F64-F107 HydrophobicContact CE1-CE2 4.05Å
65	T	94.3	Very high	93.8	Very high	45 Å²	45	58.8 Å²	58.8	28%	0.276	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	126.9	174.3	-54.7	0	0	0	0	109.5	V56 Q57	V56-T65 CarbonylContact C-O 3.58Å; V56-T65 VanDerWaalsContact CA-O 3.32Å; V56-T65 WeakPolarHBondContact CA-O 3.21Å; Q57-T65 PolarHBondContact N-O 2.83Å; Q57-T65 PolarHBondContact O-N 3.31Å
66	G	96.9	Very high	93.7	Very high	39 Å²	39	65.1 Å²	65.1	40%	0.402	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70	131.2	170.7	0	0	0	0	0	111	A75 V78	G66-A75 WeakPolarHBondContact O-CB 3.23Å; G66-V78 VanDerWaalsContact O-CG2 3.31Å; G66-V78 WeakPolarHBondContact O-CG2 3.17Å
67	L	98	Very high	93.6	Very high	3 Å²	3	67.2 Å²	67.2	2%	0.016	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	-61.4	179.8	-62.5	-179.3	0	0	0	111.7	W55 Q57 A75 V78 F82 L93 Y106	W55-L67 HydrophobicContact CB-CB 4.21Å; W55-L67 PolarHBondContact O-N 2.79Å; Q57-L67 HydrophobicContact CB-CD1 3.94Å; Q57-L67 HydrophobicContact CB-CD2 4.14Å; Q57-L67 HydrophobicContact CB-CG 4.05Å; L67-A75 PolarHBondContact O-N 3.26Å; L67-V78 HydrophobicContact CD2-CG1 4.06Å; L67-V78 HydrophobicContact CD2-CG2 4.3Å; L67-F82 HydrophobicContact CD1-CD1 4Å; L67-F82 HydrophobicContact CD1-CE1 4.06Å; L67-F82 HydrophobicContact CD2-CD1 4.34Å; L67-F82 HydrophobicContact CD2-CE1 4.37Å; L67-L93 HydrophobicContact CD1-CD1 4.49Å; L67-L93 HydrophobicContact CD1-CD2 3.77Å; L67-Y106 HydrophobicContact CD1-CD1 3.74Å; L67-Y106 HydrophobicContact CD1-CE1 3.68Å
68	I	98.5	Very high	93.7	Very high	5 Å²	5	67.4 Å²	67.4	3%	0.026	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	132.2	-176.9	-48.6	-66	0	0	0	108.6	N54 W55 N73 R74 L93	N54-I68 CarbonylContact C-O 3.58Å; N54-I68 VanDerWaalsContact CA-O 3.27Å; N54-I68 WeakPolarHBondContact CA-O 3.27Å; W55-I68 HydrophobicContact CB-CB 4.27Å; W55-I68 PolarHBondContact N-O 3.29Å; W55-I68 PolarHBondContact O-N 3.24Å; I68-N73 CarbonylContact C-O 3.53Å; I68-N73 WeakPolarHBondContact CA-O 3.48Å; I68-R74 HydrophobicContact CD1-CB 3.83Å; I68-R74 HydrophobicContact CD1-CG 4.05Å; I68-L93 HydrophobicContact CG1-CD1 3.7Å
69	G	96.5	Very high	93.8	Very high	21 Å²	21	68 Å²	68	22%	0.216	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.5	156.3	171.1	0	0	0	0	0	112.5	N54 T71 N73	N54-G69 WeakPolarHBondContact OD1-CA 3.39Å; G69-T71 VanDerWaalsContact C-N 3.34Å; G69-T71 PolarHBondContact O-N 2.93Å; G69-N73 PolarHBondContact N-O 2.88Å; G69-N73 WeakPolarHBondContact O-CA 3.37Å; G69-N73 WeakPolarHBondContact O-CB 3.43Å; G69-N73 PolarHBondContact O-N 2.84Å; G69-N73 PolarHBondContact O-ND2 2.93Å
70	G	92.8	Very high	94.4	Very high	22 Å²	22	69.4 Å²	69.4	23%	0.227	42%	0.424	C	S	.	.	T	Hydrogen-bonded Turn	trans	57.2	44.5	175.8	0	0	0	0	0	113.4	Y52 N54 S72 N73	Y52-G70 VanDerWaalsContact CD2-CA 3.45Å; N54-G70 PolarHBondContact OD1-N 2.91Å; G70-S72 PolarHBondContact O-N 2.81Å; G70-N73 PolarHBondContact O-ND2 2.9Å
71	T	92.7	Very high	95	Very high	7 Å²	7	65.3 Å²	65.3	4%	0.043	39%	0.393	C	S	.	.	T	Hydrogen-bonded Turn	trans	73.7	-45.9	-178	-56.4	0	0	0	0	115.9	T48 Y52 A53 G69 G84 S85 L86	T48-T71 PolarHBondContact O-OG1 3.39Å; Y52-T71 WeakPolarHBondContact CB-OG1 3.18Å; A53-T71 PolarHBondContact O-N 2.88Å; G69-T71 VanDerWaalsContact C-N 3.34Å; G69-T71 PolarHBondContact O-N 2.93Å; T71-G84 CarbonylContact O-C 3.58Å; T71-G84 WeakPolarHBondContact O-CA 3.33Å; T71-S85 PolarHBondContact O-N 2.02Å; T71-L86 HydrophobicContact CG2-CD1 4.19Å; T71-L86 HydrophobicContact CG2-CD2 3.78Å; T71-L86 HydrophobicContact CG2-CG 3.63Å
72	S	96.3	Very high	95.6	Very high	73 Å²	73	61 Å²	61	51%	0.51	37%	0.37	S	S	.	.	T	Hydrogen-bonded Turn	trans	-140.6	-4.1	-171	59.9	0	0	0	0	115.5	G70 R74 G84	G70-S72 PolarHBondContact O-N 2.81Å; S72-R74 PolarHBondContact O-N 2.85Å; S72-R74 VanDerWaalsContact O-N 3.12Å; S72-G84 WeakPolarHBondContact CB-O 3.43Å
73	N	97.3	Very high	96.2	Very high	108 Å²	108	57 Å²	57	58%	0.578	36%	0.357	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.6	102.9	-178	-53.8	-64.6	0	0	0	110.2	I68 G69 G70 A75	I68-N73 CarbonylContact C-O 3.53Å; I68-N73 WeakPolarHBondContact CA-O 3.48Å; G69-N73 PolarHBondContact N-O 2.88Å; G69-N73 WeakPolarHBondContact O-CA 3.37Å; G69-N73 WeakPolarHBondContact O-CB 3.43Å; G69-N73 PolarHBondContact O-N 2.84Å; G69-N73 PolarHBondContact O-ND2 2.93Å; G70-N73 PolarHBondContact O-ND2 2.9Å; N73-A75 PolarHBondContact O-N 2.57Å
74	R	98.2	Very high	96.6	Very high	112 Å²	112	52.4 Å²	52.4	42%	0.423	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.4	130.5	175.2	-176.8	171.3	66	-125.4	-4.5	110.8	I68 S72 V78 P79 V80 F82	I68-R74 HydrophobicContact CD1-CB 3.83Å; I68-R74 HydrophobicContact CD1-CG 4.05Å; S72-R74 PolarHBondContact O-N 2.85Å; S72-R74 VanDerWaalsContact O-N 3.12Å; R74-V78 WeakPolarHBondContact CD-O 3.26Å; R74-V78 HydrophobicContact CG-CB 3.63Å; R74-V78 HydrophobicContact CG-CG1 3.77Å; R74-V78 PolarHBondContact NE-O 3.46Å; R74-P79 WeakPolarHBondContact CD-O 3.47Å; R74-V80 PolarHBondContact NH1-O 2.84Å; R74-F82 WeakPolarHBondContact CD-O 3.29Å; R74-F82 PolarHBondContact NH1-O 2.81Å
75	A	97.9	Very high	96.9	Very high	30 Å²	30	48.1 Å²	48.1	25%	0.248	32%	0.323	C	S	.	.	P	Polyproline II helix	trans	-67.5	152.5	179.6	0	0	0	0	0	111.6	G66 L67 N73 G77 V78	G66-A75 WeakPolarHBondContact O-CB 3.23Å; L67-A75 PolarHBondContact O-N 3.26Å; N73-A75 PolarHBondContact O-N 2.57Å; A75-G77 PolarHBondContact O-N 3.12Å; A75-V78 HydrophobicContact CB-CG2 3.85Å; A75-V78 WeakPolarHBondContact O-CB 3.44Å; A75-V78 WeakPolarHBondContact O-CG2 3.26Å; A75-V78 PolarHBondContact O-N 2.81Å
76	P	96.4	Very high	97.1	Very high	134 Å²	134	49 Å²	49	87%	0.87	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56	137	176.5	-25	34.7	0	0	0	112.2	V78	P76-V78 PolarHBondContact O-N 3.4Å
77	G	95.6	Very high	97.1	Very high	87 Å²	87	51.1 Å²	51.1	90%	0.897	33%	0.327	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.1	-8.8	-179.7	0	0	0	0	0	115.2	A75	A75-G77 PolarHBondContact O-N 3.12Å
78	V	97.2	Very high	97	Very high	16 Å²	16	54.5 Å²	54.5	10%	0.097	36%	0.362	C	S	.	.			trans	-74.4	130.6	174.8	178.3	0	0	0	0	109.7	G66 L67 R74 A75 P76 F82	G66-V78 VanDerWaalsContact O-CG2 3.31Å; G66-V78 WeakPolarHBondContact O-CG2 3.17Å; L67-V78 HydrophobicContact CD2-CG1 4.06Å; L67-V78 HydrophobicContact CD2-CG2 4.3Å; R74-V78 WeakPolarHBondContact CD-O 3.26Å; R74-V78 HydrophobicContact CG-CB 3.63Å; R74-V78 HydrophobicContact CG-CG1 3.77Å; R74-V78 PolarHBondContact NE-O 3.46Å; A75-V78 HydrophobicContact CB-CG2 3.85Å; A75-V78 WeakPolarHBondContact O-CB 3.44Å; A75-V78 WeakPolarHBondContact O-CG2 3.26Å; A75-V78 PolarHBondContact O-N 2.81Å; P76-V78 PolarHBondContact O-N 3.4Å; V78-F82 HydrophobicContact CG1-CB 3.76Å; V78-F82 HydrophobicContact CG1-CD2 4.03Å; V78-F82 HydrophobicContact CG1-CG 3.96Å
79	P	97.4	Very high	96.9	Very high	49 Å²	49	58.5 Å²	58.5	32%	0.318	38%	0.383	S	S	.	.			trans	-58.7	148.7	-178	-27.7	36.7	0	0	0	113.7	R74 R81 F82	R74-P79 WeakPolarHBondContact CD-O 3.47Å; P79-R81 HydrophobicContact CB-CG 4.01Å; P79-R81 PolarHBondContact O-N 3.04Å; P79-F82 HydrophobicContact CB-CD2 4.07Å; P79-F82 HydrophobicContact CB-CE2 4.31Å; P79-F82 HydrophobicContact CG-CD2 4.33Å; P79-F82 HydrophobicContact CG-CE2 4.23Å; P79-F82 PolarHBondContact O-N 3.07Å
80	V	97.8	Very high	96.9	Very high	119 Å²	119	60.9 Å²	60.9	72%	0.721	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.1	-21.9	-177.5	71.5	0	0	0	0	114	R74 F82	R74-V80 PolarHBondContact NH1-O 2.84Å; V80-F82 PolarHBondContact O-N 3.4Å
81	R	98.1	Very high	97.1	Very high	33 Å²	33	59.9 Å²	59.9	13%	0.125	38%	0.377	C	S	.	.	T	Hydrogen-bonded Turn	trans	-66	-18.7	178.1	75.6	-178.1	178.3	-100	-4.3	113.9	P79 I95 T96 E101 D102	P79-R81 HydrophobicContact CB-CG 4.01Å; P79-R81 PolarHBondContact O-N 3.04Å; R81-I95 WeakPolarHBondContact O-CA 3.31Å; R81-T96 VanDerWaalsContact CB-O 3.26Å; R81-T96 WeakPolarHBondContact CB-O 3.26Å; R81-T96 PolarHBondContact O-N 3.09Å; R81-T96 PolarHBondContact O-OG1 3.02Å; R81-E101 IonicContact CZ-OE1 3.78Å; R81-E101 IonicContact NH1-OE1 3.59Å; R81-E101 IonicContact NH2-OE1 2.74Å; R81-E101 PolarHBondContact NH2-OE1 2.86Å; R81-D102 IonicContact CZ-OD1 3.67Å; R81-D102 IonicContact CZ-OD2 3.6Å; R81-D102 IonicContact NE-OD1 3.04Å; R81-D102 PolarHBondContact NE-OD1 3.42Å; R81-D102 IonicContact NE-OD2 3.49Å; R81-D102 PolarHBondContact NE-OD2 2.85Å; R81-D102 IonicContact NH2-OD1 2.71Å; R81-D102 PolarHBondContact NH2-OD1 3.23Å; R81-D102 IonicContact NH2-OD2 3.58Å
82	F	98.4	Very high	97.4	Very high	3 Å²	3	59.6 Å²	59.6	1%	0.013	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	132.6	171.8	-66	-98.6	0	0	0	110.6	L67 R74 V78 P79 V80 L93 T94 I95 D102 Y106	L67-F82 HydrophobicContact CD1-CD1 4Å; L67-F82 HydrophobicContact CD1-CE1 4.06Å; L67-F82 HydrophobicContact CD2-CD1 4.34Å; L67-F82 HydrophobicContact CD2-CE1 4.37Å; R74-F82 WeakPolarHBondContact CD-O 3.29Å; R74-F82 PolarHBondContact NH1-O 2.81Å; V78-F82 HydrophobicContact CG1-CB 3.76Å; V78-F82 HydrophobicContact CG1-CD2 4.03Å; V78-F82 HydrophobicContact CG1-CG 3.96Å; P79-F82 HydrophobicContact CB-CD2 4.07Å; P79-F82 HydrophobicContact CB-CE2 4.31Å; P79-F82 HydrophobicContact CG-CD2 4.33Å; P79-F82 HydrophobicContact CG-CE2 4.23Å; P79-F82 PolarHBondContact O-N 3.07Å; V80-F82 PolarHBondContact O-N 3.4Å; F82-L93 HydrophobicContact CD1-CD1 4.37Å; F82-T94 WeakPolarHBondContact CA-O 3.45Å; F82-I95 HydrophobicContact CD1-CB 4.5Å; F82-I95 HydrophobicContact CD1-CD1 4.09Å; F82-I95 HydrophobicContact CD1-CG1 3.72Å; F82-I95 HydrophobicContact CD1-CG2 4.29Å; F82-I95 HydrophobicContact CE1-CB 4.42Å; F82-I95 HydrophobicContact CE1-CD1 3.56Å; F82-I95 HydrophobicContact CE1-CG1 3.67Å; F82-I95 HydrophobicContact CE1-CG2 3.95Å; F82-I95 HydrophobicContact CE2-CG2 4.43Å; F82-I95 HydrophobicContact CZ-CD1 4.4Å; F82-I95 HydrophobicContact CZ-CG2 4.03Å; F82-D102 VanDerWaalsContact CZ-OD1 3.26Å; F82-D102 WeakPolarHBondContact CZ-OD1 3.27Å; F82-Y106 HydrophobicContact CE1-CE1 4.08Å
83	S	98.4	Very high	97.5	Very high	50 Å²	50	56.1 Å²	56.1	35%	0.35	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	144.3	175.5	56.9	0	0	0	0	111.1	T94	S83-T94 PolarHBondContact N-O 2.89Å; S83-T94 PolarHBondContact O-N 2.92Å; S83-T94 PolarHBondContact OG-O 2.94Å
84	G	98.3	Very high	97.6	Very high	11 Å²	11	52 Å²	52	11%	0.113	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	146.7	172.1	0	0	0	0	0	111.8	T71 S72 A92	T71-G84 CarbonylContact O-C 3.58Å; T71-G84 WeakPolarHBondContact O-CA 3.33Å; S72-G84 WeakPolarHBondContact CB-O 3.43Å; G84-A92 CarbonylContact C-O 3.58Å; G84-A92 VanDerWaalsContact CA-O 3.28Å; G84-A92 WeakPolarHBondContact CA-O 3.43Å
85	S	97.8	Very high	97.6	Very high	44 Å²	44	46.8 Å²	46.8	31%	0.308	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.6	-177.5	179.5	62.2	0	0	0	0	111.1	T71 A92	T71-S85 PolarHBondContact O-N 2.02Å; S85-A92 PolarHBondContact N-O 3.29Å; S85-A92 PolarHBondContact O-N 3.07Å
86	L	97.9	Very high	97.6	Very high	63 Å²	63	48.2 Å²	48.2	33%	0.33	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	135.8	168.6	-61.6	173.6	0	0	0	109.3	V47 T71 K90 A91	V47-L86 HydrophobicContact CB-CD2 4.48Å; V47-L86 HydrophobicContact CG1-CD2 4.1Å; T71-L86 HydrophobicContact CG2-CD1 4.19Å; T71-L86 HydrophobicContact CG2-CD2 3.78Å; T71-L86 HydrophobicContact CG2-CG 3.63Å; L86-K90 CarbonylContact C-O 3.54Å; L86-K90 VanDerWaalsContact CA-O 3.29Å; L86-K90 WeakPolarHBondContact CA-O 3.37Å; L86-A91 HydrophobicContact CD2-CB 4.49Å
87	I	97.2	Very high	97.7	Very high	84 Å²	84	43.4 Å²	43.4	43%	0.431	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	96.4	169.1	-60.8	175.6	0	0	0	106.7	I37 D89 K90 A92	I37-I87 HydrophobicContact CG2-CD1 3.83Å; I87-D89 PolarHBondContact O-N 3.12Å; I87-K90 PolarHBondContact N-O 2.99Å; I87-K90 PolarHBondContact O-N 3.49Å; I87-A92 HydrophobicContact CB-CB 4.48Å; I87-A92 HydrophobicContact CD1-CB 3.53Å; I87-A92 HydrophobicContact CG1-CB 3.68Å
88	G	96.1	Very high	97.8	Very high	73 Å²	73	39.7 Å²	39.7	75%	0.753	25%	0.252	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.4	-118.5	-171.4	0	0	0	0	0	111.2
89	D	95.8	Very high	97.7	Very high	89 Å²	89	43.3 Å²	43.3	48%	0.476	27%	0.268	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.8	9.2	-179.2	67	-18.1	0	0	0	113.7	A46 V47 I87	A46-D89 HydrophobicContact CB-CB 3.82Å; V47-D89 WeakPolarHBondContact CB-O 3.17Å; V47-D89 PolarHBondContact N-O 2.62Å; I87-D89 PolarHBondContact O-N 3.12Å
90	K	97.6	Very high	97.5	Very high	72 Å²	72	47.1 Å²	47.1	31%	0.313	29%	0.29	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	145.1	-177.4	-50.4	-173.7	-174.6	173	0	111.2	C40 R41 L86 I87	C40-K90 WeakPolarHBondContact O-CA 2.97Å; C40-K90 WeakPolarHBondContact O-CB 3.32Å; R41-K90 HydrophobicContact CB-CD 4.35Å; R41-K90 HydrophobicContact CB-CG 4.05Å; L86-K90 CarbonylContact C-O 3.54Å; L86-K90 VanDerWaalsContact CA-O 3.29Å; L86-K90 WeakPolarHBondContact CA-O 3.37Å; I87-K90 PolarHBondContact N-O 2.99Å; I87-K90 PolarHBondContact O-N 3.49Å
91	A	97.8	Very high	97.2	Very high	1 Å²	1	47.4 Å²	47.4	1%	0.008	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	145.6	161.1	0	0	0	0	0	110.2	T39 C40 V47 A53 W55 L86	T39-A91 CarbonylContact C-O 3.6Å; T39-A91 VanDerWaalsContact CA-O 3.26Å; T39-A91 WeakPolarHBondContact CA-O 3.29Å; C40-A91 HydrophobicContact CB-CB 4.26Å; C40-A91 PolarHBondContact N-O 2.89Å; C40-A91 PolarHBondContact O-N 2.95Å; V47-A91 HydrophobicContact CG1-CB 3.8Å; A53-A91 HydrophobicContact CB-CB 3.28Å; W55-A91 HydrophobicContact CZ2-CB 4.41Å; L86-A91 HydrophobicContact CD2-CB 4.49Å
92	A	98.3	Very high	97	Very high	0 Å²	0	46.5 Å²	46.5	0%	0	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	134.2	176.4	0	0	0	0	0	110.8	I37 L38 G84 S85 I87	I37-A92 HydrophobicContact CG2-CB 4.05Å; L38-A92 CarbonylContact O-C 3.57Å; L38-A92 VanDerWaalsContact O-CA 3.23Å; L38-A92 WeakPolarHBondContact O-CA 3.48Å; G84-A92 CarbonylContact C-O 3.58Å; G84-A92 VanDerWaalsContact CA-O 3.28Å; G84-A92 WeakPolarHBondContact CA-O 3.43Å; S85-A92 PolarHBondContact N-O 3.29Å; S85-A92 PolarHBondContact O-N 3.07Å; I87-A92 HydrophobicContact CB-CB 4.48Å; I87-A92 HydrophobicContact CD1-CB 3.53Å; I87-A92 HydrophobicContact CG1-CB 3.68Å
93	L	98.5	Very high	96.8	Very high	0 Å²	0	53 Å²	53	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	115.7	166.3	174.4	68.3	0	0	0	108.2	I37 L38 W55 L67 I68 F82 I95 Y106	I37-L93 CarbonylContact C-O 3.15Å; I37-L93 WeakPolarHBondContact CA-O 2.93Å; L38-L93 HydrophobicContact CB-CB 4.37Å; L38-L93 HydrophobicContact CD1-CB 4.44Å; L38-L93 HydrophobicContact CD1-CD2 4.18Å; L38-L93 HydrophobicContact CD1-CG 4.34Å; L38-L93 PolarHBondContact N-O 2.85Å; L38-L93 PolarHBondContact O-N 2.99Å; W55-L93 HydrophobicContact CB-CD1 4.4Å; W55-L93 HydrophobicContact CB-CD2 4.22Å; W55-L93 HydrophobicContact CD2-CB 3.48Å; W55-L93 VanDerWaalsContact CD2-CB 3.48Å; W55-L93 HydrophobicContact CD2-CD2 3.96Å; W55-L93 HydrophobicContact CD2-CG 4.23Å; W55-L93 VanDerWaalsContact CE2-CB 3.46Å; W55-L93 HydrophobicContact CE3-CB 3.79Å; W55-L93 HydrophobicContact CE3-CD2 3.74Å; W55-L93 HydrophobicContact CE3-CG 4.39Å; W55-L93 HydrophobicContact CG-CB 3.92Å; W55-L93 HydrophobicContact CG-CD1 4.29Å; W55-L93 HydrophobicContact CG-CD2 4.18Å; W55-L93 HydrophobicContact CG-CG 4.37Å; W55-L93 HydrophobicContact CH2-CB 4.04Å; W55-L93 HydrophobicContact CZ2-CB 3.76Å; W55-L93 HydrophobicContact CZ3-CB 4.05Å; W55-L93 HydrophobicContact CZ3-CD2 4.36Å; L67-L93 HydrophobicContact CD1-CD1 4.49Å; L67-L93 HydrophobicContact CD1-CD2 3.77Å; I68-L93 HydrophobicContact CG1-CD1 3.7Å; F82-L93 HydrophobicContact CD1-CD1 4.37Å; L93-I95 HydrophobicContact CD2-CD1 4.5Å; L93-I95 HydrophobicContact CG-CG1 4.3Å; L93-Y106 HydrophobicContact CD2-CD1 3.86Å; L93-Y106 HydrophobicContact CD2-CE1 4.31Å
94	T	98.5	Very high	96.6	Very high	22 Å²	22	51.8 Å²	51.8	14%	0.135	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	124.8	176.7	-58.7	0	0	0	0	109.2	T35 V36 I37 F82 S83 T96	T35-T94 HydrophobicContact CG2-CG2 3.89Å; V36-T94 WeakPolarHBondContact O-CA 3.45Å; I37-T94 HydrophobicContact CG1-CG2 4.13Å; F82-T94 WeakPolarHBondContact CA-O 3.45Å; S83-T94 PolarHBondContact N-O 2.89Å; S83-T94 PolarHBondContact O-N 2.92Å; S83-T94 PolarHBondContact OG-O 2.94Å; T94-T96 HydrophobicContact CG2-CG2 4.01Å
95	I	98.3	Very high	96.4	Very high	2 Å²	2	55.9 Å²	55.9	1%	0.01	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	108.2	172.8	-46.4	175	0	0	0	106.6	T35 V36 L38 R81 F82 L93 Y106	T35-I95 VanDerWaalsContact CA-O 3.3Å; T35-I95 WeakPolarHBondContact CA-O 3.26Å; V36-I95 HydrophobicContact CG1-CB 3.79Å; V36-I95 HydrophobicContact CG1-CD1 4.04Å; V36-I95 HydrophobicContact CG1-CG1 4.17Å; V36-I95 PolarHBondContact N-O 3.36Å; V36-I95 PolarHBondContact O-N 3.37Å; L38-I95 HydrophobicContact CD1-CD1 3.99Å; L38-I95 HydrophobicContact CD1-CG1 4.36Å; R81-I95 WeakPolarHBondContact O-CA 3.31Å; F82-I95 HydrophobicContact CD1-CB 4.5Å; F82-I95 HydrophobicContact CD1-CD1 4.09Å; F82-I95 HydrophobicContact CD1-CG1 3.72Å; F82-I95 HydrophobicContact CD1-CG2 4.29Å; F82-I95 HydrophobicContact CE1-CB 4.42Å; F82-I95 HydrophobicContact CE1-CD1 3.56Å; F82-I95 HydrophobicContact CE1-CG1 3.67Å; F82-I95 HydrophobicContact CE1-CG2 3.95Å; F82-I95 HydrophobicContact CE2-CG2 4.43Å; F82-I95 HydrophobicContact CZ-CD1 4.4Å; F82-I95 HydrophobicContact CZ-CG2 4.03Å; L93-I95 HydrophobicContact CD2-CD1 4.5Å; L93-I95 HydrophobicContact CG-CG1 4.3Å; I95-Y106 HydrophobicContact CD1-CE1 3.81Å; I95-Y106 HydrophobicContact CD1-CE2 4.43Å
96	T	98.4	Very high	96.4	Very high	61 Å²	61	54.7 Å²	54.7	37%	0.374	32%	0.315	S	S	.	.			trans	-90.7	156	173.2	58.8	0	0	0	0	110.1	T35 R81 T94 A98	T35-T96 HydrophobicContact CG2-CG2 4.02Å; R81-T96 VanDerWaalsContact CB-O 3.26Å; R81-T96 WeakPolarHBondContact CB-O 3.26Å; R81-T96 PolarHBondContact O-N 3.09Å; R81-T96 PolarHBondContact O-OG1 3.02Å; T94-T96 HydrophobicContact CG2-CG2 4.01Å; T96-A98 VanDerWaalsContact C-N 3.3Å; T96-A98 PolarHBondContact O-N 3.03Å
97	G	98.1	Very high	96.3	Very high	32 Å²	32	55.3 Å²	55.3	33%	0.33	32%	0.315	S	S	.	.	S	Bend	trans	56.7	43.3	175.3	0	0	0	0	0	113.4	G33 G34 Q99	G33-G97 WeakPolarHBondContact O-CA 3.19Å; G34-G97 PolarHBondContact O-N 3.41Å; G97-Q99 WeakPolarHBondContact O-CG 3.46Å; G97-Q99 PolarHBondContact O-N 3.4Å
98	A	97.1	Very high	96.3	Very high	10 Å²	10	52 Å²	52	8%	0.083	30%	0.299	C	S	.	.			trans	-52.6	135.3	-172.4	0	0	0	0	0	112.4	T30 G33 G34 T96	T30-A98 HydrophobicContact CG2-CB 3.59Å; G33-A98 PolarHBondContact N-O 3.37Å; G34-A98 PolarHBondContact O-N 2.85Å; T96-A98 VanDerWaalsContact C-N 3.3Å; T96-A98 PolarHBondContact O-N 3.03Å
99	Q	96.3	Very high	96.2	Very high	92 Å²	92	51 Å²	51	43%	0.43	28%	0.284	S	S	.	.			trans	-114.8	164.7	-176.3	-56	-172.2	-0.1	0	0	110.9	G97 E101 D102	G97-Q99 WeakPolarHBondContact O-CG 3.46Å; G97-Q99 PolarHBondContact O-N 3.4Å; Q99-E101 HydrophobicContact CB-CG 3.85Å; Q99-E101 PolarHBondContact O-N 3.34Å; Q99-E101 PolarHBondContact OE1-OE1 3.14Å; Q99-D102 PolarHBondContact N-OD2 2.93Å; Q99-D102 VanDerWaalsContact O-CB 3.32Å; Q99-D102 WeakPolarHBondContact O-CB 3.25Å; Q99-D102 PolarHBondContact O-N 2.98Å
100	T	93	Very high	96.1	Very high	129 Å²	129	48 Å²	48	79%	0.791	27%	0.268	S	S	*	.	G	3₁₀ helix	trans	-60.3	-32.1	178.3	-50.9	0	0	0	0	112.4	D102 D103	T100-D102 PolarHBondContact O-N 3.48Å; T100-D103 WeakPolarHBondContact O-CB 3.46Å; T100-D103 PolarHBondContact O-N 3.29Å
101	E	91.9	Very high	95.9	Very high	125 Å²	125	51.9 Å²	51.9	58%	0.584	28%	0.281	S	S	*	.	G	3₁₀ helix	trans	-70	-12.9	174.6	60.2	-176.4	-134.9	0	0	114.2	R81 Q99 D103	R81-E101 IonicContact CZ-OE1 3.78Å; R81-E101 IonicContact NH1-OE1 3.59Å; R81-E101 IonicContact NH2-OE1 2.74Å; R81-E101 PolarHBondContact NH2-OE1 2.86Å; Q99-E101 HydrophobicContact CB-CG 3.85Å; Q99-E101 PolarHBondContact O-N 3.34Å; Q99-E101 PolarHBondContact OE1-OE1 3.14Å; E101-D103 VanDerWaalsContact C-N 3.32Å
102	D	93.7	Very high	95.3	Very high	14 Å²	14	55.5 Å²	55.5	8%	0.075	30%	0.295	C	S	.	.	G	3₁₀ helix	trans	-86.7	-5.2	177.3	-57.6	-32.6	0	0	0	111.9	R81 F82 Q99 T100 A104 Y106	R81-D102 IonicContact CZ-OD1 3.67Å; R81-D102 IonicContact CZ-OD2 3.6Å; R81-D102 IonicContact NE-OD1 3.04Å; R81-D102 PolarHBondContact NE-OD1 3.42Å; R81-D102 IonicContact NE-OD2 3.49Å; R81-D102 PolarHBondContact NE-OD2 2.85Å; R81-D102 IonicContact NH2-OD1 2.71Å; R81-D102 PolarHBondContact NH2-OD1 3.23Å; R81-D102 IonicContact NH2-OD2 3.58Å; F82-D102 VanDerWaalsContact CZ-OD1 3.26Å; F82-D102 WeakPolarHBondContact CZ-OD1 3.27Å; Q99-D102 PolarHBondContact N-OD2 2.93Å; Q99-D102 VanDerWaalsContact O-CB 3.32Å; Q99-D102 WeakPolarHBondContact O-CB 3.25Å; Q99-D102 PolarHBondContact O-N 2.98Å; T100-D102 PolarHBondContact O-N 3.48Å; D102-A104 PolarHBondContact O-N 2.65Å; D102-A104 VanDerWaalsContact O-N 3.15Å; D102-Y106 VanDerWaalsContact O-CE2 3.32Å; D102-Y106 WeakPolarHBondContact O-CE2 3.41Å; D102-Y106 PolarHBondContact O-OH 3.46Å
103	D	93.4	Very high	94.2	Very high	138 Å²	138	58.1 Å²	58.1	74%	0.738	31%	0.313	S	S	*	.			trans	-73.1	101.4	172.5	-169.1	4.3	0	0	0	109.9	T100 E101	T100-D103 WeakPolarHBondContact O-CB 3.46Å; T100-D103 PolarHBondContact O-N 3.29Å; E101-D103 VanDerWaalsContact C-N 3.32Å
104	A	93.9	Very high	92.6	Very high	25 Å²	25	62.6 Å²	62.6	21%	0.207	34%	0.341	C	S	.	.	S	Bend	trans	-162.5	170.3	-167.3	0	0	0	0	0	111.5	Q57 E58 D102 Y106	Q57-A104 HydrophobicContact CG-CB 3.68Å; Q57-A104 VanDerWaalsContact NE2-CB 3.33Å; E58-A104 WeakPolarHBondContact O-CB 3.42Å; D102-A104 PolarHBondContact O-N 2.65Å; D102-A104 VanDerWaalsContact O-N 3.15Å; A104-Y106 HydrophobicContact CB-CE2 3.96Å; A104-Y106 VanDerWaalsContact O-CD2 3.29Å; A104-Y106 WeakPolarHBondContact O-CD2 3.42Å; A104-Y106 WeakPolarHBondContact O-CE2 3.45Å
105	M	95.8	Very high	90.3	Very high	98 Å²	98	70 Å²	70	48%	0.483	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	134	167.2	-70.7	-55.6	-45.1	0	0	110.1	Q57 E58 F107	Q57-M105 CarbonylContact C-O 3.29Å; Q57-M105 WeakPolarHBondContact CA-O 3.36Å; E58-M105 HydrophobicContact CB-CB 4.15Å; E58-M105 PolarHBondContact N-O 3.16Å; E58-M105 PolarHBondContact O-N 2.98Å; M105-F107 HydrophobicContact CB-CE2 3.77Å; M105-F107 HydrophobicContact CB-CZ 3.98Å; M105-F107 HydrophobicContact CE-CZ 4.31Å
106	Y	96.9	Very high	87.7	Confident	19 Å²	19	81.7 Å²	81.7	8%	0.075	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	139.3	177.8	-65.5	-95.1	0	0	0	109.6	Q24 L38 V56 Q57 L67 F82 L93 I95 D102 A104	Q24-Y106 PolarHBondContact NE2-O 3.02Å; L38-Y106 HydrophobicContact CD2-CD2 4.14Å; L38-Y106 HydrophobicContact CD2-CG 3.87Å; V56-Y106 WeakPolarHBondContact O-CA 3.45Å; Q57-Y106 HydrophobicContact CB-CD1 4.16Å; Q57-Y106 HydrophobicContact CB-CE1 4.07Å; Q57-Y106 HydrophobicContact CG-CD1 4.16Å; Q57-Y106 HydrophobicContact CG-CE1 3.77Å; Q57-Y106 PolarHBondContact NE2-OH 2.92Å; Q57-Y106 VanDerWaalsContact NE2-OH 3.16Å; L67-Y106 HydrophobicContact CD1-CD1 3.74Å; L67-Y106 HydrophobicContact CD1-CE1 3.68Å; F82-Y106 HydrophobicContact CE1-CE1 4.08Å; L93-Y106 HydrophobicContact CD2-CD1 3.86Å; L93-Y106 HydrophobicContact CD2-CE1 4.31Å; I95-Y106 HydrophobicContact CD1-CE1 3.81Å; I95-Y106 HydrophobicContact CD1-CE2 4.43Å; D102-Y106 VanDerWaalsContact O-CE2 3.32Å; D102-Y106 WeakPolarHBondContact O-CE2 3.41Å; D102-Y106 PolarHBondContact O-OH 3.46Å; A104-Y106 HydrophobicContact CB-CE2 3.96Å; A104-Y106 VanDerWaalsContact O-CD2 3.29Å; A104-Y106 WeakPolarHBondContact O-CD2 3.42Å; A104-Y106 WeakPolarHBondContact O-CE2 3.45Å
107	F	96.5	Very high	87.2	Confident	75 Å²	75	82.7 Å²	82.7	33%	0.329	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	143	178.7	-54.5	-87.5	0	0	0	110.8	V56 E58 F64 M105	V56-F107 HydrophobicContact CG2-CB 3.72Å; V56-F107 HydrophobicContact CG2-CD2 4.34Å; V56-F107 PolarHBondContact N-O 3.01Å; V56-F107 PolarHBondContact O-N 3.34Å; E58-F107 HydrophobicContact CB-CE2 3.91Å; E58-F107 WeakPolarHBondContact OE2-CE2 3.32Å; F64-F107 HydrophobicContact CE1-CD2 4.13Å; F64-F107 HydrophobicContact CE1-CE2 4.05Å; M105-F107 HydrophobicContact CB-CE2 3.77Å; M105-F107 HydrophobicContact CB-CZ 3.98Å; M105-F107 HydrophobicContact CE-CZ 4.31Å
108	C	96.2	Very high	86.6	Confident	14 Å²	14	85.4 Å²	85.4	10%	0.095	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.5	138.6	167.8	69.4	0	0	0	0	111.5	V22 Q24 C40 N54 W55	V22-C108 WeakPolarHBondContact CG1-SG 3.46Å; Q24-C108 VanDerWaalsContact OE1-N 3.13Å; C40-C108 HydrophobicContact CB-CB 3.45Å; C40-C108 VanDerWaalsContact CB-CB 3.45Å; C40-C108 WeakPolarHBondContact CB-SG 3.47Å; C40-C108 WeakPolarHBondContact SG-CB 3.48Å; C40-C108 CovalentContact SG-SG 2.02Å; C40-C108 PolarHBondContact SG-SG 2.95Å; N54-C108 WeakPolarHBondContact O-CA 3.28Å; W55-C108 HydrophobicContact CD2-CB 4.22Å; W55-C108 HydrophobicContact CE3-CB 3.99Å; W55-C108 HydrophobicContact CH2-CB 4.1Å; W55-C108 HydrophobicContact CZ2-CB 4.31Å; W55-C108 HydrophobicContact CZ3-CB 3.93Å
109	A	94.8	Very high	86	Confident	53 Å²	53	89.6 Å²	89.6	44%	0.438	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	125.8	172.2	0	0	0	0	0	109.4	A53 N54	A53-A109 CarbonylContact C-O 3.36Å; A53-A109 WeakPolarHBondContact CA-O 3.33Å; N54-A109 PolarHBondContact N-O 3.14Å; N54-A109 PolarHBondContact O-N 3.44Å
110	L	94.1	Very high	85.4	Confident	27 Å²	27	89.4 Å²	89.4	14%	0.141	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	129.9	178.8	-62.7	-175.5	0	0	0	110.7	V22 V47 Y52 A53 Y112	V22-L110 HydrophobicContact CG1-CD1 4.36Å; V22-L110 HydrophobicContact CG1-CG 4.26Å; V22-L110 HydrophobicContact CG2-CB 4.36Å; V22-L110 HydrophobicContact CG2-CD1 3.96Å; V22-L110 HydrophobicContact CG2-CG 4.01Å; V47-L110 HydrophobicContact CG1-CD2 3.9Å; V47-L110 HydrophobicContact CG2-CD1 3.9Å; V47-L110 HydrophobicContact CG2-CD2 3.88Å; Y52-L110 WeakPolarHBondContact O-CA 3.42Å; A53-L110 HydrophobicContact CB-CD2 3.63Å; L110-Y112 HydrophobicContact CB-CE2 3.99Å; L110-Y112 WeakPolarHBondContact CD1-OH 3.2Å
111	W	91.8	Very high	84.9	Confident	153 Å²	153	86.9 Å²	86.9	58%	0.58	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.3	123.8	167.5	-173.8	-88.3	0	0	0	108.8	N51 Y52	N51-W111 CarbonylContact C-O 3.5Å; N51-W111 VanDerWaalsContact CA-O 3.26Å; N51-W111 WeakPolarHBondContact CA-O 3.42Å; Y52-W111 HydrophobicContact CD2-CB 4.11Å; Y52-W111 HydrophobicContact CE1-CB 4.46Å; Y52-W111 AromaticContact CE1-CD1 3.92Å; Y52-W111 HydrophobicContact CE1-CG 4.45Å; Y52-W111 HydrophobicContact CE2-CB 3.72Å; Y52-W111 HydrophobicContact CE2-CG 4.2Å; Y52-W111 AromaticContact CZ-CD1 3.74Å; Y52-W111 AromaticContact CZ-CG 3.92Å; Y52-W111 PolarHBondContact N-O 2.93Å; Y52-W111 VanDerWaalsContact N-O 3.07Å; Y52-W111 PolarHBondContact O-N 3.5Å
112	Y	86.6	Confident	84.5	Confident	77 Å²	77	84.4 Å²	84.4	30%	0.302	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	116.6	173.8	-61.3	-86.6	0	0	0	108.5	A20 S42 N51 L110 T114	A20-Y112 HydrophobicContact CB-CE2 4.37Å; S42-Y112 VanDerWaalsContact CB-OH 3.25Å; S42-Y112 WeakPolarHBondContact CB-OH 3.43Å; S42-Y112 PolarHBondContact OG-OH 3.3Å; N51-Y112 HydrophobicContact CB-CD1 4.19Å; N51-Y112 WeakPolarHBondContact OD1-CA 3.43Å; L110-Y112 HydrophobicContact CB-CE2 3.99Å; L110-Y112 WeakPolarHBondContact CD1-OH 3.2Å; Y112-T114 PolarHBondContact O-N 3.48Å
113	S	73.4	Confident	83.8	Confident	54 Å²	54	89.4 Å²	89.4	38%	0.378	45%	0.446	S	S	.	.			trans	-72.8	101	166.5	-176.7	0	0	0	0	107.2	S50 N51 H115	S50-S113 WeakPolarHBondContact O-CB 3.47Å; S50-S113 PolarHBondContact O-N 2.82Å; N51-S113 PolarHBondContact OD1-N 3.07Å; N51-S113 VanDerWaalsContact OD1-N 3.12Å; S113-H115 PolarHBondContact O-N 2.94Å
114	T	65.6	Low	83.1	Confident	94 Å²	94	85.7 Å²	85.7	58%	0.577	42%	0.424	S	S	*	.			trans	-63.4	104.8	170.8	51.7	0	0	0	0	108.4	Y112 F116	Y112-T114 PolarHBondContact O-N 3.48Å; T114-F116 HydrophobicContact CG2-CE2 3.96Å; T114-F116 HydrophobicContact CG2-CZ 4.25Å; T114-F116 PolarHBondContact O-N 3.42Å; T114-F116 WeakPolarHBondContact OG1-CE2 3.38Å
115	H	50.3	Low	82.2	Confident	177 Å²	177	90.8 Å²	90.8	82%	0.819	44%	0.442	S	S	*	.			trans	-78.4	97.2	152.7	-88	-54.6	0	0	0	106.4	S113	S113-H115 PolarHBondContact O-N 2.94Å
116	F	44	Very low	80.9	Confident	248 Å²	248	90.1 Å²	90.1	100%	1.088	44%	0.438	S	S	*	.			trans	-76.1	0	152.2	-64.6	-77	0	0	0	108.6	T114	T114-F116 HydrophobicContact CG2-CE2 3.96Å; T114-F116 HydrophobicContact CG2-CZ 4.25Å; T114-F116 PolarHBondContact O-N 3.42Å; T114-F116 WeakPolarHBondContact OG1-CE2 3.38Å

Retrieved 116 of 116 residues in 103.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).